Citrus Sinensis ID: 040733

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640---
MATTLSPPFIFNTPKSPPTISRPLMPLPYSYNRIKKPSLHVTNSTLNIPTSTAPFQQTDFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRALH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccccccccccccccccEEccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHccccHHcccccccccccccccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccEEEEEcccHHHHccHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHcccEEEEEEccccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHccccEEEEcccHcccHHHHHHHHHHccccEEHHHcccccccccccHHHHHcccHHHHHHHHHHHcccEEEEEEEEEcccccccHHHHccccEEEEEEcccccccccccccccEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHccccHHHcccccccccccccccHcccHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHEccccccccc
mattlsppfifntpkspptisrplmplpysynrikkpslhvtnstlniptstapfqqtdfssrfapdkprkgADIIVEALERqgvttvfaypggasieIHQSLTRSNirsilprheqggifaaegyarssgtpgvclvssgpgvtnIMTGLMdaysdsipilaITGQVSQkllgtdafqeipVVEVTRYMtkhnylvldvddiPRIIKEAFFIatsgrpgpvlidipVDVQLElavpnwnqpcklpscisslpkepDELALRQTLKLIVesknpvlcvgggclnssEELRKFVGltgipvtcttmglglfpctdeLCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVhididsneigkvklpdvsicaDAKLVFNRMNMILeskgvgfmfDFSAWREELHEQKkkypfsyktfgeeippqYAIQILNEltddeetiistgVGQHQMWAIQFYMYKRARQLLtssgfgsmgfglpaamgaavanpgaivvdidgdgsFIMNLQELAAIKAENIPVKILLINNqylgmnveyedryfeanransflgdplrkseifpDMLKFAEacgipaarvtkKKDVRAAIQLMLETPGPYLLDVMVSYQEhvvpmipydksfkdtileddgralh
mattlsppfifntpkspptisrPLMPLPYSYNRIKKPSLHVTNSTLniptstapfqqtdfssrfapdkprKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHnylvldvddiPRIIKEAFFiatsgrpgpVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIvhididsneigkvklpdvSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRALH
MATTLSPPFIFNTPKSPPTISRPLMPLPYSYNRIKKPSLHVTNSTLNIPTSTAPFQQTDFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLpaamgaavanpgaIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRALH
************************************************************************ADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPK*PDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTI*********
**************************************************************************IIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLP*EPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILES******FDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILED******
MATTLSPPFIFNTPKSPPTISRPLMPLPYSYNRIKKPSLHVTNSTLNIPTSTAPFQQTDFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRALH
********************************************************************PRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILED******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTLSPPFIFNTPKSPPTISRPLMPLPYSYNRIKKPSLHVTNSTLNIPTSTAPFQQTDFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSNIRSILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRALH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query643 2.2.26 [Sep-21-2011]
P27819652 Acetolactate synthase 3, N/A no 0.986 0.972 0.655 0.0
P27818655 Acetolactate synthase 1, N/A no 0.989 0.970 0.654 0.0
P09114664 Acetolactate synthase 2, N/A no 0.962 0.932 0.642 0.0
P17597670 Acetolactate synthase, ch yes no 0.902 0.865 0.685 0.0
P09342667 Acetolactate synthase 1, N/A no 0.923 0.890 0.665 0.0
P14874637 Acetolactate synthase 2, N/A no 0.970 0.979 0.628 0.0
Q41768638 Acetolactate synthase 1, N/A no 0.900 0.907 0.638 0.0
Q6K2E8644 Acetolactate synthase 1, yes no 0.900 0.899 0.638 0.0
Q41769638 Acetolactate synthase 2, N/A no 0.900 0.907 0.636 0.0
Q7XKQ8663 Probable acetolactate syn no no 0.895 0.868 0.614 0.0
>sp|P27819|ILVB3_BRANA Acetolactate synthase 3, chloroplastic OS=Brassica napus PE=3 SV=1 Back     alignment and function desciption
 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/651 (65%), Positives = 526/651 (80%), Gaps = 17/651 (2%)

Query: 2   ATTLSPPFIFNTP--KSPPTISRPLMPLPYSYNRIKKPS--LH---VTNSTLNIPTSTAP 54
           AT+ SP  +   P  KSP  ISR    LP+S    +KPS  LH     ++ LN P + AP
Sbjct: 4   ATSSSPISLTAKPSSKSPLPISR--FSLPFSLTP-QKPSSRLHRPLAISAVLNSPVNVAP 60

Query: 55  FQQTD----FSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IR 109
            ++TD    F SR+APD+PRKGADI+VEALERQGV TVFAYPGGAS+EIHQ+LTRS+ IR
Sbjct: 61  -EKTDKIKTFISRYAPDEPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSTIR 119

Query: 110 SILPRHEQGGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVS 169
           ++LPRHEQGG+FAAEGYARSSG PG+C+ +SGPG TN+++GL DA  DS+P++AITGQV 
Sbjct: 120 NVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVP 179

Query: 170 QKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVD 229
           ++++GTDAFQE P+VEVTR +TKHNYLV+DVDDIPRI++EAFF+ATSGRPGPVL+D+P D
Sbjct: 180 RRMIGTDAFQETPIVEVTRSITKHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKD 239

Query: 230 VQLELAVPNWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEEL 289
           +Q +LA+PNW+QP +LP  +S LP+ P+   L Q ++LI ESK PVL VGGG LNSSEEL
Sbjct: 240 IQQQLAIPNWDQPMRLPGYMSRLPQPPEVSQLGQIVRLISESKRPVLYVGGGSLNSSEEL 299

Query: 290 RKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNER 349
            +FV LTGIPV  T MGLG +PC DEL L+M+GM GTVYANYAV   DLLLA GVRF++R
Sbjct: 300 GRFVELTGIPVASTLMGLGSYPCNDELSLQMLGMHGTVYANYAVEHSDLLLAFGVRFDDR 359

Query: 350 MTSKLEDFATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDF 409
           +T KLE FA+RAKIVHIDIDS EIGK K P VS+C D KL    MN +LE++      DF
Sbjct: 360 VTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDF 419

Query: 410 SAWREELHEQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFY 469
             WR EL EQK+K+P S+KTFGE IPPQYAIQ+L+ELT   + IISTGVGQHQMWA QFY
Sbjct: 420 GVWRSELSEQKQKFPLSFKTFGEAIPPQYAIQVLDELTQG-KAIISTGVGQHQMWAAQFY 478

Query: 470 MYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENI 529
            Y++ RQ L+SSG G+MGFGLPAA+GA+VANP AIVVDIDGDGSFIMN+QELA I+ EN+
Sbjct: 479 KYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENL 538

Query: 530 PVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVT 589
           PVKILL+NNQ+LGM +++EDR+++ANRA+++LGDP R++EIFP+ML+FA ACGIPAARVT
Sbjct: 539 PVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGDPARENEIFPNMLQFAGACGIPAARVT 598

Query: 590 KKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGR 640
           KK+++R AIQ ML+TPGPYLLDV+  +QEHV+PMIP   +FKD I E DGR
Sbjct: 599 KKEELREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFKDVITEGDGR 649

Brassica napus (taxid: 3708)
EC: 2EC: .EC: 2EC: .EC: 1EC: .EC: 6
>sp|P27818|ILVB1_BRANA Acetolactate synthase 1, chloroplastic OS=Brassica napus PE=3 SV=1 Back     alignment and function description
>sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 Back     alignment and function description
>sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana GN=ALS PE=1 SV=1 Back     alignment and function description
>sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 Back     alignment and function description
>sp|P14874|ILVB2_BRANA Acetolactate synthase 2, chloroplastic OS=Brassica napus PE=3 SV=1 Back     alignment and function description
>sp|Q41768|ILVB1_MAIZE Acetolactate synthase 1, chloroplastic OS=Zea mays GN=ALS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6K2E8|ILVB1_ORYSJ Acetolactate synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS1 PE=2 SV=1 Back     alignment and function description
>sp|Q41769|ILVB2_MAIZE Acetolactate synthase 2, chloroplastic OS=Zea mays GN=ALS2 PE=3 SV=1 Back     alignment and function description
>sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
255540223660 acetolactate synthase, putative [Ricinus 0.953 0.928 0.700 0.0
224136183650 predicted protein [Populus trichocarpa] 0.953 0.943 0.697 0.0
356549355645 PREDICTED: acetolactate synthase 2, chlo 0.993 0.990 0.651 0.0
449440546665 PREDICTED: acetolactate synthase 3, chlo 0.900 0.870 0.718 0.0
356555166653 PREDICTED: acetolactate synthase 2, chlo 0.953 0.938 0.673 0.0
124370652 RecName: Full=Acetolactate synthase 3, c 0.986 0.972 0.655 0.0
124366655 RecName: Full=Acetolactate synthase 1, c 0.989 0.970 0.654 0.0
1130684659 acetohydroxyacid synthase [Gossypium hir 0.967 0.943 0.666 0.0
357446499655 Acetolactate synthase [Medicago truncatu 0.976 0.958 0.657 0.0
22450043585 putative acetolactate synthase [Raphanus 0.902 0.991 0.695 0.0
>gi|255540223|ref|XP_002511176.1| acetolactate synthase, putative [Ricinus communis] gi|223550291|gb|EEF51778.1| acetolactate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/622 (70%), Positives = 517/622 (83%), Gaps = 9/622 (1%)

Query: 27  LPYSYNRIKKP---SLHVTNS----TLNIPTSTAPFQQTDFSSRFAPDKPRKGADIIVEA 79
           LP+S N  K     SLH+TN+       IP +TAP  Q   + RFAPD+PRKG+DI+VEA
Sbjct: 37  LPFSLNPQKSTAHRSLHITNAISKPATTIPATTAPVPQPSPNPRFAPDEPRKGSDILVEA 96

Query: 80  LERQGVTTVFAYPGGASIEIHQSLTRSNI-RSILPRHEQGGIFAAEGYARSSGTPGVCLV 138
           LERQGVT VFAYPGGAS+EIHQ+LTRS I R++LPRHEQGG+FAAEGYARSSG PGVC+ 
Sbjct: 97  LERQGVTDVFAYPGGASLEIHQALTRSPIIRNVLPRHEQGGVFAAEGYARSSGKPGVCIA 156

Query: 139 SSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVL 198
           +SGPG TN+++GL DA  DS+PI+AITGQV ++++GTDAFQE P+VEVTR +TKHNYLVL
Sbjct: 157 TSGPGATNLVSGLADALLDSVPIVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVL 216

Query: 199 DVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPSCISSLPKEPDE 258
           DVDDIPRI++EAFF+ATSGRPGPVLID+P D+Q +LAVPNWN P KLP  +S LPK P++
Sbjct: 217 DVDDIPRIVQEAFFLATSGRPGPVLIDVPKDIQQQLAVPNWNTPIKLPGYMSRLPKVPND 276

Query: 259 LALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTCTTMGLGLFPCTDELCL 318
             L Q ++LI ESK PVL VGGGCLNSSEELR+FV LTGIPV  T MGLG FP  DEL L
Sbjct: 277 SHLEQIVRLISESKKPVLYVGGGCLNSSEELRRFVELTGIPVASTLMGLGAFPVGDELSL 336

Query: 319 RMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAKIVHIDIDSNEIGKVKL 378
           +M+GM GTVYANY+V++ DLLLA GVRF++R+T KLE FA+RAKIVHIDIDS EIGK K 
Sbjct: 337 QMLGMHGTVYANYSVDKSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQ 396

Query: 379 PDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYKTFGEEIPPQY 438
           P VS+C D KL    MN ILESKG     DF AWREEL+EQK KYP S+KTFG+ IPPQY
Sbjct: 397 PHVSVCGDVKLALQGMNKILESKGAKSKLDFKAWREELNEQKVKYPLSFKTFGDAIPPQY 456

Query: 439 AIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAV 498
           AIQ+L+ELT+    IISTGVGQHQMWA QFY YKR RQ LTS G G+MGFGLPAA+GAAV
Sbjct: 457 AIQVLDELTNG-NAIISTGVGQHQMWAAQFYKYKRPRQWLTSGGLGAMGFGLPAAIGAAV 515

Query: 499 ANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRAN 558
           ANPGA+VVDIDGDGSFIMN+QELA I+ EN+P+KILL+NNQ+LGM V++EDR+++ANRA+
Sbjct: 516 ANPGAVVVDIDGDGSFIMNVQELATIRVENLPIKILLLNNQHLGMVVQWEDRFYKANRAH 575

Query: 559 SFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLMLETPGPYLLDVMVSYQE 618
           ++LGDP  +SEIFP+MLKFAEACGIPAARVT+K+D+RAAIQ ML+TPGPYLLDV+V +QE
Sbjct: 576 TYLGDPSNESEIFPNMLKFAEACGIPAARVTRKEDLRAAIQEMLDTPGPYLLDVIVPHQE 635

Query: 619 HVVPMIPYDKSFKDTILEDDGR 640
           HV+PMIP   +FKD I E DGR
Sbjct: 636 HVLPMIPSGGAFKDVITEGDGR 657

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136183|ref|XP_002322262.1| predicted protein [Populus trichocarpa] gi|222869258|gb|EEF06389.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549355|ref|XP_003543059.1| PREDICTED: acetolactate synthase 2, chloroplastic-like [Glycine max] gi|255689393|gb|ACU30048.1| acetohydroxyacid synthase, partial [Glycine max] Back     alignment and taxonomy information
>gi|449440546|ref|XP_004138045.1| PREDICTED: acetolactate synthase 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555166|ref|XP_003545907.1| PREDICTED: acetolactate synthase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|124370|sp|P27819.1|ILVB3_BRANA RecName: Full=Acetolactate synthase 3, chloroplastic; AltName: Full=ALS III; AltName: Full=Acetohydroxy-acid synthase III; AltName: Full=Acetolactate synthase III; Flags: Precursor gi|17776|emb|CAA77615.1| acetohydroxyacid synthase III [Brassica napus] gi|379030365|dbj|BAL68082.1| acetolactate synthase [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|124366|sp|P27818.1|ILVB1_BRANA RecName: Full=Acetolactate synthase 1, chloroplastic; AltName: Full=ALS I; AltName: Full=Acetohydroxy-acid synthase I; AltName: Full=Acetolactate synthase I; Flags: Precursor gi|17772|emb|CAA77613.1| actohydroxyacid synthase I [Brassica napus] gi|270567208|gb|ACZ92141.1| acetohydroxyacid synthase [Brassica napus] Back     alignment and taxonomy information
>gi|1130684|emb|CAA87084.1| acetohydroxyacid synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|357446499|ref|XP_003593527.1| Acetolactate synthase [Medicago truncatula] gi|124360613|gb|ABN08612.1| Thiamine pyrophosphate enzyme, central region [Medicago truncatula] gi|355482575|gb|AES63778.1| Acetolactate synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|22450043|emb|CAC86694.1| putative acetolactate synthase [Raphanus raphanistrum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
TAIR|locus:2114525670 CSR1 "chlorsulfuron/imidazolin 0.979 0.940 0.631 4.7e-220
TIGR_CMR|GSU_1911566 GSU_1911 "acetolactate synthas 0.861 0.978 0.428 5.8e-121
TIGR_CMR|BA_1850570 BA_1850 "acetolactate synthase 0.852 0.961 0.444 7.4e-121
TIGR_CMR|CHY_0520554 CHY_0520 "acetolactate synthas 0.833 0.967 0.437 3.4e-116
TIGR_CMR|CHY_0517552 CHY_0517 "acetolactate synthas 0.832 0.969 0.427 2.6e-109
TIGR_CMR|BA_1417566 BA_1417 "acetolactate synthase 0.844 0.959 0.416 6.3e-108
TIGR_CMR|SPO_2578583 SPO_2578 "acetolactate synthas 0.864 0.953 0.398 1.7e-105
UNIPROTKB|P0A622618 ilvB1 "Acetolactate synthase l 0.850 0.885 0.415 5.3e-104
TIGR_CMR|DET_0833569 DET_0833 "acetolactate synthas 0.852 0.963 0.405 6.7e-104
TIGR_CMR|CJE_0677566 CJE_0677 "acetolactate synthas 0.863 0.980 0.381 1.8e-101
TAIR|locus:2114525 CSR1 "chlorsulfuron/imidazolinone resistant 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2098 (743.6 bits), Expect = 4.7e-220, Sum P(2) = 4.7e-220
 Identities = 403/638 (63%), Positives = 496/638 (77%)

Query:     6 SPPFIFNTPKSPPTISRPLMPL--PYSYNRIKKPSLHVTNSTLNIPTSTAPFQQTDFSSR 63
             S PF  N  KS  +  R  +    P S + +    L+ T +    P+ T P +   F SR
Sbjct:    35 SLPFSLNPNKSSSSSRRRGIKSSSPSSISAV----LNTTTNVTTTPSPTKPTKPETFISR 90

Query:    64 FAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQGGIFA 122
             FAPD+PRKGADI+VEALERQGV TVFAYPGGAS+EIHQ+LTRS+ IR++LPRHEQGG+FA
Sbjct:    91 FAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFA 150

Query:   123 AEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIP 182
             AEGYARSSG PG+C+ +SGPG TN+++GL DA  DS+P++AITGQV ++++GTDAFQE P
Sbjct:   151 AEGYARSSGKPGICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETP 210

Query:   183 VVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPNWNQP 242
             +VEVTR +TKHNYLV+DV+DIPRII+EAFF+ATSGRPGPVL+D+P D+Q +LA+PNW Q 
Sbjct:   211 IVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQA 270

Query:   243 CKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGIPVTC 302
              +LP  +S +PK P++  L Q ++LI ESK PVL VGGGCLNSS+EL +FV LTGIPV  
Sbjct:   271 MRLPGYMSRMPKPPEDSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGIPVAS 330

Query:   303 TTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAK 362
             T MGLG +PC DEL L M+GM GTVYANYAV   DLLLA GVRF++R+T KLE FA+RAK
Sbjct:   331 TLMGLGSYPCDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAK 390

Query:   363 IVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKK 422
             IVHIDIDS EIGK K P VS+C D KL    MN +LE++      DF  WR EL+ QK+K
Sbjct:   391 IVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFGVWRNELNVQKQK 450

Query:   423 YPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLLTSSG 482
             +P S+KTFGE IPPQYAI++L+ELTD +  IISTGVGQHQMWA QFY YK+ RQ L+S G
Sbjct:   451 FPLSFKTFGEAIPPQYAIKVLDELTDGK-AIISTGVGQHQMWAAQFYNYKKPRQWLSSGG 509

Query:   483 FGSMGFGLXXXXXXXXXXXXXIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINNQYLG 542
              G+MGFGL             IVVDIDGDGSFIMN+QELA I+ EN+PVK+LL+NNQ+LG
Sbjct:   510 LGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLG 569

Query:   543 MNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAIQLML 602
             M +++EDR+++ANRA++FLGDP ++ EIFP+ML FA ACGIPAARVTKK D+R AIQ ML
Sbjct:   570 MVMQWEDRFYKANRAHTFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTML 629

Query:   603 ETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGR 640
             +TPGPYLLDV+  +QEHV+PMIP   +F D I E DGR
Sbjct:   630 DTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEGDGR 667
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003984 "acetolactate synthase activity" evidence=IEA;IDA
GO:0004737 "pyruvate decarboxylase activity" evidence=TAS
GO:0009082 "branched-chain amino acid biosynthetic process" evidence=IEA;TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016740 "transferase activity" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
TIGR_CMR|GSU_1911 GSU_1911 "acetolactate synthase, large subunit, biosynthetic type" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1850 BA_1850 "acetolactate synthase, large subunit, biosynthetic type" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0520 CHY_0520 "acetolactate synthase, large subunit, biosynthetic type" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0517 CHY_0517 "acetolactate synthase, large subunit, biosynthetic type" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1417 BA_1417 "acetolactate synthase, large subunit, biosynthetic type" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2578 SPO_2578 "acetolactate synthase, large subunit, biosynthetic type" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P0A622 ilvB1 "Acetolactate synthase large subunit IlvB1" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0833 DET_0833 "acetolactate synthase, large subunit, biosynthetic type" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0677 CJE_0677 "acetolactate synthase, large subunit, biosynthetic type" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7U5G1ILVB_SYNPX2, ., 2, ., 1, ., 60.40070.84600.8816yesno
O85293ILVI_BUCAP2, ., 2, ., 1, ., 60.37560.84130.9474yesno
Q6K2E8ILVB1_ORYSJ2, ., 2, ., 1, ., 60.63850.90040.8990yesno
Q41769ILVB2_MAIZE2, ., 2, ., 1, ., 60.63680.90040.9075N/Ano
Q41768ILVB1_MAIZE2, ., 2, ., 1, ., 60.63850.90040.9075N/Ano
P09114ILVB2_TOBAC2, ., 2, ., 1, ., 60.64250.96260.9322N/Ano
Q89AP7ILVI_BUCBP2, ., 2, ., 1, ., 60.35520.83980.9375yesno
P14874ILVB2_BRANA2, ., 2, ., 1, ., 60.62830.97040.9795N/Ano
O08353ILVB_METAO2, ., 2, ., 1, ., 60.40210.82420.8848yesno
P57321ILVI_BUCAI2, ., 2, ., 1, ., 60.37470.83510.9404yesno
P42463ILVB_CORGL2, ., 2, ., 1, ., 60.41630.89420.9185yesno
P45261ILVI_HAEIN2, ., 2, ., 1, ., 60.36800.86460.9703yesno
P17597ILVB_ARATH2, ., 2, ., 1, ., 60.68550.90200.8656yesno
O33112ILVB_MYCLE2, ., 2, ., 1, ., 60.40930.90350.9296yesno
P09342ILVB1_TOBAC2, ., 2, ., 1, ., 60.6650.92370.8905N/Ano
Q59498ILVB_MYCAV2, ., 2, ., 1, ., 60.40910.86150.8921yesno
O78518ILVB_GUITH2, ., 2, ., 1, ., 60.39220.85840.96yesno
P36620ILVB_SCHPO2, ., 2, ., 1, ., 60.38820.86000.8266yesno
Q57725ILVB_METJA2, ., 2, ., 1, ., 60.42470.84290.9170yesno
Q02137ILVB_LACLA2, ., 2, ., 1, ., 60.41200.84290.9426yesno
P27818ILVB1_BRANA2, ., 2, ., 1, ., 60.65490.98910.9709N/Ano
P27819ILVB3_BRANA2, ., 2, ., 1, ., 60.65590.98600.9723N/Ano
P37251ILVB_BACSU2, ., 2, ., 1, ., 60.42900.84440.9459yesno
P0A623ILVB_MYCBO2, ., 2, ., 1, ., 60.42830.85060.8851yesno
P0A622ILVB1_MYCTU2, ., 2, ., 1, ., 60.42830.85060.8851yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.2.10.976
4th Layer2.2.1.60.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0005029001
acetolactate synthase I/II/III large subunit (EC-2.2.1.6) (651 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_1240037
hypothetical protein (525 aa)
• •• •• 0.994
gw1.V.3049.1
2-isopropylmalate synthase (EC-2.3.3.13) (545 aa)
• •• •• 0.994
estExt_fgenesh4_pg.C_280257
threonine deaminase (EC-4.3.1.19) (543 aa)
•  •••• 0.991
gw1.I.272.1
hypothetical protein; Catalyzes the oxidation of 3-carboxy-2-hydroxy-4- methylpentanoate (3-iso [...] (382 aa)
• •  •• 0.990
estExt_fgenesh4_pg.C_LG_IV0521
hypothetical protein (589 aa)
• •• •• 0.986
estExt_fgenesh4_pm.C_LG_III0598
hypothetical protein (605 aa)
• ••  • 0.970
estExt_fgenesh4_pg.C_LG_I0451
hypothetical protein (611 aa)
• ••  • 0.969
gw1.VII.445.1
hypothetical protein (410 aa)
• •  •• 0.953
gw1.VIII.1377.1
hypothetical protein (414 aa)
• •  •• 0.953
gw1.X.1439.1
hypothetical protein (415 aa)
• •  •• 0.945

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
PLN02470585 PLN02470, PLN02470, acetolactate synthase 0.0
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 0.0
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 0.0
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 0.0
PRK09107595 PRK09107, PRK09107, acetolactate synthase 3 cataly 0.0
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 0.0
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 0.0
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 0.0
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 0.0
PRK07789612 PRK07789, PRK07789, acetolactate synthase 1 cataly 0.0
CHL00099585 CHL00099, ilvB, acetohydroxyacid synthase large su 0.0
PRK07418616 PRK07418, PRK07418, acetolactate synthase 3 cataly 0.0
PRK06276586 PRK06276, PRK06276, acetolactate synthase catalyti 1e-179
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 1e-175
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 1e-164
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 1e-154
PRK06965587 PRK06965, PRK06965, acetolactate synthase 3 cataly 1e-152
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 1e-145
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 1e-143
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 1e-142
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 1e-123
PRK11269591 PRK11269, PRK11269, glyoxylate carboligase; Provis 3e-99
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 7e-95
TIGR01504588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 4e-90
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 7e-89
COG3960592 COG3960, COG3960, Glyoxylate carboligase [General 1e-86
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 2e-83
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 2e-80
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 3e-74
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 1e-73
PRK06457549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 2e-71
PRK08611576 PRK08611, PRK08611, pyruvate oxidase; Provisional 2e-71
PRK06112578 PRK06112, PRK06112, acetolactate synthase catalyti 4e-67
PRK07064544 PRK07064, PRK07064, hypothetical protein; Provisio 6e-67
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 1e-66
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 8e-62
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 2e-61
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 5e-61
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 6e-59
PRK09124574 PRK09124, PRK09124, pyruvate dehydrogenase; Provis 1e-56
TIGR02720575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 2e-54
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 3e-54
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 1e-53
PRK06546578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 5e-52
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 2e-47
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 3e-47
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 3e-46
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 8e-43
PRK08273597 PRK08273, PRK08273, thiamine pyrophosphate protein 1e-42
cd07039164 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding dom 2e-41
cd02014178 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) fam 2e-37
COG3962617 COG3962, COG3962, Acetolactate synthase [Amino aci 2e-37
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 2e-37
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 1e-34
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 2e-34
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 5e-32
cd02010177 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) fam 3e-28
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 2e-26
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 1e-21
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 9e-21
cd02006202 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) fam 5e-17
TIGR03394535 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylp 8e-17
PRK07092530 PRK07092, PRK07092, benzoylformate decarboxylase; 1e-16
TIGR03393539 TIGR03393, indolpyr_decarb, indolepyruvate decarbo 2e-16
cd02013196 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP 6e-16
cd02003205 cd02003, TPP_IolD, Thiamine pyrophosphate (TPP) fa 7e-16
cd02005183 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP 3e-15
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validate 4e-15
cd07037162 cd07037, TPP_PYR_MenD, Pyrimidine (PYR) binding do 2e-12
PRK07092530 PRK07092, PRK07092, benzoylformate decarboxylase; 1e-11
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 9e-11
TIGR00173430 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydrox 1e-10
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 1e-09
cd03372179 cd03372, TPP_ComE, Thiamine pyrophosphate (TPP) fa 2e-09
TIGR03297361 TIGR03297, Ppyr-DeCO2ase, phosphonopyruvate decarb 2e-09
TIGR03846181 TIGR03846, sulfopy_beta, sulfopyruvate decarboxyla 4e-09
cd03371188 cd03371, TPP_PpyrDC, Thiamine pyrophosphate (TPP) 5e-09
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 6e-09
PLN02980 1655 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ 1e-08
cd02001157 cd02001, TPP_ComE_PpyrDC, Thiamine pyrophosphate ( 3e-08
PRK06163202 PRK06163, PRK06163, hypothetical protein; Provisio 4e-08
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validate 1e-06
PLN02573578 PLN02573, PLN02573, pyruvate decarboxylase 3e-05
cd03375193 cd03375, TPP_OGFOR, Thiamine pyrophosphate (TPP fa 5e-05
cd02008178 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TP 3e-04
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 6e-04
COG1165566 COG1165, MenD, 2-succinyl-6-hydroxy-2,4-cyclohexad 9e-04
cd02009175 cd02009, TPP_SHCHC_synthase, Thiamine pyrophosphat 0.001
PLN02573578 PLN02573, PLN02573, pyruvate decarboxylase 0.003
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information 
 Score =  996 bits (2578), Expect = 0.0
 Identities = 401/583 (68%), Positives = 484/583 (83%), Gaps = 3/583 (0%)

Query: 59  DFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQ 117
            F SRFAPD+PRKGADI+VEALER+GV TVFAYPGGAS+EIHQ+LTRSN IR++L RHEQ
Sbjct: 2   TFQSRFAPDEPRKGADILVEALEREGVDTVFAYPGGASMEIHQALTRSNCIRNVLCRHEQ 61

Query: 118 GGIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDA 177
           G +FAAEGYA++SG  GVC+ +SGPG TN++TGL DA  DS+P++AITGQV ++++GTDA
Sbjct: 62  GEVFAAEGYAKASGKVGVCIATSGPGATNLVTGLADALLDSVPLVAITGQVPRRMIGTDA 121

Query: 178 FQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVP 237
           FQE P+VEVTR +TKHNYLV+DV+DIPR+I+EAFF+A+SGRPGPVL+DIP D+Q +LAVP
Sbjct: 122 FQETPIVEVTRSITKHNYLVMDVEDIPRVIREAFFLASSGRPGPVLVDIPKDIQQQLAVP 181

Query: 238 NWNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTG 297
           NWNQP KLP  +S LPK P++  L Q ++LI ESK PV+ VGGGCLNSSEELR+FV LTG
Sbjct: 182 NWNQPMKLPGYLSRLPKPPEKSQLEQIVRLISESKRPVVYVGGGCLNSSEELREFVELTG 241

Query: 298 IPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDF 357
           IPV  T MGLG FP +DEL L+M+GM GTVYANYAV+  DLLLA GVRF++R+T KLE F
Sbjct: 242 IPVASTLMGLGAFPASDELSLQMLGMHGTVYANYAVDSADLLLAFGVRFDDRVTGKLEAF 301

Query: 358 ATRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELH 417
           A+RA IVHIDID  EIGK K P VS+CAD KL    +N +LE +      DFSAWR EL 
Sbjct: 302 ASRASIVHIDIDPAEIGKNKQPHVSVCADVKLALQGLNKLLEERKAKRP-DFSAWRAELD 360

Query: 418 EQKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQL 477
           EQK+K+P SY TFG+ IPPQYAIQ+L+ELTD    IISTGVGQHQMWA Q+Y YK  R+ 
Sbjct: 361 EQKEKFPLSYPTFGDAIPPQYAIQVLDELTDG-NAIISTGVGQHQMWAAQWYKYKEPRRW 419

Query: 478 LTSSGFGSMGFGLPAAMGAAVANPGAIVVDIDGDGSFIMNLQELAAIKAENIPVKILLIN 537
           LTS G G+MGFGLPAA+GAA ANP AIVVDIDGDGSFIMN+QELA I  EN+PVKI+++N
Sbjct: 420 LTSGGLGAMGFGLPAAIGAAAANPDAIVVDIDGDGSFIMNIQELATIHVENLPVKIMVLN 479

Query: 538 NQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAA 597
           NQ+LGM V++EDR+++ANRA+++LGDP  ++EIFPD LKFAE C IPAARVT+K D+R A
Sbjct: 480 NQHLGMVVQWEDRFYKANRAHTYLGDPDAEAEIFPDFLKFAEGCKIPAARVTRKSDLREA 539

Query: 598 IQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGR 640
           IQ ML+TPGPYLLDV+V +QEHV+PMIP   +FKD I E DGR
Sbjct: 540 IQKMLDTPGPYLLDVIVPHQEHVLPMIPGGGTFKDIITEGDGR 582

Length = 585
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|132922 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>gnl|CDD|238972 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>gnl|CDD|226471 COG3962, COG3962, Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|238968 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>gnl|CDD|238964 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>gnl|CDD|132435 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|132434 TIGR03393, indolpyr_decarb, indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>gnl|CDD|238971 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>gnl|CDD|238961 cd02003, TPP_IolD, Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>gnl|CDD|238963 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>gnl|CDD|236063 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|132920 cd07037, TPP_PYR_MenD, Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1- carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|232855 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylic-acid synthase Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239469 cd03372, TPP_ComE, Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>gnl|CDD|132340 TIGR03297, Ppyr-DeCO2ase, phosphonopyruvate decarboxylase Back     alignment and domain information
>gnl|CDD|234373 TIGR03846, sulfopy_beta, sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>gnl|CDD|239468 cd03371, TPP_PpyrDC, Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|215530 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>gnl|CDD|238959 cd02001, TPP_ComE_PpyrDC, Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>gnl|CDD|235721 PRK06163, PRK06163, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236063 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information
>gnl|CDD|239470 cd03375, TPP_OGFOR, Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>gnl|CDD|238966 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|224087 COG1165, MenD, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238967 cd02009, TPP_SHCHC_synthase, Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 643
KOG4166675 consensus Thiamine pyrophosphate-requiring enzyme 100.0
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
PLN02470585 acetolactate synthase 100.0
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PRK11269591 glyoxylate carboligase; Provisional 100.0
CHL00099585 ilvB acetohydroxyacid synthase large subunit 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08273597 thiamine pyrophosphate protein; Provisional 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK05858542 hypothetical protein; Provisional 100.0
PRK08611576 pyruvate oxidase; Provisional 100.0
PRK09124574 pyruvate dehydrogenase; Provisional 100.0
PRK06154565 hypothetical protein; Provisional 100.0
PRK06546578 pyruvate dehydrogenase; Provisional 100.0
PRK06457549 pyruvate dehydrogenase; Provisional 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 100.0
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK07524535 hypothetical protein; Provisional 100.0
PRK07064544 hypothetical protein; Provisional 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PRK08266542 hypothetical protein; Provisional 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
PLN02573578 pyruvate decarboxylase 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK12474518 hypothetical protein; Provisional 100.0
PRK07586514 hypothetical protein; Validated 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
COG3960592 Glyoxylate carboligase [General function predictio 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 100.0
COG3962617 Acetolactate synthase [Amino acid transport and me 100.0
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 100.0
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 100.0
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 100.0
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 100.0
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 100.0
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 100.0
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 100.0
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 100.0
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 100.0
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 100.0
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 100.0
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 100.0
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 100.0
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 100.0
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 100.0
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 100.0
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 100.0
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 100.0
PRK06163202 hypothetical protein; Provisional 99.98
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 99.97
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.97
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.97
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.97
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.97
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.96
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.96
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.96
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.96
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.96
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.96
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.95
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.95
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.94
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.94
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.94
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.94
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.93
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.93
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 99.85
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 99.77
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 99.75
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.71
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 99.7
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 99.7
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 99.69
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 99.68
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 99.65
PRK05899 624 transketolase; Reviewed 99.59
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 99.51
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 99.51
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.44
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 99.41
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 99.4
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.39
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.32
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 99.19
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 99.01
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.98
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 98.94
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.92
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 98.87
PLN02790 654 transketolase 98.85
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 98.81
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 98.8
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.78
PTZ00089 661 transketolase; Provisional 98.72
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 98.7
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 98.69
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 98.68
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 98.67
PRK12754 663 transketolase; Reviewed 98.67
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 98.67
PRK12753 663 transketolase; Reviewed 98.65
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 98.64
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 98.63
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 98.63
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 98.56
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 98.5
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 98.46
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 98.35
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 98.29
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 98.28
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 98.27
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 98.23
COG0021 663 TktA Transketolase [Carbohydrate transport and met 98.21
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 98.17
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 98.1
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 98.04
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 98.03
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 98.02
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 98.02
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 98.0
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 97.95
KOG0523 632 consensus Transketolase [Carbohydrate transport an 97.93
KOG0225394 consensus Pyruvate dehydrogenase E1, alpha subunit 97.93
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 97.86
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 97.83
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 97.82
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 97.78
PRK05261 785 putative phosphoketolase; Provisional 97.68
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.67
KOG1182432 consensus Branched chain alpha-keto acid dehydroge 97.32
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 96.45
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 96.45
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 96.41
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 96.4
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 96.4
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 96.27
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 95.72
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 95.36
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 95.24
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 95.23
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 95.2
smart00861168 Transket_pyr Transketolase, pyrimidine binding dom 95.19
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 95.03
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 94.99
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 94.7
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 94.66
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 94.63
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 94.6
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 94.52
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 94.48
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 94.43
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 94.33
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 94.24
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 94.18
PRK03363313 fixB putative electron transfer flavoprotein FixB; 94.16
PRK00481242 NAD-dependent deacetylase; Provisional 94.07
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 93.98
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 93.82
PRK12753663 transketolase; Reviewed 93.82
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 93.79
PRK14138244 NAD-dependent deacetylase; Provisional 93.79
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 93.78
PTZ00089661 transketolase; Provisional 93.71
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 93.69
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 93.63
PLN02582677 1-deoxy-D-xylulose-5-phosphate synthase 93.54
PLN02790654 transketolase 93.5
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 93.32
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 93.27
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 93.25
PRK12754663 transketolase; Reviewed 93.16
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 93.14
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 93.1
PRK07524 535 hypothetical protein; Provisional 92.91
TIGR00300407 conserved hypothetical protein TIGR00300. All memb 92.74
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 92.68
TIGR03297 361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 92.5
TIGR03129421 one_C_dehyd_B formylmethanofuran dehydrogenase sub 92.37
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 92.36
PRK08266 542 hypothetical protein; Provisional 92.36
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 92.34
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 92.28
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 92.26
PTZ00408242 NAD-dependent deacetylase; Provisional 92.17
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 92.0
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 91.97
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 91.97
CHL00144327 odpB pyruvate dehydrogenase E1 component beta subu 91.91
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 91.87
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 91.87
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 91.83
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 91.77
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 91.75
PRK05333285 NAD-dependent deacetylase; Provisional 91.71
PRK13012896 2-oxoacid dehydrogenase subunit E1; Provisional 91.63
PRK08611 576 pyruvate oxidase; Provisional 91.56
PF09364379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 91.5
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 91.5
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 91.49
PRK07586 514 hypothetical protein; Validated 91.38
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 91.3
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 91.26
PRK11269 591 glyoxylate carboligase; Provisional 91.24
PRK08322 547 acetolactate synthase; Reviewed 91.14
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 91.04
PRK08617 552 acetolactate synthase; Reviewed 91.04
PRK07064 544 hypothetical protein; Provisional 91.04
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 90.87
TIGR01591 671 Fdh-alpha formate dehydrogenase, alpha subunit, ar 90.77
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 90.75
cd02768386 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The Nuo 90.74
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 90.73
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 90.72
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 90.71
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 90.67
PRK05858 542 hypothetical protein; Provisional 90.67
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 90.65
PLN02470 585 acetolactate synthase 90.62
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 90.62
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 90.57
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 90.56
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 90.55
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 90.53
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 90.48
PRK06112 578 acetolactate synthase catalytic subunit; Validated 90.37
PRK08327569 acetolactate synthase catalytic subunit; Validated 90.33
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 90.28
PRK08199 557 thiamine pyrophosphate protein; Validated 90.28
PRK12474 518 hypothetical protein; Provisional 90.27
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 90.26
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 90.22
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 90.14
PRK05899624 transketolase; Reviewed 90.12
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 90.08
cd02753512 MopB_Formate-Dh-H Formate dehydrogenase H (Formate 90.06
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 89.99
KOG3954336 consensus Electron transfer flavoprotein, alpha su 89.95
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 89.85
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 89.8
PRK06457 549 pyruvate dehydrogenase; Provisional 89.76
cd02767574 MopB_ydeP The MopB_ydeP CD includes a group of rel 89.73
PRK06163202 hypothetical protein; Provisional 89.65
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 89.62
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 89.59
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 89.57
PRK09124574 pyruvate dehydrogenase; Provisional 89.51
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 89.47
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 89.32
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 89.31
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 89.27
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 89.26
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 89.09
PRK07092 530 benzoylformate decarboxylase; Reviewed 88.98
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 88.9
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 88.89
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 88.89
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 88.88
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 88.81
PRK08155 564 acetolactate synthase catalytic subunit; Validated 88.67
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla 88.55
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 88.53
TIGR03479 912 DMSO_red_II_alp DMSO reductase family type II enzy 88.41
cd02752 649 MopB_Formate-Dh-Na-like Formate dehydrogenase N, a 88.4
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 88.29
TIGR00173 432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 87.91
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 87.91
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 87.88
PRK06546578 pyruvate dehydrogenase; Provisional 87.66
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 87.47
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 86.91
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 86.77
PRK06154565 hypothetical protein; Provisional 86.66
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 86.45
PLN02225701 1-deoxy-D-xylulose-5-phosphate synthase 86.1
TIGR01973603 NuoG NADH-quinone oxidoreductase, chain G. This mo 86.03
cd02750461 MopB_Nitrate-R-NarG-like Respiratory nitrate reduc 85.96
TIGR01701 743 Fdhalpha-like oxidoreductase alpha (molybdopterin) 85.28
PLN02683356 pyruvate dehydrogenase E1 component subunit beta 85.2
PLN02573578 pyruvate decarboxylase 85.13
PRK08273 597 thiamine pyrophosphate protein; Provisional 85.0
cd02766501 MopB_3 The MopB_3 CD includes a group of related u 84.89
cd02754565 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA 84.72
PF02233463 PNTB: NAD(P) transhydrogenase beta subunit; InterP 83.86
PRK09129776 NADH dehydrogenase subunit G; Validated 83.86
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 83.74
PRK09212 327 pyruvate dehydrogenase subunit beta; Validated 83.71
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 83.31
cd02774366 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: M 82.63
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 82.3
cd02762539 MopB_1 The MopB_1 CD includes a group of related u 82.23
cd02772414 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second doma 81.62
PRK09939 759 putative oxidoreductase; Provisional 81.3
PTZ00182 355 3-methyl-2-oxobutanate dehydrogenase; Provisional 81.17
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla 81.0
COG3958312 Transketolase, C-terminal subunit [Carbohydrate tr 80.91
PLN02683 356 pyruvate dehydrogenase E1 component subunit beta 80.62
cd02773375 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The s 80.45
KOG0451 913 consensus Predicted 2-oxoglutarate dehydrogenase, 80.09
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-127  Score=958.21  Aligned_cols=577  Identities=55%  Similarity=0.895  Sum_probs=545.4

Q ss_pred             CCCcccccccCCCC---CCcHHHHHHHHHHHCCCCEEEEccCCCcHHHHHHHhhCC-CeEEecCChhHHHHHHHHHHHHh
Q 040733           55 FQQTDFSSRFAPDK---PRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQGGIFAAEGYARSS  130 (643)
Q Consensus        55 ~~~~~~~~~~~~~~---~~~~a~~lv~~L~~~GV~~vFg~PG~~~~~l~~al~~~~-i~~i~~~hE~~A~~~A~Gyar~s  130 (643)
                      .-|++|.+++++++   .++|+|++++.|+++||++||||||+.++|++||+.++. +++|+.||||+|+|||.||||+|
T Consensus        73 sk~~t~~s~~~~D~sfvg~tGg~If~emm~rqnV~tVFgYPGGAilpv~dAi~rS~~f~fvLPrHEQgaghaAegYaR~s  152 (675)
T KOG4166|consen   73 SKPETFISRFAPDQSFVGRTGGDIFVEMMERQNVETVFGYPGGAILPVHDAITRSSSFRFVLPRHEQGAGHAAEGYARSS  152 (675)
T ss_pred             CCcccccccCCCcccccCCchhHHHHHHHHhcCCceEeecCCcceeehHhhhhcCccccccccccccccchhhhhhhhhc
Confidence            33789999999998   899999999999999999999999999999999999988 99999999999999999999999


Q ss_pred             CCcEEEEEccchhhHHHHHHHHHhhhCCCCEEEEeCCCcccccCCCCCCccCHHHHhhccceeeeEeCCcCcHHHHHHHH
Q 040733          131 GTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEA  210 (643)
Q Consensus       131 g~~gv~~~t~GpG~~N~~~gl~~A~~~~vPvlvItg~~~~~~~g~~~~Q~~d~~~~~~~~tk~~~~v~~~~~i~~~l~~A  210 (643)
                      ||||||++|||||++|.++++++|++|++||+++|||+|++.+|+++|||.|.+.+.|++|||++.|.+++++|+.|++|
T Consensus       153 gKPGvvlvTSGPGATNvvtp~ADAlaDg~PlVvftGQVptsaIGtDAFQEadiVgisRScTKwNvmVkdVedlPrrI~EA  232 (675)
T KOG4166|consen  153 GKPGVVLVTSGPGATNVVTPLADALADGVPLVVFTGQVPTSAIGTDAFQEADIVGISRSCTKWNVMVKDVEDLPRRIEEA  232 (675)
T ss_pred             CCCcEEEEecCCCcccccchhhHHhhcCCcEEEEecccchhhcccchhccCCeeeeeeccceeheeeecHHHhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCCeEEEEcccchhhhccCCCCCCCCCCCC--CCCCCCCCCCH---HHHHHHHHHHHhCCCcEEEEcCCchhh
Q 040733          211 FFIATSGRPGPVLIDIPVDVQLELAVPNWNQPCKLPS--CISSLPKEPDE---LALRQTLKLIVESKNPVLCVGGGCLNS  285 (643)
Q Consensus       211 ~~~A~s~~~GPV~i~iP~Dv~~~~~~~~~~~~~~~p~--~~~~~~~~~~~---~~i~~~~~~L~~AkrPvIl~G~g~~~~  285 (643)
                      |.+|.|||||||.+++|.|++.+-..+.|+...++|.  +..+.+..+++   ..+++++++|+.||||||++|+||.+.
T Consensus       233 FeiATSGRPGPVLVDlPKDvta~~l~~pip~~~~lPsn~~m~~~~~~~~~~v~~~i~~~a~Li~laKKPVlyvG~G~Ln~  312 (675)
T KOG4166|consen  233 FEIATSGRPGPVLVDLPKDVTAQLLIPPIPQAMRLPSNAYMSRMPKPPEDFVMSHIEQIARLISLAKKPVLYVGGGCLNS  312 (675)
T ss_pred             hhhhccCCCCCeEeeCcHHHHHHHhcCCchhhhcCCchhhHhhCCCCchhhHHHHHHHHHHHHHhccCceEEeCcccccC
Confidence            9999999999999999999998887777777777886  44455555665   689999999999999999999999854


Q ss_pred             H---HHHHHHHHHhCCceeecCCCCCCCCCCCCCcccccCCCCcHHHHHhhhcCCEEEEecCccCccccCccccccCCce
Q 040733          286 S---EELRKFVGLTGIPVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFATRAK  362 (643)
Q Consensus       286 ~---~~l~~lae~lg~PV~tt~~gkg~~~~~hpl~lG~~g~~~~~~~~~~l~~aDlvL~vG~~~~~~~t~~~~~~~~~~~  362 (643)
                      .   .+|.+|.|+++|||.+|++|.|.+++++++++.|+|++|+.++|++++++||||++|.||++++|++++.|.++++
T Consensus       313 ~d~p~lL~~fser~qIPVtttL~GLGs~d~~d~lSLhMLGMHG~~yAN~Avq~aDLilA~GvRFDDRVTGn~s~FAp~Ar  392 (675)
T KOG4166|consen  313 SDGPRLLGRFSERTQIPVTTTLMGLGSYDCDDELSLHMLGMHGTVYANYAVQHADLILAFGVRFDDRVTGNLSAFAPRAR  392 (675)
T ss_pred             CcchHHHHHHHHhhcCcceehhhcccCcCCCCchhhhhhcccccceehhhhhccceeEEecceeccccccchhhhChhhh
Confidence            4   4899999999999999999999999999999999999999999999999999999999999999999999998887


Q ss_pred             ---------EEEEcCCcccccCCCCCCeeEecCHHHHHHHHHHHHhhcCCCCCCChhHHHHHHHHHHHhCCCccc--CCC
Q 040733          363 ---------IVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHEQKKKYPFSYK--TFG  431 (643)
Q Consensus       363 ---------iI~Id~d~~~i~~~~~~~~~i~~D~~~~L~~L~~~l~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~--~~~  431 (643)
                               |||+|++|.+|||+..+++.++||+...|+.+...++....   +.+.+|+.+++.+|+++|..+.  +++
T Consensus       393 ~aaae~rggIiHfdispknIgKvvqp~~aveGDv~~~L~~m~s~~kn~~~---~~r~dW~~qin~wK~~fP~sf~~~tpG  469 (675)
T KOG4166|consen  393 RAAAEGRGGIIHFDISPKNIGKVVQPHVAVEGDVKLALQGMNSVLKNRAE---ELRLDWRNQINVWKQKFPLSFKEETPG  469 (675)
T ss_pred             hhhhcccCceEEEecCHHHhCcccCcceeeeccHHHHHHHHHhHhhcccc---hhhhhHHHHHHHHHHhCCeeeeccCCc
Confidence                     99999999999999999999999999999999988877654   3456799999999999998654  567


Q ss_pred             CCCCHHHHHHHHHhcCCC--CCeEEEeCCChhHHHHHHhccccCCCeEEecCCCcccccchHHHHHHHHhCCCCeEEEEe
Q 040733          432 EEIPPQYAIQILNELTDD--EETIISTGVGQHQMWAIQFYMYKRARQLLTSSGFGSMGFGLPAAMGAAVANPGAIVVDID  509 (643)
Q Consensus       432 ~~i~~~~~~~~L~~~l~~--~d~iv~~d~G~~~~~~~~~~~~~~p~~~~~~~~~g~mG~glpaAiGaalA~p~~~Vv~i~  509 (643)
                      +.+.|+++++.|+++..+  ...||.+++|+|+||++++|+.++|++|++++|+|+||||||+||||++|+|+..||.|.
T Consensus       470 e~ikPQ~vIk~Ldk~t~d~~~kviitTGVGqHQMWAAqfy~w~kP~~~~tSGGLGtMGfGLPAAIGAsVA~P~~iViDID  549 (675)
T KOG4166|consen  470 EAIKPQYVIKVLDKLTDDTGRKVIITTGVGQHQMWAAQFYNWKKPRQWLTSGGLGTMGFGLPAAIGASVANPDAIVIDID  549 (675)
T ss_pred             cccChHHHHHHHHHhccCcCceEEEeccccHHHHHHHHHhcccCccceeecCCccccccCcchhhcccccCcccEEEecc
Confidence            789999999999998754  267889999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccccCCHHHHHHHHHhCCCeEEEEEeCCCchhhHHHHHHhhcccccccccCCCCCCCCCCCCHHHHHhHCCCCEEEeC
Q 040733          510 GDGSFIMNLQELAAIKAENIPVKILLINNQYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVT  589 (643)
Q Consensus       510 GDGsf~m~~~eL~Ta~~~~lpv~ivV~NN~~~g~~~~~q~~~~~~~~~~~~~g~p~~~~~~~~d~~~lA~a~G~~~~~V~  589 (643)
                      ||+||.|+++||+|+++.++||+|+++||+..||+-|||+.+|+.++.|+.        ..+|||.++|++||+++.||+
T Consensus       550 GDaSF~Mt~~ELat~rq~~~PVKiLiLNNeeqGMVtQWq~lFYe~rysHTh--------Q~nPnf~klA~AmGikalRV~  621 (675)
T KOG4166|consen  550 GDASFIMTVQELATIRQENLPVKILILNNEEQGMVTQWQDLFYEARYSHTH--------QENPNFLKLAAAMGIKALRVT  621 (675)
T ss_pred             CCceeeeehHhhhhhhhcCCceEEEEecchhhhhHHHHHHHHHHhhhcccc--------ccCccHHHHHHhcCCchheee
Confidence            999999999999999999999999999999999999999999999998873        567999999999999999999


Q ss_pred             ChhHHHHHHHHHHhCCCcEEEEEEeCCCCCcccccCCCcccccccccCCCCCC
Q 040733          590 KKKDVRAAIQLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGRAL  642 (643)
Q Consensus       590 ~~~eL~~al~~al~~~gp~lIeV~v~~~~~~~p~~~~~~~~~~~~~~~~~~~~  642 (643)
                      +.+||++.++++++++||+|+||.|++++|++||+|.++++.+.|.++++|..
T Consensus       622 K~edL~~k~keflsTkGPvLleV~v~~kehVlPmvpgG~~l~~fI~~~~~~~k  674 (675)
T KOG4166|consen  622 KKEDLREKIKEFLSTKGPVLLEVIVPHKEHVLPMVPGGGTLNDFITEGDGRIK  674 (675)
T ss_pred             hHHHHHHHHHHHhCCCCCeEEEEEccCccceeeecCCCccHhhhhccCCcccc
Confidence            99999999999999999999999999999999999999999999999999975

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00300 conserved hypothetical protein TIGR00300 Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>KOG3954 consensus Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>PF02233 PNTB: NAD(P) transhydrogenase beta subunit; InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane [] Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02774 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02772 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria Back     alignment and domain information
>PRK09939 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>cd02773 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 Back     alignment and domain information
>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
1ybh_A590 Crystal Structure Of Arabidopsis Thaliana Acetohydr 0.0
3e9y_A584 Arabidopsis Thaliana Acetohydroxyacid Synthase In C 0.0
1n0h_A677 Crystal Structure Of Yeast Acetohydroxyacid Synthas 1e-107
1jsc_A630 Crystal Structure Of The Catalytic Subunit Of Yeast 1e-107
2pan_A616 Crystal Structure Of E. Coli Glyoxylate Carboligase 1e-63
3eya_A549 Structural Basis For Membrane Binding And Catalytic 7e-44
3ey9_A572 Structural Basis For Membrane Binding And Catalytic 8e-44
1ozg_A566 The Crystal Structure Of Klebsiella Pneumoniae Acet 1e-40
2pgn_A589 The Crystal Structure Of Fad And Thdp-Dependent Cyc 1e-38
2ez4_A603 Pyruvate Oxidase Variant F479w Length = 603 6e-36
1pow_A585 The Refined Structures Of A Stabilized Mutant And O 7e-36
4fee_A603 High-Resolution Structure Of Pyruvate Oxidase In Co 1e-35
1y9d_A603 Pyruvate Oxidase Variant V265a From Lactobacillus P 1e-35
1pox_A585 The Refined Structures Of A Stabilized Mutant And O 7e-35
1v5e_A590 Crystal Structure Of Pyruvate Oxidase Containing Fa 8e-34
1v5f_A589 Crystal Structure Of Pyruvate Oxidase Complexed Wit 1e-33
1upb_A573 Carboxyethylarginine Synthase From Streptomyces Cla 5e-31
1upa_A573 Carboxyethylarginine Synthase From Streptomyces Cla 2e-29
2uz1_B563 1.65 Angstrom Structure Of Benzaldehyde Lyase Compl 8e-29
2ag0_A563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Nati 9e-29
3d7k_A570 Crystal Structure Of Benzaldehyde Lyase In Complex 1e-28
3iae_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Be 1e-28
3iaf_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Mo 1e-28
2ag1_A563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Seme 6e-27
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 2e-24
2c31_A568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 2e-24
2v3w_A528 Crystal Structure Of The Benzoylformate Decarboxyla 1e-17
1po7_A528 High Resolution Structure Of E28a Mutant Benzoylfor 2e-17
3f6b_X525 Crystal Structure Of Benzoylformate Decarboxylase I 2e-17
2fn3_A528 High Resolution Structure Of S26a Mutant Of Benzoyl 3e-17
1yno_A527 High Resolution Structure Of Benzoylformate Decarbo 3e-17
3fzn_A534 Intermediate Analogue In Benzoylformate Decarboxyla 3e-17
1mcz_A528 Benzoylformate Decarboxylase From Pseudomonas Putid 3e-17
1pi3_A528 E28q Mutant Benzoylformate Decarboxylase From Pseud 3e-17
2fwn_A528 Phosphorylation Of An Active Site Serine In A Thdp- 4e-17
2vbf_A570 The Holostructure Of The Branched-Chain Keto Acid D 7e-15
2vbi_A566 Holostructure Of Pyruvate Decarboxylase From Acetob 4e-12
2vjy_A563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 4e-11
2nxw_A565 Crystal Structure Of Phenylpyruvate Decarboxylase O 3e-09
1qpb_A563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 6e-09
2w93_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 7e-09
1ovm_A552 Crystal Structure Of Indolepyruvate Decarboxylase F 7e-09
2vk1_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 3e-08
2vk8_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 4e-08
1pvd_A555 Crystal Structure Of The Thiamin Diphosphate Depend 4e-08
1pyd_A556 Catalytic Centers In The Thiamin Diphosphate Depend 4e-08
1zpd_A568 Pyruvate Decarboxylase From Zymomonas Mobilis Lengt 5e-06
3oe1_A568 Pyruvate Decarboxylase Variant Glu473asp From Z. Mo 1e-05
2wva_A568 Structural Insights Into The Pre-Reaction State Of 2e-05
>pdb|1YBH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl Length = 590 Back     alignment and structure 
Iteration: 1

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/582 (66%), Positives = 473/582 (81%), Gaps = 2/582 (0%)
Query: 60  FSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQG 118
           F SRFAPD+PRKGADI+VEALERQGV TVFAYPGGAS+EIHQ+LTRS+ IR++LPRHEQG
Sbjct: 2   FISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQG 61
Query: 119 GIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAF 178
           G+FAAEGYARSSG PG+C+ +SGPG TN+++GL DA  DS+P++AITGQV ++++GTDAF
Sbjct: 62  GVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAF 121
Query: 179 QEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPN 238
           QE P+VEVTR +TKHNYLV+DV+DIPRII+EAFF+ATSGRPGPVL+D+P D+Q +LA+PN
Sbjct: 122 QETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPN 181
Query: 239 WNQPCKLPSCISSLPKEPDELALRQTLKLIVESKNPVLCVGGGCLNSSEELRKFVGLTGI 298
           W Q  +LP  +S +PK P++  L Q ++LI ESK PVL VGGGCLNSS+EL +FV LTGI
Sbjct: 182 WEQAMRLPGYMSRMPKPPEDSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGI 241
Query: 299 PVTCTTMGLGLFPCTDELCLRMVGMFGTVYANYAVNECDLLLAAGVRFNERMTSKLEDFA 358
           PV  T MGLG +P  DEL L M+GM GTVYANYAV   DLLLA GVRF++R+T KLE FA
Sbjct: 242 PVASTLMGLGSYPXDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFA 301
Query: 359 TRAKIVHIDIDSNEIGKVKLPDVSICADAKLVFNRMNMILESKGVGFMFDFSAWREELHE 418
           +RAKIVHIDIDS EIGK K P VS+C D KL    MN +LE++      DF  WR EL+ 
Sbjct: 302 SRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFGVWRNELNV 361
Query: 419 QKKKYPFSYKTFGEEIPPQYAIQILNELTDDEETIISTGVGQHQMWAIQFYMYKRARQLL 478
           QK+K+P S+KTFGE IPPQYAI++L+ELTD  + IISTGVGQHQMWA QFY YK+ RQ L
Sbjct: 362 QKQKFPLSFKTFGEAIPPQYAIKVLDELTDG-KAIISTGVGQHQMWAAQFYNYKKPRQWL 420
Query: 479 TSSGFGSMGFGLXXXXXXXXXXXXXIVVDIDGDGSFIMNLQELAAIKAENIPVKILLINN 538
           +S G G+MGFGL             IVVDIDGDGSFIMN+QELA I+ EN+PVK+LL+NN
Sbjct: 421 SSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNN 480
Query: 539 QYLGMNVEYEDRYFEANRANSFLGDPLRKSEIFPDMLKFAEACGIPAARVTKKKDVRAAI 598
           Q+LGM +++EDR+++ANRA++FLGDP ++ EIFP+ML FA ACGIPAARVTKK D+R AI
Sbjct: 481 QHLGMVMQWEDRFYKANRAHTFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAI 540
Query: 599 QLMLETPGPYLLDVMVSYQEHVVPMIPYDKSFKDTILEDDGR 640
           Q ML+TPGPYLLDV+  +QEHV+PMIP   +F D I E DGR
Sbjct: 541 QTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEGDGR 582
>pdb|3E9Y|A Chain A, Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With Monosulfuron Length = 584 Back     alignment and structure
>pdb|1N0H|A Chain A, Crystal Structure Of Yeast Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide, Chlorimuron Ethyl Length = 677 Back     alignment and structure
>pdb|1JSC|A Chain A, Crystal Structure Of The Catalytic Subunit Of Yeast Acetohydroxyacid Synthase: A Target For Herbicidal Inhibitors Length = 630 Back     alignment and structure
>pdb|2PAN|A Chain A, Crystal Structure Of E. Coli Glyoxylate Carboligase Length = 616 Back     alignment and structure
>pdb|3EYA|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 549 Back     alignment and structure
>pdb|3EY9|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 572 Back     alignment and structure
>pdb|1OZG|A Chain A, The Crystal Structure Of Klebsiella Pneumoniae Acetolactate Synthase With Enzyme-bound Cofactor And With An Unusual Intermediate Length = 566 Back     alignment and structure
>pdb|2PGN|A Chain A, The Crystal Structure Of Fad And Thdp-Dependent Cyclohexane-1,2-Dione Hydrolase In Complex With Cyclohexane-1,2-Dione Length = 589 Back     alignment and structure
>pdb|2EZ4|A Chain A, Pyruvate Oxidase Variant F479w Length = 603 Back     alignment and structure
>pdb|1POW|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|4FEE|A Chain A, High-Resolution Structure Of Pyruvate Oxidase In Complex With Reaction Intermediate 2-Hydroxyethyl-Thiamin Diphosphate Carbanion-Enamine, Crystal B Length = 603 Back     alignment and structure
>pdb|1Y9D|A Chain A, Pyruvate Oxidase Variant V265a From Lactobacillus Plantarum Length = 603 Back     alignment and structure
>pdb|1POX|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|1V5E|A Chain A, Crystal Structure Of Pyruvate Oxidase Containing Fad, From Aerococcus Viridans Length = 590 Back     alignment and structure
>pdb|1V5F|A Chain A, Crystal Structure Of Pyruvate Oxidase Complexed With Fad And Tpp, From Aerococcus Viridans Length = 589 Back     alignment and structure
>pdb|1UPB|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus Length = 573 Back     alignment and structure
>pdb|1UPA|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus (semet Structure) Length = 573 Back     alignment and structure
>pdb|2UZ1|B Chain B, 1.65 Angstrom Structure Of Benzaldehyde Lyase Complexed With 2-Methyl-2,4-Pentanediol Length = 563 Back     alignment and structure
>pdb|2AG0|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Native Length = 563 Back     alignment and structure
>pdb|3D7K|A Chain A, Crystal Structure Of Benzaldehyde Lyase In Complex With The Inhibitor Mbp Length = 570 Back     alignment and structure
>pdb|3IAE|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|3IAF|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Monomethyl Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|2AG1|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Semet Length = 563 Back     alignment and structure
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|2V3W|A Chain A, Crystal Structure Of The Benzoylformate Decarboxylase Variant L461a From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|1PO7|A Chain A, High Resolution Structure Of E28a Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3F6B|X Chain X, Crystal Structure Of Benzoylformate Decarboxylase In Complex With The Pyridyl Inhibitor Paa Length = 525 Back     alignment and structure
>pdb|2FN3|A Chain A, High Resolution Structure Of S26a Mutant Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 528 Back     alignment and structure
>pdb|1YNO|A Chain A, High Resolution Structure Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 527 Back     alignment and structure
>pdb|3FZN|A Chain A, Intermediate Analogue In Benzoylformate Decarboxylase Length = 534 Back     alignment and structure
>pdb|1MCZ|A Chain A, Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With An Inhibitor, R-Mandelate Length = 528 Back     alignment and structure
>pdb|1PI3|A Chain A, E28q Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2FWN|A Chain A, Phosphorylation Of An Active Site Serine In A Thdp- Dependent Enzyme By Phosphonate Inactivation Length = 528 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure
>pdb|2VBI|A Chain A, Holostructure Of Pyruvate Decarboxylase From Acetobacter Pasteurianus Length = 566 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|2NXW|A Chain A, Crystal Structure Of Phenylpyruvate Decarboxylase Of Azospirillum Brasilense Length = 565 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|1OVM|A Chain A, Crystal Structure Of Indolepyruvate Decarboxylase From Enterobacter Cloacae Length = 552 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|1ZPD|A Chain A, Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure
>pdb|3OE1|A Chain A, Pyruvate Decarboxylase Variant Glu473asp From Z. Mobilis In Complex With Reaction Intermediate 2-Lactyl-Thdp Length = 568 Back     alignment and structure
>pdb|2WVA|A Chain A, Structural Insights Into The Pre-Reaction State Of Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 0.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 0.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 0.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 0.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 0.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 0.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 0.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 0.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 0.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 0.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 0.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 0.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 0.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 0.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 1e-175
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 1e-173
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 1e-172
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 1e-168
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 1e-165
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-118
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-113
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 1e-96
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 2e-05
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 3e-04
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Length = 170 Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query643
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 100.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.86
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.8
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.72
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.66
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 99.64
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 99.64
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 99.62
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.62
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 99.6
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.57
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.56
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 99.56
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.56
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.56
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.54
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 99.53
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.53
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.52
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.52
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 99.51
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.43
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 99.14
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 99.08
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 98.94
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 98.83
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 98.75
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.15
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 97.41
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 95.68
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxido 95.3
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 95.15
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; 94.98
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 94.93
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 94.77
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 94.57
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 94.55
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 94.39
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 94.3
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 94.29
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 94.2
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 93.83
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 93.81
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 93.69
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 93.57
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 93.55
1m2k_A249 Silent information regulator 2; protein-ligand com 93.53
1efv_A315 Electron transfer flavoprotein; electron transport 93.49
3c2q_A345 Uncharacterized conserved protein; putative LOR/SD 93.43
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 93.28
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 93.13
1o97_D320 Electron transferring flavoprotein alpha-subunit; 93.1
1gpu_A680 Transketolase; transferase(ketone residues); HET: 93.06
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 92.97
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 92.95
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 92.92
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 92.83
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 92.83
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 92.77
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 92.75
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 92.74
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 92.74
3l84_A632 Transketolase; TKT, structural genomics, center fo 92.68
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 92.61
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 92.5
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 92.43
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 91.6
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 91.47
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 91.24
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 91.17
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 91.04
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 90.81
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 90.71
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 90.68
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 90.31
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 90.19
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 90.17
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 90.14
3rim_A700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 89.98
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 89.95
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 89.81
3uk1_A711 Transketolase; structural genomics, seattle struct 89.49
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 88.91
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 88.88
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 88.71
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 88.63
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 88.52
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 88.51
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 88.2
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 88.14
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 88.07
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 87.49
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 87.22
2iv2_X 715 Formate dehydrogenase H; oxidoreductase, 4Fe-4S, a 85.24
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 85.06
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 85.06
1yd7_A 395 2-keto acid:ferredoxin oxidoreductase subunit alph 82.14
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 82.04
3i9v_3783 NADH-quinone oxidoreductase subunit 3; electron tr 81.93
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>3c2q_A Uncharacterized conserved protein; putative LOR/SDH, structural genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis S2} Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 643
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 2e-64
d1ybha3208 c.36.1.9 (A:460-667) Acetohydroxyacid synthase cat 6e-53
d1t9ba2175 c.36.1.5 (A:89-263) Acetohydroxyacid synthase cata 1e-49
d1ybha1179 c.31.1.3 (A:281-459) Acetohydroxyacid synthase cat 4e-46
d1t9ba3227 c.36.1.9 (A:461-687) Acetohydroxyacid synthase cat 4e-36
d1ytla1158 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synth 6e-34
d1ozha2181 c.36.1.5 (A:7-187) Catabolic acetolactate synthase 1e-31
d1zpda3204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 2e-30
d1pvda2180 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's 4e-29
d1ovma2178 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase 5e-29
d2ez9a2174 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus 5e-29
d2ihta3198 c.36.1.9 (A:375-572) Carboxyethylarginine synthase 6e-29
d2djia2184 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus vi 5e-28
d1zpda2186 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomon 4e-27
d1q6za2180 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {P 9e-27
d1ozha3192 c.36.1.9 (A:367-558) Catabolic acetolactate syntha 1e-26
d2ji7a2188 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalo 2e-26
d1t9ba1171 c.31.1.3 (A:290-460) Acetohydroxyacid synthase cat 1e-25
d1pvda1179 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker 3e-25
d2djia3229 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus 8e-25
d2ihta2186 c.36.1.5 (A:12-197) Carboxyethylarginine synthase 1e-24
d2ihta1177 c.31.1.3 (A:198-374) Carboxyethylarginine synthase 1e-24
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 2e-24
d1ovma3196 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxyla 3e-24
d1ovma1161 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxyla 6e-24
d1q6za3183 c.36.1.9 (A:342-524) Benzoylformate decarboxylase 6e-24
d1pvda3196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 2e-23
d1ozha1179 c.31.1.3 (A:188-366) Catabolic acetolactate syntha 6e-23
d1zpda1175 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymom 1e-22
d2ez9a3228 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacill 2e-22
d1q6za1160 c.31.1.3 (A:182-341) Benzoylformate decarboxylase 2e-20
d2djia1177 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus 2e-19
d2ez9a1183 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacill 2e-18
d2ji7a1175 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxa 2e-16
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Acetohydroxyacid synthase catalytic subunit
species: Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]

 Score =  208 bits (531), Expect = 2e-64
 Identities = 139/194 (71%), Positives = 174/194 (89%), Gaps = 1/194 (0%)

Query: 60  FSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQG 118
           F SRFAPD+PRKGADI+VEALERQGV TVFAYPGGAS+EIHQ+LTRS+ IR++LPRHEQG
Sbjct: 2   FISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQG 61

Query: 119 GIFAAEGYARSSGTPGVCLVSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAF 178
           G+FAAEGYARSSG PG+C+ +SGPG TN+++GL DA  DS+P++AITGQV ++++GTDAF
Sbjct: 62  GVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAF 121

Query: 179 QEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSGRPGPVLIDIPVDVQLELAVPN 238
           QE P+VEVTR +TKHNYLV+DV+DIPRII+EAFF+ATSGRPGPVL+D+P D+Q +LA+PN
Sbjct: 122 QETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPN 181

Query: 239 WNQPCKLPSCISSL 252
           W Q  +LP  +S +
Sbjct: 182 WEQAMRLPGYMSRM 195
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 208 Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 179 Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 227 Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 158 Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 198 Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 192 Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 188 Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 179 Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 229 Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 177 Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 196 Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 161 Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 183 Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 175 Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 228 Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 160 Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 177 Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 183 Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query643
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 100.0
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 100.0
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 100.0
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 100.0
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 100.0
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 100.0
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.96
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.96
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.96
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.96
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.95
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.94
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.92
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.92
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.91
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.9
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.78
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 99.11
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 98.87
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 98.81
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 98.78
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 98.76
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 98.74
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 98.62
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 98.5
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 98.37
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 98.3
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 98.26
d2ieaa2 415 Pyruvate dehydrogenase E1 component, PP module {Es 97.35
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 97.03
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 97.01
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 96.83
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 96.83
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 96.71
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 96.69
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 96.61
d1efva2124 C-terminal domain of the electron transfer flavopr 96.48
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 96.48
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 96.41
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 96.38
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 96.34
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 96.3
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 96.26
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 96.19
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 96.14
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 96.12
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 95.94
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.87
d3clsd2123 C-terminal domain of the electron transfer flavopr 95.77
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 95.04
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 94.77
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 94.75
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 94.42
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 94.37
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 94.15
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 94.07
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 94.04
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 94.03
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 94.02
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 93.76
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 93.36
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.99
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 92.83
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 91.69
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 91.03
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 90.51
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 88.58
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 87.27
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 86.62
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 86.55
d1umdb1186 Branched-chain alpha-keto acid dehydrogenase, Pyr 86.54
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 84.55
d2ozlb1192 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 84.51
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 84.45
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 81.86
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 81.57
d1ik6a1191 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 80.37
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Acetohydroxyacid synthase catalytic subunit
species: Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]

Probab=100.00  E-value=7.4e-49  Score=378.00  Aligned_cols=190  Identities=73%  Similarity=1.250  Sum_probs=181.2

Q ss_pred             ccccccCCCCCCcHHHHHHHHHHHCCCCEEEEccCCCcHHHHHHHhhCC-CeEEecCChhHHHHHHHHHHHHhCCcEEEE
Q 040733           59 DFSSRFAPDKPRKGADIIVEALERQGVTTVFAYPGGASIEIHQSLTRSN-IRSILPRHEQGGIFAAEGYARSSGTPGVCL  137 (643)
Q Consensus        59 ~~~~~~~~~~~~~~a~~lv~~L~~~GV~~vFg~PG~~~~~l~~al~~~~-i~~i~~~hE~~A~~~A~Gyar~sg~~gv~~  137 (643)
                      +|++|++|.++|+|+|+|++.|+++||++|||+||+.+++|+++|.+++ ++++.+|||++|+|||+||+|+||||+||+
T Consensus         1 t~~~~~~~~~~~~Gad~i~~~L~~~Gv~~vFgipG~~~~~l~~al~~~~~i~~i~~rhE~~A~~mAdgyar~tg~~gv~~   80 (195)
T d1ybha2           1 TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICI   80 (195)
T ss_dssp             CCCCSSCTTCCEEHHHHHHHHHHTTTCCEEEECCCGGGHHHHHHHHHCSSCEECCCSSHHHHHHHHHHHHHHHSSCEEEE
T ss_pred             CccccCCCCCCccHHHHHHHHHHHCCCCEEEEcCCccHHHHHHHHhhhcceeecccccHHHHHHHHHHHHHHHCCCeEEE
Confidence            5899999999999999999999999999999999999999999998887 999999999999999999999999999999


Q ss_pred             EccchhhHHHHHHHHHhhhCCCCEEEEeCCCcccccCCCCCCccCHHHHhhccceeeeEeCCcCcHHHHHHHHHHHhhcC
Q 040733          138 VSSGPGVTNIMTGLMDAYSDSIPILAITGQVSQKLLGTDAFQEIPVVEVTRYMTKHNYLVLDVDDIPRIIKEAFFIATSG  217 (643)
Q Consensus       138 ~t~GpG~~N~~~gl~~A~~~~vPvlvItg~~~~~~~g~~~~Q~~d~~~~~~~~tk~~~~v~~~~~i~~~l~~A~~~A~s~  217 (643)
                      +|+|||++|+++||++|+.|++|||+|+|+.+....+++.+|+.|+.+++++++||++++.+++++++.+++||+.|.++
T Consensus        81 ~t~GpG~~N~~~gl~~A~~~~~Pvlvi~g~~~~~~~~~~~~q~~d~~~~~~~~tk~~~~v~~~~~~~~~~~~A~~~a~~~  160 (195)
T d1ybha2          81 ATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSG  160 (195)
T ss_dssp             ECTTHHHHTTHHHHHHHHHHTCCEEEEEEECCGGGTTTTCTTCCCHHHHHGGGSSEEEECCCGGGHHHHHHHHHHHHHSS
T ss_pred             EecChHHHHHHHHHHHHHHcCCCEEEEecCCcHHHhccCcccccchhhhhcccccchhhcchHhhcchHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeEEEEcccchhhhccCCCCCCCCCCCCC
Q 040733          218 RPGPVLIDIPVDVQLELAVPNWNQPCKLPSC  248 (643)
Q Consensus       218 ~~GPV~i~iP~Dv~~~~~~~~~~~~~~~p~~  248 (643)
                      |+|||||+||.|++.+++.+.|+...++|.|
T Consensus       161 r~GPV~l~iP~Dv~~~~~~~~~~~~~~~Pg~  191 (195)
T d1ybha2         161 RPGPVLVDVPKDIQQQLAIPNWEQAMRLPGY  191 (195)
T ss_dssp             SCCEEEEEEEHHHHHCEECCCTTCCCCCHHH
T ss_pred             CCCcEEEECChHHhhCccCCCCcccCCCCCC
Confidence            9999999999999998887766554444443
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure