Citrus Sinensis ID: 040341

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY
cHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccc
ccHHHHHHHHHcHHHHcEcccccEccccccHHHHHHHHHHHHHHHccEccEEEEEEccccccEEccccEEcHHHcccccHccEEEcHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHcccccEEEEcHHHHccHHHHHHHHHHHHHHccEEEEEcccEcccccHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccHHHcccccccc
MFLQAVIKKKygqdatnvgdeggfapniqesYEGFELLKTAIAKGGYIGKIVIGMDVaasefydskdktydlnfkeenndgsqkvsgdgLKNVYRSfisdhpivsiedpfdqddwEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRagwgvmashrsgetedTFIADLSVglatgqiktgapcrsERLAKYNQLLRIEEelgpaaiyagtkfrapvepy
MFLQAVIKkkygqdatnvgdeggFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFkeenndgsqkvsgDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKtcnalllkvnqigsvteSIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGqiktgapcrsERLAKYNQLLRIEEelgpaaiyagtkfrapvepy
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY
*****************VGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDL*****************LKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHR**ETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKF*******
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFK*************GLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAP****
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPV***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q42971446 Enolase OS=Oryza sativa s yes no 0.992 0.558 0.867 1e-128
P42895446 Enolase 2 OS=Zea mays GN= N/A no 0.992 0.558 0.855 1e-126
P42896445 Enolase OS=Ricinus commun N/A no 0.988 0.557 0.863 1e-125
Q9LEI9445 Enolase 2 OS=Hevea brasil N/A no 0.988 0.557 0.867 1e-125
Q9LEJ0445 Enolase 1 OS=Hevea brasil N/A no 0.988 0.557 0.855 1e-124
P26301446 Enolase 1 OS=Zea mays GN= N/A no 0.992 0.558 0.839 1e-122
P26300444 Enolase OS=Solanum lycope N/A no 0.988 0.558 0.843 1e-122
P25696444 Bifunctional enolase 2/tr yes no 0.988 0.558 0.835 1e-121
Q43130444 Enolase OS=Mesembryanthem N/A no 0.988 0.558 0.823 1e-120
Q43321440 Enolase OS=Alnus glutinos N/A no 0.968 0.552 0.839 1e-116
>sp|Q42971|ENO_ORYSJ Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  457 bits (1176), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/249 (86%), Positives = 234/249 (93%)

Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
           L++VIKKKYGQDATNVGDEGGFAPNIQE+ EG ELLKTAI K GY GK+VIGMDVAASEF
Sbjct: 198 LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEF 257

Query: 63  YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
           Y+ KDKTYDLNFKEENNDGSQK+SGD LKNVY+SF+S++PIVSIEDPFDQDDWEH+A++T
Sbjct: 258 YNDKDKTYDLNFKEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 317

Query: 123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
            +IG  VQIVGDDLLVTNP RV KAI+EK+CNALLLKVNQIGSVTESIEAVKMSKRAGWG
Sbjct: 318 AEIGEQVQIVGDDLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWG 377

Query: 183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
           VM SHRSGETEDTFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG AA+YAG 
Sbjct: 378 VMTSHRSGETEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGA 437

Query: 243 KFRAPVEPY 251
           KFRAPVEPY
Sbjct: 438 KFRAPVEPY 446

Oryza sativa subsp. japonica (taxid: 39947)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1
>sp|P42895|ENO2_MAIZE Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1 Back     alignment and function description
>sp|P42896|ENO_RICCO Enolase OS=Ricinus communis PE=2 SV=1 Back     alignment and function description
>sp|Q9LEI9|ENO2_HEVBR Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LEJ0|ENO1_HEVBR Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1 Back     alignment and function description
>sp|P26301|ENO1_MAIZE Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1 Back     alignment and function description
>sp|P26300|ENO_SOLLC Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1 Back     alignment and function description
>sp|P25696|ENO2_ARATH Bifunctional enolase 2/transcriptional activator OS=Arabidopsis thaliana GN=ENO2 PE=1 SV=1 Back     alignment and function description
>sp|Q43130|ENO_MESCR Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1 Back     alignment and function description
>sp|Q43321|ENO_ALNGL Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
225455555 445 PREDICTED: enolase [Vitis vinifera] gi|2 0.992 0.559 0.895 1e-130
356530953 445 PREDICTED: enolase-like [Glycine max] 0.992 0.559 0.887 1e-129
356559925 445 PREDICTED: enolase-like [Glycine max] 0.992 0.559 0.887 1e-129
224482647 445 enolase [Annona cherimola] 0.992 0.559 0.895 1e-129
357498709 434 Enolase [Medicago truncatula] gi|3554946 0.996 0.576 0.88 1e-129
224136806 445 predicted protein [Populus trichocarpa] 0.992 0.559 0.883 1e-129
255539693 445 enolase, putative [Ricinus communis] gi| 0.992 0.559 0.875 1e-127
218184182 447 hypothetical protein OsI_32842 [Oryza sa 0.992 0.557 0.867 1e-126
110288669 480 Enolase, putative, expressed [Oryza sati 0.992 0.518 0.867 1e-126
110288667 480 Enolase, putative, expressed [Oryza sati 0.992 0.518 0.867 1e-126
>gi|225455555|ref|XP_002267091.1| PREDICTED: enolase [Vitis vinifera] gi|296084129|emb|CBI24517.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/249 (89%), Positives = 238/249 (95%)

Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
           L++VIKKKYGQDATNVGDEGGFAPNIQE+ EG ELLKTAIAK GY GK+VIGMDVAASEF
Sbjct: 197 LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEF 256

Query: 63  YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
           YD+KDKTYDLNFKEENNDGSQK+SGD LKNVY+SF++D+PIVSIEDPFDQDDWEH+A++T
Sbjct: 257 YDNKDKTYDLNFKEENNDGSQKISGDSLKNVYKSFVNDYPIVSIEDPFDQDDWEHYAKMT 316

Query: 123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
            +IG  VQIVGDDLLVTNPKRVEKAIKEK CNALLLKVNQIGSVTESIEAVKMSKRAGWG
Sbjct: 317 SEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWG 376

Query: 183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
           VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG AA+YAG 
Sbjct: 377 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGA 436

Query: 243 KFRAPVEPY 251
           KFRAPVEPY
Sbjct: 437 KFRAPVEPY 445

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356530953|ref|XP_003534043.1| PREDICTED: enolase-like [Glycine max] Back     alignment and taxonomy information
>gi|356559925|ref|XP_003548246.1| PREDICTED: enolase-like [Glycine max] Back     alignment and taxonomy information
>gi|224482647|gb|ACN50180.1| enolase [Annona cherimola] Back     alignment and taxonomy information
>gi|357498709|ref|XP_003619643.1| Enolase [Medicago truncatula] gi|355494658|gb|AES75861.1| Enolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224136806|ref|XP_002322420.1| predicted protein [Populus trichocarpa] gi|118484871|gb|ABK94302.1| unknown [Populus trichocarpa] gi|222869416|gb|EEF06547.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255539693|ref|XP_002510911.1| enolase, putative [Ricinus communis] gi|223550026|gb|EEF51513.1| enolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|218184182|gb|EEC66609.1| hypothetical protein OsI_32842 [Oryza sativa Indica Group] gi|222612493|gb|EEE50625.1| hypothetical protein OsJ_30829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|110288669|gb|ABB46861.2| Enolase, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|110288667|gb|ABB46862.2| Enolase, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2044851444 LOS2 "LOW EXPRESSION OF OSMOTI 0.988 0.558 0.835 4.8e-110
UNIPROTKB|F1NG74434 ENO2 "Gamma-enolase" [Gallus g 0.956 0.552 0.693 1.3e-86
TAIR|locus:2031476477 ENO1 "enolase 1" [Arabidopsis 0.960 0.505 0.697 3.3e-86
WB|WBGene00011884434 enol-1 [Caenorhabditis elegans 0.960 0.555 0.693 6.9e-86
UNIPROTKB|P06733434 ENO1 "Alpha-enolase" [Homo sap 0.960 0.555 0.691 1.8e-85
ZFIN|ZDB-GENE-030131-6048432 eno1a "enolase 1a, (alpha)" [D 0.960 0.557 0.686 2.4e-85
UNIPROTKB|F1MB08434 ENO1 "Alpha-enolase" [Bos taur 0.960 0.555 0.686 3e-85
UNIPROTKB|O57391434 ENO2 "Gamma-enolase" [Gallus g 0.956 0.552 0.681 8e-85
UNIPROTKB|P51913434 ENO1 "Alpha-enolase" [Gallus g 0.956 0.552 0.681 8e-85
UNIPROTKB|F1NZ78434 ENO1 "Alpha-enolase" [Gallus g 0.956 0.552 0.677 1e-84
TAIR|locus:2044851 LOS2 "LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1087 (387.7 bits), Expect = 4.8e-110, P = 4.8e-110
 Identities = 208/249 (83%), Positives = 230/249 (92%)

Query:     3 LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
             L++VIKKKYGQDATNVGDEGGFAPNIQE+ EG ELLKTAI K GY GK+VIGMDVAASEF
Sbjct:   197 LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEF 256

Query:    63 YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
             Y S+DKTYDLNFKEENN+GSQK+SGD LK++Y+SF++++PIVSIEDPFDQDDWEH+A++T
Sbjct:   257 Y-SEDKTYDLNFKEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMT 315

Query:   123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
              + G  VQIVGDDLLVTNPKRV KAI EK+CNALLLKVNQIGSVTESIEAVKMSK+AGWG
Sbjct:   316 TECGTEVQIVGDDLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWG 375

Query:   183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
             VM SHRSGETEDTFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AIYAG 
Sbjct:   376 VMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGV 435

Query:   243 KFRAPVEPY 251
              FR PVEPY
Sbjct:   436 NFRKPVEPY 444
GO:0000015 "phosphopyruvate hydratase complex" evidence=IEA
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0004634 "phosphopyruvate hydratase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006096 "glycolysis" evidence=IEA;RCA
GO:0003677 "DNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0009409 "response to cold" evidence=IMP
GO:0009416 "response to light stimulus" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0005740 "mitochondrial envelope" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
UNIPROTKB|F1NG74 ENO2 "Gamma-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2031476 ENO1 "enolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00011884 enol-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P06733 ENO1 "Alpha-enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6048 eno1a "enolase 1a, (alpha)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB08 ENO1 "Alpha-enolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O57391 ENO2 "Gamma-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P51913 ENO1 "Alpha-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ78 ENO1 "Alpha-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q42971ENO_ORYSJ4, ., 2, ., 1, ., 1, 10.86740.99200.5582yesno
P25696ENO2_ARATH4, ., 2, ., 1, ., 1, 10.83530.98800.5585yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.110.914
3rd Layer4.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
PLN00191457 PLN00191, PLN00191, enolase 1e-170
pfam00113296 pfam00113, Enolase_C, Enolase, C-terminal TIM barr 1e-154
PTZ00081439 PTZ00081, PTZ00081, enolase; Provisional 1e-150
cd03313408 cd03313, enolase, Enolase: Enolases are homodimeri 1e-139
PRK00077425 PRK00077, eno, enolase; Provisional 1e-120
COG0148423 COG0148, Eno, Enolase [Carbohydrate transport and 1e-107
TIGR01060425 TIGR01060, eno, phosphopyruvate hydratase 1e-104
cd00308229 cd00308, enolase_like, Enolase-superfamily, charac 6e-16
cd03321355 cd03321, mandelate_racemase, Mandelate racemase (M 1e-04
cd03317354 cd03317, NAAAR, N-acylamino acid racemase (NAAAR), 6e-04
cd03315265 cd03315, MLE_like, Muconate lactonizing enzyme (ML 0.001
>gnl|CDD|215095 PLN00191, PLN00191, enolase Back     alignment and domain information 
 Score =  476 bits (1228), Expect = e-170
 Identities = 199/247 (80%), Positives = 215/247 (87%), Gaps = 3/247 (1%)

Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
           L+AVIKKKYGQDA NVGDEGGFAPNIQ++ EG ELLK AI K GY GKI IGMDVAASEF
Sbjct: 214 LKAVIKKKYGQDACNVGDEGGFAPNIQDNKEGLELLKEAIEKAGYTGKIKIGMDVAASEF 273

Query: 63  YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
           Y +KDK YDL+FKEENNDGS K SGD L ++Y+ F+SD+PIVSIEDPFDQDDWEH A+LT
Sbjct: 274 Y-TKDKKYDLDFKEENNDGSNKKSGDELIDLYKEFVSDYPIVSIEDPFDQDDWEHWAKLT 332

Query: 123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
                 VQIVGDDLLVTNPKRV KAI+EK CNALLLKVNQIG+VTESIEAVKMSK AGWG
Sbjct: 333 SLE--DVQIVGDDLLVTNPKRVAKAIQEKACNALLLKVNQIGTVTESIEAVKMSKAAGWG 390

Query: 183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
           VM SHRSGETED+FIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAG 
Sbjct: 391 VMTSHRSGETEDSFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDEAVYAGE 450

Query: 243 KFRAPVE 249
            FR PV 
Sbjct: 451 NFRKPVW 457

Length = 457
>gnl|CDD|109180 pfam00113, Enolase_C, Enolase, C-terminal TIM barrel domain Back     alignment and domain information
>gnl|CDD|240259 PTZ00081, PTZ00081, enolase; Provisional Back     alignment and domain information
>gnl|CDD|239429 cd03313, enolase, Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>gnl|CDD|234617 PRK00077, eno, enolase; Provisional Back     alignment and domain information
>gnl|CDD|223226 COG0148, Eno, Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213580 TIGR01060, eno, phosphopyruvate hydratase Back     alignment and domain information
>gnl|CDD|238188 cd00308, enolase_like, Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>gnl|CDD|239437 cd03321, mandelate_racemase, Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>gnl|CDD|239433 cd03317, NAAAR, N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>gnl|CDD|239431 cd03315, MLE_like, Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG2670433 consensus Enolase [Carbohydrate transport and meta 100.0
PF00113295 Enolase_C: Enolase, C-terminal TIM barrel domain; 100.0
COG0148423 Eno Enolase [Carbohydrate transport and metabolism 100.0
PTZ00081439 enolase; Provisional 100.0
PTZ00378518 hypothetical protein; Provisional 100.0
PLN00191457 enolase 100.0
PRK00077425 eno enolase; Provisional 100.0
cd03313408 enolase Enolase: Enolases are homodimeric enzymes 100.0
TIGR01060425 eno phosphopyruvate hydratase. Alternate name: eno 100.0
PRK08350341 hypothetical protein; Provisional 100.0
TIGR01502408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 99.84
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 99.8
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octame 99.79
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 99.79
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 99.76
cd03314369 MAL Methylaspartate ammonia lyase (3-methylasparta 99.76
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 99.76
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 99.75
cd03322361 rpsA The starvation sensing protein RpsA from E.co 99.75
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 99.75
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 99.75
cd00308229 enolase_like Enolase-superfamily, characterized by 99.74
PRK15129321 L-Ala-D/L-Glu epimerase; Provisional 99.74
PRK14017382 galactonate dehydratase; Provisional 99.73
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 99.72
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 99.72
PRK02714320 O-succinylbenzoate synthase; Provisional 99.72
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 99.71
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 99.71
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 99.71
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 99.7
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 99.69
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 99.69
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 99.68
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 99.67
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 99.66
PRK05105322 O-succinylbenzoate synthase; Provisional 99.65
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 99.62
PRK02901327 O-succinylbenzoate synthase; Provisional 99.56
PRK15440394 L-rhamnonate dehydratase; Provisional 99.48
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.42
PF07476248 MAAL_C: Methylaspartate ammonia-lyase C-terminus; 99.1
PF13378111 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FC 98.56
PF0118867 MR_MLE: Mandelate racemase / muconate lactonizing 98.33
COG3799410 Mal Methylaspartate ammonia-lyase [Amino acid tran 97.81
COG1441321 MenC O-succinylbenzoate synthase [Coenzyme metabol 96.93
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 96.79
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.86
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 95.85
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.74
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 95.72
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.43
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 95.36
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 95.21
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 94.85
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 94.58
TIGR03586327 PseI pseudaminic acid synthase. 94.26
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 94.21
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 94.16
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 94.0
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 93.61
KOG2367 560 consensus Alpha-isopropylmalate synthase/homocitra 93.22
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 93.21
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 92.79
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 92.78
PRK05481289 lipoyl synthase; Provisional 92.51
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 92.48
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 92.33
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 92.13
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 91.97
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 91.87
PF00682237 HMGL-like: HMGL-like of this family is not conserv 91.72
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 91.62
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 91.18
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 90.74
PRK09389 488 (R)-citramalate synthase; Provisional 90.45
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 90.24
TIGR00612 346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 89.54
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 88.62
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 88.53
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 88.47
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 88.37
PRK00915 513 2-isopropylmalate synthase; Validated 87.88
PLN02321 632 2-isopropylmalate synthase 87.79
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.49
PF04551 359 GcpE: GcpE protein; InterPro: IPR004588 This prote 86.33
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 85.99
TIGR03217 333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 85.74
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 84.92
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 84.9
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 83.73
COG2089 347 SpsE Sialic acid synthase [Cell envelope biogenesi 83.68
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 83.6
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 83.4
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 83.28
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 82.64
PRK07094323 biotin synthase; Provisional 82.59
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 82.37
PRK08508279 biotin synthase; Provisional 81.77
PRK12928290 lipoyl synthase; Provisional 81.73
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 81.6
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 81.47
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 81.08
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 80.55
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 80.46
>KOG2670 consensus Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-95  Score=652.80  Aligned_cols=243  Identities=71%  Similarity=1.108  Sum_probs=240.3

Q ss_pred             ChHHHHHHHhcCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHhcCCccceeeeeehhhhcccccCCcceeecCCCCCCC
Q 040341            1 MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENND   80 (251)
Q Consensus         1 ~~lk~~l~~~~g~~~~~vgdeGGfap~~~~~eeal~~i~~Ai~~aGy~~kI~iglD~Aase~~~~~~g~Y~l~~~~~~~d   80 (251)
                      |+||.+||+|||..+|+|||||||||++.+++|+|++|.+||+++||++||+||||+|||+||++  |+|+|+|++|..|
T Consensus       191 h~LK~vik~kyG~~a~nVGDEGGfAPnI~~~~E~L~Li~~Ai~kagyt~kikIgmDvAaseF~~d--gkYDLdfk~~~~d  268 (433)
T KOG2670|consen  191 HHLKSVIKEKYGADATNVGDEGGFAPNIQTNEEALDLIKEAINKAGYTGKVKIGMDVAASEFYKD--GKYDLDFKSPNSD  268 (433)
T ss_pred             HHHHHHHHHHhCccccccccccCcCCCccchHHHHHHHHHHHHhcCCCCceEEEEeechhhhhcC--CcccccCcCCCCC
Confidence            79999999999999999999999999999999999999999999999999999999999999998  9999999999999


Q ss_pred             CCCccChhhHHHHHHHhhhcCCceeecCCCCcccHHHHHHHHhhhCCceEEEcccccccCHHHHHHHHhccCcceeEeec
Q 040341           81 GSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKV  160 (251)
Q Consensus        81 ~~~~~s~~elid~~~~l~~~ypI~~IEDP~~e~D~~~~~~l~~~lg~~~~ivgDdl~vtn~~~i~~~i~~~a~n~ilIK~  160 (251)
                      +.+++|+++|.|+|++++++|||+||||||++|||++|++|....  .+|||||||+||||+||++|+++++||++|+|+
T Consensus       269 ~s~~~s~~~L~dlY~~~~k~yPivSiEDPFdqdDw~~w~~~~~~~--~iqiVgDDLtvTnpkri~~Ai~~k~cN~LLlKv  346 (433)
T KOG2670|consen  269 PSRWLSGDQLADLYKSFIKDYPIVSIEDPFDQDDWEAWSKFFKEV--GIQIVGDDLTVTNPKRIATAIEEKACNALLLKV  346 (433)
T ss_pred             cccccCHHHHHHHHHHHHhcCCeeeecCCcchhhHHHHHHHhhcc--ceEEecCcccccCHHHHHHHHHHhhccceEeec
Confidence            999999999999999999999999999999999999999999887  899999999999999999999999999999999


Q ss_pred             cccccHHHHHHHHHHHHHcCCcEEEecCCCCCCchhHhhhhhhcccCccccCCCCchhHHHHhhHHHHHHHHhCCCcccc
Q 040341          161 NQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYA  240 (251)
Q Consensus       161 nqiGtlte~l~~~~~a~~~g~~~ivs~rsgEt~d~~iadLAva~~~~~ik~G~~~r~Er~aKyN~llrie~~l~~~~~~~  240 (251)
                      ||||||||+++++++|+++||+||||||||||+|+||+||.||+++||||+|+||||||++||||||||||||++.++|+
T Consensus       347 NQIGtvtEsiea~~~a~~~gwgvmvSHRSGETeDtFIaDL~VGl~tgqIKtGApcRsERlaKYNqLLRIeEelg~~a~~a  426 (433)
T KOG2670|consen  347 NQIGTVTESIEAAKLARSAGWGVMVSHRSGETEDTFIADLVVGLGTGQIKTGAPCRSERLAKYNQLLRIEEELGDDARYA  426 (433)
T ss_pred             cccccHHHHHHHHHHHHhcCceEEEeccCCCcccchHHHhhhhhccceeecCCCchHHHHHHHHHHHHHHHHhcccceec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCC
Q 040341          241 GTKFRAP  247 (251)
Q Consensus       241 ~~~~~~~  247 (251)
                      |.+||+|
T Consensus       427 G~~f~~~  433 (433)
T KOG2670|consen  427 GENFRNP  433 (433)
T ss_pred             cccccCC
Confidence            9999987

>PF00113 Enolase_C: Enolase, C-terminal TIM barrel domain; InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ] Back     alignment and domain information
>COG0148 Eno Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00081 enolase; Provisional Back     alignment and domain information
>PTZ00378 hypothetical protein; Provisional Back     alignment and domain information
>PLN00191 enolase Back     alignment and domain information
>PRK00077 eno enolase; Provisional Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>TIGR01060 eno phosphopyruvate hydratase Back     alignment and domain information
>PRK08350 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>PRK15129 L-Ala-D/L-Glu epimerase; Provisional Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK15440 L-rhamnonate dehydratase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF07476 MAAL_C: Methylaspartate ammonia-lyase C-terminus; InterPro: IPR022662 Methylaspartate ammonia-lyase 4 Back     alignment and domain information
>PF13378 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FCP_B 3P0W_D 3VFC_A 3VDG_A 3FJ4_B 3CT2_B 3DGB_A 3V3W_A 3V4B_A 3NO1_E Back     alignment and domain information
>PF01188 MR_MLE: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain; InterPro: IPR013342 Mandelate racemase 5 Back     alignment and domain information
>COG3799 Mal Methylaspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1441 MenC O-succinylbenzoate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG2367 consensus Alpha-isopropylmalate synthase/homocitrate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2psn_A434 Crystal Structure Of Enolase1 Length = 434 6e-95
3b97_A433 Crystal Structure Of Human Enolase 1 Length = 433 6e-95
1pdz_A434 X-Ray Structure And Catalytic Mechanism Of Lobster 4e-94
1te6_A439 Crystal Structure Of Human Neuron Specific Enolase 6e-94
3uje_A443 Asymmetric Complex Of Human Neuron Specific Enolase 6e-94
3ucc_A439 Asymmetric Complex Of Human Neuron Specific Enolase 7e-94
2xsx_A435 Crystal Structure Of Human Beta Enolase Enob Length 3e-92
3otr_A452 2.75 Angstrom Crystal Structure Of Enolase 1 From T 7e-85
1els_A436 Catalytic Metal Ion Binding In Enolase: The Crystal 9e-78
1l8p_A436 Mg-phosphonoacetohydroxamate Complex Of S39a Yeast 1e-77
1ebg_A436 Chelation Of Ser 39 To Mg2+ Latches A Gate At The A 1e-77
2al2_B436 Crystal Structure Analysis Of Enolase Mg Subunit Co 1e-77
1p43_A436 Reverse Protonation Is The Key To General Acid-Base 1e-77
3qtp_A441 Crystal Structure Analysis Of Entamoeba Histolytica 2e-77
1p48_A436 Reverse Protonation Is The Key To General Acid-Base 3e-77
2xgz_A443 Engineering The Enolase Active Site Pocket: Crystal 3e-77
2xh0_A443 Engineering The Enolase Active Site Pocket: Crystal 3e-77
2xh4_A443 Engineering The Enolase Active Site Pocket: Crystal 4e-77
2xh7_A443 Engineering The Enolase Active Site Pocket: Crystal 4e-77
2xh2_A443 Engineering The Enolase Active Site Pocket: Crystal 4e-77
2al2_A436 Crystal Structure Analysis Of Enolase Mg Subunit Co 4e-77
4g7f_A429 Crystal Structure Of Enolase From Trypanosoma Cruzi 6e-73
1oep_A432 Structure Of Trypanosoma Brucei Enolase Reveals The 2e-71
2ptw_A432 Crystal Structure Of The T. Brucei Enolase Complexe 2e-71
2pa6_A427 Crystal Structure Of Mj0232 From Methanococcus Jann 5e-66
1iyx_A432 Crystal Structure Of Enolase From Enterococcus Hira 2e-59
3uj2_A449 Crystal Structure Of An Enolase From Anaerostipes C 2e-58
4a3r_A430 Crystal Structure Of Enolase From Bacillus Subtilis 4e-58
4ewj_A443 Structure Of The Enloase From Streptococcus Suis Se 3e-55
1w6t_A444 Crystal Structure Of Octameric Enolase From Strepto 6e-55
1e9i_A431 Enolase From E.Coli Length = 431 3e-53
3h8a_A432 Crystal Structure Of E. Coli Enolase Bound To Its C 3e-53
3qn3_A417 Phosphopyruvate Hydratase From Campylobacter Jejuni 3e-49
3tqp_A428 Structure Of An Enolase (Eno) From Coxiella Burneti 2e-48
>pdb|2PSN|A Chain A, Crystal Structure Of Enolase1 Length = 434 Back     alignment and structure 
Iteration: 1

 Score =  343 bits (880), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 198/246 (80%), Gaps = 5/246 (2%)
Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
           L+ VIK+KYG+DATNVGDEGGFAPNI E+ EG ELLKTAI K GY  K+VIGMDVAASEF
Sbjct: 192 LKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEF 251
Query: 63  YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
           + S    YDL+FK  + D S+ +S D L ++Y+SFI D+P+VSIEDPFDQDDW    + T
Sbjct: 252 FRSG--KYDLDFKSPD-DPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFT 308
Query: 123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
              G  +Q+VGDDL VTNPKR+ KA+ EK+CN LLLKVNQIGSVTES++A K+++  GWG
Sbjct: 309 ASAG--IQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWG 366
Query: 183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
           VM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELG  A +AG 
Sbjct: 367 VMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGR 426
Query: 243 KFRAPV 248
            FR P+
Sbjct: 427 NFRNPL 432
>pdb|3B97|A Chain A, Crystal Structure Of Human Enolase 1 Length = 433 Back     alignment and structure
>pdb|1PDZ|A Chain A, X-Ray Structure And Catalytic Mechanism Of Lobster Enolase Length = 434 Back     alignment and structure
>pdb|1TE6|A Chain A, Crystal Structure Of Human Neuron Specific Enolase At 1.8 Angstrom Length = 439 Back     alignment and structure
>pdb|3UJE|A Chain A, Asymmetric Complex Of Human Neuron Specific Enolase-3-PgaPEP Length = 443 Back     alignment and structure
>pdb|3UCC|A Chain A, Asymmetric Complex Of Human Neuron Specific Enolase-1-PgaPEP Length = 439 Back     alignment and structure
>pdb|2XSX|A Chain A, Crystal Structure Of Human Beta Enolase Enob Length = 435 Back     alignment and structure
>pdb|3OTR|A Chain A, 2.75 Angstrom Crystal Structure Of Enolase 1 From Toxoplasma Gondii Length = 452 Back     alignment and structure
>pdb|1ELS|A Chain A, Catalytic Metal Ion Binding In Enolase: The Crystal Structure Of Enolase-Mn2+-Phosphonoacetohydroxamate Complex At 2.4 Angstroms Resolution Length = 436 Back     alignment and structure
>pdb|1L8P|A Chain A, Mg-phosphonoacetohydroxamate Complex Of S39a Yeast Enolase 1 Length = 436 Back     alignment and structure
>pdb|1EBG|A Chain A, Chelation Of Ser 39 To Mg2+ Latches A Gate At The Active Site Of Enolase: Structure Of The Bis(Mg2+) Complex Of Yeast Enolase And The Intermediate Analog Phosphonoacetohydroxamate At 2.1 Angstroms Resolution Length = 436 Back     alignment and structure
>pdb|2AL2|B Chain B, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>pdb|1P43|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>pdb|3QTP|A Chain A, Crystal Structure Analysis Of Entamoeba Histolytica Enolase Length = 441 Back     alignment and structure
>pdb|1P48|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>pdb|2XGZ|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH0|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n Q167k D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH4|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39a D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH7|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH2|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2AL2|A Chain A, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>pdb|4G7F|A Chain A, Crystal Structure Of Enolase From Trypanosoma Cruzi Length = 429 Back     alignment and structure
>pdb|1OEP|A Chain A, Structure Of Trypanosoma Brucei Enolase Reveals The Inhibitory Divalent Metal Site Length = 432 Back     alignment and structure
>pdb|2PTW|A Chain A, Crystal Structure Of The T. Brucei Enolase Complexed With Sulphate, Identification Of A Metal Binding Site Iv Length = 432 Back     alignment and structure
>pdb|2PA6|A Chain A, Crystal Structure Of Mj0232 From Methanococcus Jannaschii Length = 427 Back     alignment and structure
>pdb|1IYX|A Chain A, Crystal Structure Of Enolase From Enterococcus Hirae Length = 432 Back     alignment and structure
>pdb|3UJ2|A Chain A, Crystal Structure Of An Enolase From Anaerostipes Caccae (Efi Target Efi-502054) With Bound Mg And Sulfate Length = 449 Back     alignment and structure
>pdb|4A3R|A Chain A, Crystal Structure Of Enolase From Bacillus Subtilis. Length = 430 Back     alignment and structure
>pdb|4EWJ|A Chain A, Structure Of The Enloase From Streptococcus Suis Serotype 2 Length = 443 Back     alignment and structure
>pdb|1W6T|A Chain A, Crystal Structure Of Octameric Enolase From Streptococcus Pneumoniae Length = 444 Back     alignment and structure
>pdb|1E9I|A Chain A, Enolase From E.Coli Length = 431 Back     alignment and structure
>pdb|3H8A|A Chain A, Crystal Structure Of E. Coli Enolase Bound To Its Cognate Rnase E Recognition Domain Length = 432 Back     alignment and structure
>pdb|3QN3|A Chain A, Phosphopyruvate Hydratase From Campylobacter Jejuni. Length = 417 Back     alignment and structure
>pdb|3TQP|A Chain A, Structure Of An Enolase (Eno) From Coxiella Burnetii Length = 428 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
3otr_A452 Enolase; structural genomics, center for structura 1e-162
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 1e-159
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 1e-158
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 1e-155
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 1e-155
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 1e-141
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 1e-119
1w6t_A444 Enolase; bacterial infection, surface protein, moo 1e-118
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 1e-117
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 1e-116
3qn3_A417 Enolase; structural genomics, center for structura 1e-113
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 1e-13
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 4e-13
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 8e-07
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 2e-06
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 2e-06
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 2e-06
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 2e-06
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 4e-06
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 5e-06
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 7e-06
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 7e-06
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 2e-05
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 5e-05
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 7e-05
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 9e-05
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 1e-04
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 1e-04
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 1e-04
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 1e-04
3r0u_A379 Enzyme of enolase superfamily; structural genomics 1e-04
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 2e-04
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 3e-04
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Length = 452 Back     alignment and structure
 Score =  457 bits (1178), Expect = e-162
 Identities = 145/249 (58%), Positives = 183/249 (73%)

Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEF 62
           L+ VIK KYG DATNVGDEGGFAPN+  + E   LL  AI   GY GKI I  D AASEF
Sbjct: 199 LKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKAAGYEGKIKIAFDAAASEF 258

Query: 63  YDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELT 122
           Y   +K YDL++K +  + S+ ++G+ LK VY  ++  +PI+S+EDPFDQDD+   +  T
Sbjct: 259 YKQDEKKYDLDYKCKTKNASKHLTGEKLKEVYEGWLKKYPIISVEDPFDQDDFASFSAFT 318

Query: 123 GKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWG 182
             +G   Q++GDD+LVTN  R+EKA+K+K CN LLLKVNQIGSVTE+IEA  +++++GWG
Sbjct: 319 KDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQIGSVTEAIEACLLAQKSGWG 378

Query: 183 VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGT 242
           V  SHRSGETED+FIADL VGL  GQIK+G+PCRSERL KYNQL+RIEE LG   +YAG 
Sbjct: 379 VQVSHRSGETEDSFIADLVVGLRCGQIKSGSPCRSERLCKYNQLMRIEESLGADCVYAGE 438

Query: 243 KFRAPVEPY 251
            FR P   +
Sbjct: 439 SFRHPKRSH 447
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Length = 436 Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Length = 439 Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Length = 441 Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Length = 432 Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Length = 427 Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Length = 449 Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Length = 444 Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Length = 431 Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Length = 428 Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Length = 417 Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Length = 413 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Length = 413 Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Length = 388 Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Length = 342 Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Length = 368 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Length = 393 Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Length = 375 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Length = 369 Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Length = 377 Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Length = 386 Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Length = 370 Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Length = 400 Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Length = 382 Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Length = 381 Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Length = 385 Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Length = 367 Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} SCOP: c.1.11.2 d.54.1.1 PDB: 2chr_A Length = 370 Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Length = 366 Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Length = 332 Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Length = 379 Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Length = 383 Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3otr_A452 Enolase; structural genomics, center for structura 100.0
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 100.0
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 100.0
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 100.0
3qn3_A417 Enolase; structural genomics, center for structura 100.0
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 100.0
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 100.0
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 100.0
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 100.0
1w6t_A444 Enolase; bacterial infection, surface protein, moo 100.0
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 100.0
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 99.97
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 99.97
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 99.9
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 99.87
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 99.87
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 99.87
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 99.86
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 99.86
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 99.86
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 99.86
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 99.85
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 99.85
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 99.84
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 99.84
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 99.84
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 99.84
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 99.84
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 99.84
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 99.83
2poz_A392 Putative dehydratase; octamer, structural genomics 99.83
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 99.83
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 99.83
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 99.83
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 99.83
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 99.83
2qgy_A391 Enolase from the environmental genome shotgun sequ 99.82
2p3z_A415 L-rhamnonate dehydratase; enolase, structural geno 99.82
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 99.82
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 99.82
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 99.82
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 99.82
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 99.82
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 99.82
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 99.81
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 99.81
2o56_A407 Putative mandelate racemase; dehydratase, structur 99.81
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 99.81
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 99.81
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 99.81
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 99.81
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 99.81
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 99.81
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 99.8
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 99.8
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 99.8
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 99.8
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 99.8
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 99.8
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 99.8
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 99.8
2gl5_A410 Putative dehydratase protein; structural genomics, 99.8
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 99.79
3r0u_A379 Enzyme of enolase superfamily; structural genomics 99.79
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 99.79
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 99.78
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 99.78
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 99.78
1tzz_A392 Hypothetical protein L1841; structural genomics, m 99.77
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 99.77
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 99.77
3eez_A378 Putative mandelate racemase/muconate lactonizing e 99.77
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 99.77
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 99.77
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 99.77
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 99.76
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 99.76
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 99.76
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 99.76
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 99.75
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 99.75
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 99.75
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 99.75
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 99.75
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 99.74
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; e 99.74
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 99.74
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 99.74
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 99.74
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 99.74
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 99.74
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 99.73
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 99.73
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 99.73
2oz8_A389 MLL7089 protein; structural genomics, unknown func 99.73
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 99.73
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 99.73
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 99.73
3va8_A445 Probable dehydratase; enolase, magnesium binding s 99.73
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 99.73
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 99.73
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 99.71
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 99.71
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 99.7
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 99.7
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 99.7
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 99.69
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 99.69
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 99.69
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 99.68
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 99.67
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 99.67
3v5c_A392 Mandelate racemase/muconate lactonizing protein; e 99.67
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 99.65
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; st 99.65
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 99.64
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enola 99.61
4gfi_A329 Mandelate racemase/muconate lactonizing enzyme FA 99.57
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 99.54
3caw_A330 O-succinylbenzoate synthase; structural genomics, 99.48
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 96.06
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 96.01
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 95.89
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 95.21
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 95.15
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 94.74
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.62
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 94.52
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 94.2
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 93.95
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 93.83
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 91.7
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 91.11
3eeg_A 325 2-isopropylmalate synthase; 11106D, beta barrel, P 90.99
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 89.93
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 88.56
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.32
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 88.24
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 88.12
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 87.68
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 87.38
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 87.29
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 87.02
3rmj_A 370 2-isopropylmalate synthase; LEUA, truncation, neis 86.65
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 86.28
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 86.15
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 85.54
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 84.75
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 84.74
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 84.72
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 83.4
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 83.2
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 81.85
3ble_A 337 Citramalate synthase from leptospira interrogans; 81.27
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 80.15
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
Probab=100.00  E-value=6.2e-87  Score=629.93  Aligned_cols=249  Identities=58%  Similarity=0.984  Sum_probs=241.6

Q ss_pred             ChHHHHHHHhcCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHhcCCccceeeeeehhhhcccccCCcceeecCCCCCCC
Q 040341            1 MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENND   80 (251)
Q Consensus         1 ~~lk~~l~~~~g~~~~~vgdeGGfap~~~~~eeal~~i~~Ai~~aGy~~kI~iglD~Aase~~~~~~g~Y~l~~~~~~~d   80 (251)
                      |+||++|++|||..+|+|||||||+|++++++|||++|++||+++||+++|.|||||||||||+.++|+|+++|++|++|
T Consensus       197 h~Lk~vl~~k~g~~~t~vgDEGgfap~~~~~~eaL~ll~~Ai~~aGy~~~i~i~lD~Aasefy~~~~g~Y~l~fk~~~~~  276 (452)
T 3otr_A          197 HHLKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKAAGYEGKIKIAFDAAASEFYKQDEKKYDLDYKCKTKN  276 (452)
T ss_dssp             HHHHHHHHHHHCGGGGCBCTTSCBCCCCCSHHHHHHHHHHHHHHHTCTTTSEEEEECCGGGGEETTTTEEETTTTCSSCC
T ss_pred             HHHHHHHHhhcCCcccccccccccCCCCCCHHHHHHHHHHHHHHcCCCceEEEccccchHhheeccCCeEEeeccCCCCc
Confidence            78999999999888999999999999999999999999999999999999999999999999976669999999988777


Q ss_pred             CCCccChhhHHHHHHHhhhcCCceeecCCCCcccHHHHHHHHhhhCCceEEEcccccccCHHHHHHHHhccCcceeEeec
Q 040341           81 GSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKV  160 (251)
Q Consensus        81 ~~~~~s~~elid~~~~l~~~ypI~~IEDP~~e~D~~~~~~l~~~lg~~~~ivgDdl~vtn~~~i~~~i~~~a~n~ilIK~  160 (251)
                      .++.+|++||+++|++|+++|||++|||||+++||++|++|+++++++|||||||++|||+++++++|++++||+++||+
T Consensus       277 ~~~~~t~~Elid~y~~lle~ypIv~IEDPl~~dD~eg~a~Lt~~lg~~iqIvGDDl~vTn~~~i~~~Ie~~a~n~IlIKv  356 (452)
T 3otr_A          277 ASKHLTGEKLKEVYEGWLKKYPIISVEDPFDQDDFASFSAFTKDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKV  356 (452)
T ss_dssp             GGGEECHHHHHHHHHHHHHHSCEEEEECCSCTTCHHHHHHHHHHHTTTSEEEESTTTTTCHHHHHHHHHHTCCSEEEECH
T ss_pred             ccccccHHHHHHHHHHHHhhhCceEEecCCChhhHHHHHHHHHhhCCCeEEEeCccccCCHHHHHHHHhcCCCCEEEeec
Confidence            77889999999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             cccccHHHHHHHHHHHHHcCCcEEEecCCCCCCchhHhhhhhhcccCccccCCCCchhHHHHhhHHHHHHHHhCCCcccc
Q 040341          161 NQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYA  240 (251)
Q Consensus       161 nqiGtlte~l~~~~~a~~~g~~~ivs~rsgEt~d~~iadLAva~~~~~ik~G~~~r~Er~aKyN~llrie~~l~~~~~~~  240 (251)
                      ||+|||||+++++++|+++||.+|||||||||+|+||||||||++++|||+|+||||||++||||||||||||++.++|+
T Consensus       357 nQIGgITEalka~~lA~~~G~~vmvshrSGETeD~~iAdLaVgl~~gqIKtGap~rsER~aKyNqLlrIeeelg~~a~~~  436 (452)
T 3otr_A          357 NQIGSVTEAIEACLLAQKSGWGVQVSHRSGETEDSFIADLVVGLRCGQIKSGSPCRSERLCKYNQLMRIEESLGADCVYA  436 (452)
T ss_dssp             HHHCCHHHHHHHHHHHHHTTCEEEEECCSSCCSCCHHHHHHHHTTCCEEECCCSCSHHHHHHHHHHHHHHHHHGGGEEEC
T ss_pred             cccccHHHHHHHHHHHHHcCCeEEEeCCCCCCchhHHHHHHHHcCCCccccCCCcchhHHHHHHHHHHHHHHhCccceec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCC
Q 040341          241 GTKFRAPVE  249 (251)
Q Consensus       241 ~~~~~~~~~  249 (251)
                      |++||+|..
T Consensus       437 g~~~~~~~~  445 (452)
T 3otr_A          437 GESFRHPKR  445 (452)
T ss_dssp             GGGTTSCC-
T ss_pred             ccccCCCcc
Confidence            999999963
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>1r6w_A OSB synthase, O-succinylbenzoate synthase, OSBS; enolase superfamily, TIM barrel, capping alpha+beta domain, lyase; HET: 164; 1.62A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1fhv_A* 1fhu_A 2ofj_A 3gc2_A* Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>3v5c_A Mandelate racemase/muconate lactonizing protein; enolase fold, galacturonate dehydratase, double Mg site, LYA; 1.53A {Paenibacillus SP} PDB: 3v5f_A* 3p3b_A* 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>4gfi_A Mandelate racemase/muconate lactonizing enzyme FA protein; putative L-Ala-L/D-Glu epimerase; HET: GLU; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>3caw_A O-succinylbenzoate synthase; structural genomics, PSI-2, NYSGXRC, target 9462A, protein structure initiative; 1.87A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1w6ta1296 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumo 4e-93
d2al1a1295 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Sacch 2e-90
d2ptza1291 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [ 3e-89
d2akza1294 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens) 1e-88
d2fyma1292 c.1.11.1 (A:140-431) Enolase {Escherichia coli [Ta 6e-82
d1kkoa1251 c.1.11.2 (A:161-411) beta-Methylaspartase {Citroba 8e-50
d1kcza1253 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostri 8e-49
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Length = 296 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: Enolase
domain: Enolase
species: Streptococcus pneumoniae [TaxId: 1313]

 Score =  274 bits (701), Expect = 4e-93
 Identities = 103/246 (41%), Positives = 159/246 (64%), Gaps = 7/246 (2%)

Query: 3   LQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIG--KIVIGMDVAAS 60
           L+ ++K +  +  T VGDEGGFAP  + + +G E +  AI   GY+    + +G D A+S
Sbjct: 52  LKKILKSRGLE--TAVGDEGGFAPRFEGTEDGVETILAAIEAAGYVPGKDVFLGFDCASS 109

Query: 61  EFYDSKDKTYDLNFKEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAE 120
           EFYD   +    ++ +   +G+   +     +     ++ +PI++IED  D++DW+    
Sbjct: 110 EFYD--KERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDWDGWKA 167

Query: 121 LTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAG 180
           LT ++G+ VQ+VGDD  VTN   + + I+E   N++L+KVNQIG++TE+ EA++M+K AG
Sbjct: 168 LTERLGKKVQLVGDDFFVTNTDYLARGIQEGAANSILIKVNQIGTLTETFEAIEMAKEAG 227

Query: 181 WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYA 240
           +  + SHRSGETED+ IAD++V    GQIKTG+  R++R+AKYNQLLRIE++LG  A Y 
Sbjct: 228 YTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAEYR 287

Query: 241 GTK-FR 245
           G K F 
Sbjct: 288 GLKSFY 293
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 295 Back     information, alignment and structure
>d2ptza1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [TaxId: 5691]} Length = 291 Back     information, alignment and structure
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Length = 251 Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d2ptza1291 Enolase {Trypanosoma brucei [TaxId: 5691]} 100.0
d2akza1294 Enolase {Human (Homo sapiens), gamma isoform [TaxI 100.0
d2al1a1295 Enolase {Baker's yeast (Saccharomyces cerevisiae) 100.0
d1w6ta1296 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 100.0
d2fyma1292 Enolase {Escherichia coli [TaxId: 562]} 100.0
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 100.0
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 100.0
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 99.84
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 99.82
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 99.82
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 99.81
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 99.8
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 99.8
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 99.8
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 99.77
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 99.76
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 99.75
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 99.75
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 99.74
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 99.74
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 99.69
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 99.68
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 99.55
d1r6wa1221 O-succinylbenzoate synthase {Escherichia coli [Tax 99.5
d1gr0a1243 Myo-inositol 1-phosphate synthase {Mycobacterium t 86.01
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 85.53
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 82.76
>d2ptza1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: Enolase
domain: Enolase
species: Trypanosoma brucei [TaxId: 5691]

Probab=100.00  E-value=2.8e-90  Score=622.48  Aligned_cols=241  Identities=55%  Similarity=0.858  Sum_probs=233.2

Q ss_pred             ChHHHHHHHhcCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHhcCCccceeeeeehhhhcccccCCcceeecCCCCCCC
Q 040341            1 MFLQAVIKKKYGQDATNVGDEGGFAPNIQESYEGFELLKTAIAKGGYIGKIVIGMDVAASEFYDSKDKTYDLNFKEENND   80 (251)
Q Consensus         1 ~~lk~~l~~~~g~~~~~vgdeGGfap~~~~~eeal~~i~~Ai~~aGy~~kI~iglD~Aase~~~~~~g~Y~l~~~~~~~d   80 (251)
                      |+||++|++|++..+++|||||||+|++++++++|++|.+||+++||++++.+|+|||||+||++++++|++.++.   .
T Consensus        50 ~~lk~~L~~k~~~~~~~vgDEGGfaP~~~~~e~aL~ll~eAi~~ag~~~~~~i~lD~AAsef~~~~~~~Y~l~~~~---~  126 (291)
T d2ptza1          50 HSLRGIIKKKYGQDAVNVGDEGGFAPPIKDINEPLPILMEAIEEAGHRGKFAICMDCAASETYDEKKQQYNLTFKS---P  126 (291)
T ss_dssp             HHHHHHHHHHHCGGGCCBCTTSSBCCSCCCTTTHHHHHHHHHHHTTCTTSCEEEEECCGGGGEETTTTEEETTTTS---S
T ss_pred             HHHHHHHHHhcCCccccccccccccccccccHHHHHHHHHHHHHcCCCCCeeEEeeechHhhhhcccccccccccc---c
Confidence            6899999999988899999999999999999999999999999999999999999999999999988999987643   2


Q ss_pred             CCCccChhhHHHHHHHhhhcCCceeecCCCCcccHHHHHHHHhhhCCceEEEcccccccCHHHHHHHHhccCcceeEeec
Q 040341           81 GSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKV  160 (251)
Q Consensus        81 ~~~~~s~~elid~~~~l~~~ypI~~IEDP~~e~D~~~~~~l~~~lg~~~~ivgDdl~vtn~~~i~~~i~~~a~n~ilIK~  160 (251)
                      .++.+|++||+++|.+|+++|||+||||||+|+||++|++|++++|++||||||||+|||++|+++||+.++||++||||
T Consensus       127 ~~~~ls~~elid~y~~l~~~YPIisIEDp~~e~D~~gw~~lt~~~g~k~~iVGDDL~vTn~~rl~~gi~~~a~NaiLIK~  206 (291)
T d2ptza1         127 EPTWVTAEQLRETYCKWAHDYPIVSIEDPYDQDDFAGFAGITEALKGKTQIVGDDLTVTNTERIKMAIEKKACNSLLLKI  206 (291)
T ss_dssp             SCCEECHHHHHHHHHHHHHHSCEEEEECCSCTTCHHHHHHHHHHTTTTSEEEESTTTTTCHHHHHHHHHTTCCSEEEECH
T ss_pred             CcchhhHHHHHHHHHHHhhccceeEecCCccccchhHHHHhhhccCceEEEecCcccccchHHHhhccccCCccceEecc
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccHHHHHHHHHHHHHcCCcEEEecCCCCCCchhHhhhhhhcccCccccCCCCchhHHHHhhHHHHHHHHhCCCcccc
Q 040341          161 NQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYA  240 (251)
Q Consensus       161 nqiGtlte~l~~~~~a~~~g~~~ivs~rsgEt~d~~iadLAva~~~~~ik~G~~~r~Er~aKyN~llrie~~l~~~~~~~  240 (251)
                      |||||||||++++++|+++||.+|||||||||+|+||||||||++++|||+|+|+||||+|||||||||||+|+++++|+
T Consensus       207 NQiGTvtEt~ea~~la~~~g~~~iiShRSGETeD~~iaDLAVg~~a~~iK~G~~~r~ER~aKyNrLLrIee~L~~~~~~~  286 (291)
T d2ptza1         207 NQIGTISEAIASSKLCMENGWSVMVSHRSGETEDTYIADLVVALGSGQIKTGAPCRGERTAKLNQLLRIEEELGAHAKFG  286 (291)
T ss_dssp             HHHCCHHHHHHHHHHHHHTTCEEEEECCSBCCSCCHHHHHHHHHTCSEEECCSSCSHHHHHHHHHHHHHHHHHCTTCEES
T ss_pred             hhhhhHHHHHHHHHHHHHcCeeEEeeCCCCCcCcchHHHHHHHhCCCceecCCCcchHHHHHHHHHHHHHHHhccccCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Cccc
Q 040341          241 GTKF  244 (251)
Q Consensus       241 ~~~~  244 (251)
                      +..|
T Consensus       287 ~~~~  290 (291)
T d2ptza1         287 FPGW  290 (291)
T ss_dssp             CGGG
T ss_pred             CCCC
Confidence            8876
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure