Citrus Sinensis ID: 041090


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSSQGGSRRSQKRAPSTSKRTSSSENGGNLSKPPSPQGESSSSVGGAGGERTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEcHHHHHHHHHccccccccccccccccccEEEcccccHHHHHHHHHHcccEEEcEEEccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHccEEEEEcccccHHHHHHHHHHHcccEEEEEEccEEEEEEEHHHHHHHHHHccccccccccccccccc
cccccccHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHccccccEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEccHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHHHcccccccEcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHcccccccEEEccccHHHHHHHHHHHccccEEEEEEccEEEEEEccHHHHHHHHcccccccccEEEEEEccc
mssqggsrrsqkrapstskrtsssenggnlskppspqgessssvggaggerTVKKLRLSkaltipegtivSDACRRMASRRVDAVLLTDANALLsgivtdkdittrviaeglrpdqtvvskimtrnpifvtsDSLAIEALQKMVQGKfrhlpvvengevIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVErqwgsnfsapYAFIETLRERmfkpslstiitenakvaivspsdPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
mssqggsrrsqkrapstskrtsssenggnlskppspqgessssvggaggertvkklrlskaltipegtivsdacRRMASRRVDAVLLTDanallsgivtdkdittrviaeglrpdqtvvskimtrnpifvTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIItenakvaivspsDPVAVAAKKMREfrsnsalivtgskiqgiLTSKDVLMRVVAqnlspeltlverFIMRI
MssqggsrrsqKRAPSTSKRTSSSENGGNLSKPPSPQgessssvggaggeRTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
*********************************************************LSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFI***
*******************************************************LRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQ*GSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
**************************************************RTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
****************************************************V*KLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQGGSRRSQKRAPSTSKRTSSSENGGNLSKPPSPQGESSSSVGGAGGERTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFIMRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query294 2.2.26 [Sep-21-2011]
Q9LF97 556 CBS domain-containing pro yes no 0.982 0.519 0.769 1e-124
Q9SJQ5 536 CBS domain-containing pro no no 0.860 0.472 0.783 1e-113
Q9FMV3 543 CBS domain-containing pro no no 0.955 0.517 0.612 4e-98
P0DH79 548 CBS domain-containing pro no no 0.836 0.448 0.635 3e-90
Q0WLC7 548 CBS domain-containing pro no no 0.836 0.448 0.635 3e-90
O13965 730 Meiotically up-regulated yes no 0.785 0.316 0.289 2e-27
P32987164 Uncharacterized 17.7 kDa N/A no 0.486 0.871 0.272 3e-07
Q58069194 Uncharacterized protein M yes no 0.316 0.479 0.287 4e-06
Q9LEV3206 CBS domain-containing pro no no 0.326 0.466 0.3 2e-05
P50100196 Uncharacterized protein M no no 0.299 0.448 0.303 2e-05
>sp|Q9LF97|Y3295_ARATH CBS domain-containing protein CBSCBSPB3 OS=Arabidopsis thaliana GN=CBSCBSPB3 PE=1 SV=1 Back     alignment and function desciption
 Score =  445 bits (1144), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/295 (76%), Positives = 255/295 (86%), Gaps = 6/295 (2%)

Query: 2   SSQGGSRRSQ--KRAPSTSKRTSSSENG---GNLSKPPSPQGESSSSVGGAGGERTVKKL 56
           SS  G R +   +R P  SK+   SENG   GN SKP S       S   + GERTVKKL
Sbjct: 9   SSTSGRRSNSTVRRGPPPSKKPVQSENGSVNGNTSKPNS-PPPQPQSQAPSNGERTVKKL 67

Query: 57  RLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQ 116
           RLSKALTIPEGT V DACRRMA+RRVDA LLTD++ALLSGIVTDKD+ TRVIAEGLRPDQ
Sbjct: 68  RLSKALTIPEGTTVFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIAEGLRPDQ 127

Query: 117 TVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRM 176
           T+VSK+MTRNPIFVTSDSLA+EALQKMVQGKFRHLPVVENGEVIA+LDITKCLYDAISRM
Sbjct: 128 TLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVVENGEVIALLDITKCLYDAISRM 187

Query: 177 EKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPS 236
           EKAAEQGSA+AAAVEGVE+QWGS +SAPYAFIETLRERMFKP+LSTIIT+N+KVA+V+PS
Sbjct: 188 EKAAEQGSALAAAVEGVEKQWGSGYSAPYAFIETLRERMFKPALSTIITDNSKVALVAPS 247

Query: 237 DPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFI 291
           DPV+VAAK+MR+ R NS +I TG+KI GILTSKD+LMRVVAQNLSPELTLVE+ +
Sbjct: 248 DPVSVAAKRMRDLRVNSVIISTGNKISGILTSKDILMRVVAQNLSPELTLVEKVM 302





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SJQ5|Y2650_ARATH CBS domain-containing protein CBSCBSPB2 OS=Arabidopsis thaliana GN=CBSCBSPB2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMV3|Y5349_ARATH CBS domain-containing protein CBSCBSPB1 OS=Arabidopsis thaliana GN=CBSCBSPB1 PE=1 SV=1 Back     alignment and function description
>sp|P0DH79|Y5064_ARATH CBS domain-containing protein CBSCBSPB5 OS=Arabidopsis thaliana GN=CBSCBSPB5 PE=2 SV=1 Back     alignment and function description
>sp|Q0WLC7|Y5053_ARATH CBS domain-containing protein CBSCBSPB4 OS=Arabidopsis thaliana GN=CBSCBSPB4 PE=2 SV=2 Back     alignment and function description
>sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug70 PE=1 SV=1 Back     alignment and function description
>sp|P32987|YBP3_ACIAM Uncharacterized 17.7 kDa protein in bps2 3'region OS=Acidianus ambivalens PE=4 SV=1 Back     alignment and function description
>sp|Q58069|Y653_METJA Uncharacterized protein MJ0653 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0653 PE=4 SV=1 Back     alignment and function description
>sp|Q9LEV3|CBSX3_ARATH CBS domain-containing protein CBSX3, mitochondrial OS=Arabidopsis thaliana GN=CBSX3 PE=1 SV=1 Back     alignment and function description
>sp|P50100|Y525_METKA Uncharacterized protein MK0525 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0525 PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
296082621 556 unnamed protein product [Vitis vinifera] 0.959 0.507 0.802 1e-127
225438337 539 PREDICTED: CBS domain-containing protein 0.935 0.510 0.816 1e-127
118489093 555 unknown [Populus trichocarpa x Populus d 0.972 0.515 0.763 1e-127
449457321 539 PREDICTED: CBS domain-containing protein 0.901 0.491 0.824 1e-125
449519605 539 PREDICTED: LOW QUALITY PROTEIN: CBS doma 0.901 0.491 0.816 1e-124
42565877 556 CBS / octicosapeptide/Phox/Bemp1 domain- 0.982 0.519 0.769 1e-122
224093670 488 predicted protein [Populus trichocarpa] 0.812 0.489 0.884 1e-122
255574194 546 conserved hypothetical protein [Ricinus 0.816 0.439 0.881 1e-122
297816584 556 CBS domain-containing protein [Arabidops 0.948 0.501 0.780 1e-121
297612744 542 Os12g0169400 [Oryza sativa Japonica Grou 0.942 0.511 0.739 1e-117
>gi|296082621|emb|CBI21626.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/293 (80%), Positives = 255/293 (87%), Gaps = 11/293 (3%)

Query: 10  SQKRAPST-SKRTSSSENGGNLSKPPSPQGESS----------SSVGGAGGERTVKKLRL 58
           SQKR PST SK+   +ENG + +K  SP   SS          S  G   G RTVKKLRL
Sbjct: 16  SQKRGPSTASKKAVLAENGSSNAKASSPTQISSDIFWVGLDYLSFDGLVDGVRTVKKLRL 75

Query: 59  SKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTV 118
           SKALTIPEGT VSDACRRMA+RRVDAVLLTD+NALLSGIVTDKDI TRVIAE LRP+QTV
Sbjct: 76  SKALTIPEGTTVSDACRRMAARRVDAVLLTDSNALLSGIVTDKDIATRVIAEELRPEQTV 135

Query: 119 VSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEK 178
           VSKIMTR+PIFV SDSLAIEAL+KMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEK
Sbjct: 136 VSKIMTRHPIFVNSDSLAIEALEKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEK 195

Query: 179 AAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDP 238
           AAE GSAIAAAVEGVERQWGSNF+APY+FIETLRERMFKP+LSTII EN KVAIVSPSDP
Sbjct: 196 AAEHGSAIAAAVEGVERQWGSNFTAPYSFIETLRERMFKPALSTIIAENTKVAIVSPSDP 255

Query: 239 VAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVERFI 291
           ++VAAKKMRE+R NS +I+TGSKIQGILTSKD+LMRVVAQNLSPELTLVE+ +
Sbjct: 256 ISVAAKKMREYRVNSVIIMTGSKIQGILTSKDILMRVVAQNLSPELTLVEKVM 308




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438337|ref|XP_002272502.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|118489093|gb|ABK96353.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449457321|ref|XP_004146397.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449519605|ref|XP_004166825.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein CBSCBSPB3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|42565877|ref|NP_190863.3| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis thaliana] gi|334185937|ref|NP_001190074.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis thaliana] gi|75263848|sp|Q9LF97.1|Y3295_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB3 gi|7529719|emb|CAB86899.1| putative protein [Arabidopsis thaliana] gi|332645495|gb|AEE79016.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis thaliana] gi|332645496|gb|AEE79017.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224093670|ref|XP_002309952.1| predicted protein [Populus trichocarpa] gi|222852855|gb|EEE90402.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574194|ref|XP_002528012.1| conserved hypothetical protein [Ricinus communis] gi|223532581|gb|EEF34368.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297816584|ref|XP_002876175.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322013|gb|EFH52434.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297612744|ref|NP_001066263.2| Os12g0169400 [Oryza sativa Japonica Group] gi|77553133|gb|ABA95929.1| CBS domain-containing protein, putative, expressed [Oryza sativa Japonica Group] gi|255670087|dbj|BAF29282.2| Os12g0169400 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
TAIR|locus:2167331 543 AT5G63490 "AT5G63490" [Arabido 0.809 0.438 0.684 3.1e-83
ASPGD|ASPL0000033419 666 AN5716 [Emericella nidulans (t 0.806 0.355 0.383 6.7e-38
CGD|CAL0003543 605 orf19.5238 [Candida albicans ( 0.761 0.370 0.323 1.6e-26
POMBASE|SPAC24C9.05c 730 mug70 "conserved protein Mug20 0.493 0.198 0.348 9.6e-20
UNIPROTKB|Q5LRC8144 SPO2201 "CBS domain protein" [ 0.411 0.840 0.288 2.2e-11
TIGR_CMR|SPO_2201144 SPO_2201 "CBS domain protein" 0.411 0.840 0.288 2.2e-11
UNIPROTKB|Q48IU0146 PSPPH_2494 "CBS domain protein 0.435 0.876 0.312 3e-11
UNIPROTKB|Q8EDA6 620 SO_2856 "Putative nucleotidylt 0.465 0.220 0.326 2.5e-10
TIGR_CMR|SO_2856 620 SO_2856 "CBS domain protein" [ 0.465 0.220 0.326 2.5e-10
UNIPROTKB|Q0BYV1144 HNE_2660 "CBS domain protein" 0.414 0.847 0.286 5.5e-10
TAIR|locus:2167331 AT5G63490 "AT5G63490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 834 (298.6 bits), Expect = 3.1e-83, P = 3.1e-83
 Identities = 163/238 (68%), Positives = 202/238 (84%)

Query:    51 RTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAE 110
             RTVK+LRLSKALT+P  T + +AC+RMASRRVDA+LLTD+N +L GI+TDKDI TRVI++
Sbjct:    53 RTVKRLRLSKALTVPATTTIYEACKRMASRRVDALLLTDSNEMLCGILTDKDIATRVISQ 112

Query:   111 GLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLY 170
              L  ++T VSK+MT+NP+FV S++LA+EALQKMVQGKFRHLPVVENGEVIA+LDI KCLY
Sbjct:   113 ELNVEETPVSKVMTKNPMFVLSETLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLY 172

Query:   171 DAISRMEKAAEQGSAIAAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKV 230
             DAI+RME+AAE+G AIAAAVEGVE+ WG+N S P  FIETLR+RMF+PSLSTII ++ KV
Sbjct:   173 DAIARMERAAEKGKAIAAAVEGVEKSWGTNTSVPNTFIETLRDRMFRPSLSTIIPDDTKV 232

Query:   231 AIVSPSDPVAVAAKKMREFRSNSALIVTGSKIQGILTSKDVLMRVVAQNLSPELTLVE 288
               VSP+D V   AKKM EF+S+ A+++   K++GI TSKD+LMRVVA+NL P  TLVE
Sbjct:   233 LKVSPTDTVLTVAKKMVEFQSSCAVVIIEDKLRGIFTSKDILMRVVAENLPPSETLVE 290


GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
ASPGD|ASPL0000033419 AN5716 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0003543 orf19.5238 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPAC24C9.05c mug70 "conserved protein Mug20" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LRC8 SPO2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2201 SPO_2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EDA6 SO_2856 "Putative nucleotidyltransferase DUF294" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2856 SO_2856 "CBS domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYV1 HNE_2660 "CBS domain protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LF97Y3295_ARATHNo assigned EC number0.76940.98290.5197yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT3G52950
CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein; CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein; LOCATED IN- chloroplast; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 15 growth stages; CONTAINS InterPro DOMAIN/s- Octicosapeptide/Phox/Bem1p (InterPro-IPR000270), Cystathionine beta-synthase, core (InterPro-IPR000644); BEST Arabidopsis thaliana protein match is- CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein (TAIR-AT2G36500.1); Has 4350 Blast hits to 3 [...] (556 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
BGLU12
BGLU12 (BETA GLUCOSIDASE 12); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl com [...] (507 aa)
       0.790
BGLU15
BGLU15 (BETA GLUCOSIDASE 15); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl com [...] (506 aa)
       0.790
AT5G27570
WD-40 repeat family protein; WD-40 repeat family protein; FUNCTIONS IN- signal transducer activ [...] (411 aa)
       0.788
BGLU14
BGLU14 (BETA GLUCOSIDASE 14); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl com [...] (489 aa)
       0.788
AT2G03270
DNA-binding protein, putative; DNA-binding protein, putative; FUNCTIONS IN- nucleoside-triphosp [...] (639 aa)
       0.788
AT5G27080
WD-40 repeat family protein; WD-40 repeat family protein; FUNCTIONS IN- signal transducer activ [...] (466 aa)
       0.788
BGLU13
BGLU13 (BETA GLUCOSIDASE 13); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl com [...] (507 aa)
       0.748
ARI1
ARI1 (ARIADNE); protein binding / zinc ion binding; ARIADNE (ARI1); FUNCTIONS IN- protein bindi [...] (597 aa)
       0.744
ARI3
zinc finger protein-related; zinc finger protein-related; FUNCTIONS IN- protein binding, zinc i [...] (537 aa)
       0.679
ARI4
zinc finger protein-related; zinc finger protein-related; FUNCTIONS IN- zinc ion binding; CONTA [...] (493 aa)
       0.677

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd 3e-46
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 4e-32
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 1e-28
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd 2e-22
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 3e-21
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 1e-19
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 3e-19
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 8e-19
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain 2e-17
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 7e-15
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con 8e-14
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 1e-13
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 3e-13
cd04630114 cd04630, CBS_pair_17, The CBS domain, named after 4e-13
cd04589111 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd 3e-12
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 9e-12
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd c 2e-11
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 5e-11
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 1e-09
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 2e-09
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after 1e-08
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 2e-08
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 2e-08
pfam0057157 pfam00571, CBS, CBS domain 3e-08
TIGR00393268 TIGR00393, kpsF, KpsF/GutQ family protein 4e-08
cd04593115 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con 9e-08
cd04620115 cd04620, CBS_pair_7, The CBS domain, named after h 9e-08
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 2e-07
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 2e-07
cd04619114 cd04619, CBS_pair_6, The CBS domain, named after h 2e-07
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 3e-07
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 3e-07
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 3e-07
cd04626111 cd04626, CBS_pair_13, The CBS domain, named after 3e-07
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 5e-07
cd04625112 cd04625, CBS_pair_12, The CBS domain, named after 5e-07
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two 1e-06
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-06
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai 2e-06
cd04617118 cd04617, CBS_pair_4, The CBS domain, named after h 2e-06
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 2e-06
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 3e-06
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after 4e-06
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains tw 4e-06
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 8e-06
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 8e-06
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains t 3e-05
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 5e-05
pfam0057157 pfam00571, CBS, CBS domain 5e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 6e-05
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 6e-05
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after h 8e-05
COG2239451 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains 9e-05
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 1e-04
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 1e-04
pfam0057157 pfam00571, CBS, CBS domain 1e-04
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after 1e-04
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 2e-04
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 2e-04
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 2e-04
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after 2e-04
COG2524294 COG2524, COG2524, Predicted transcriptional regula 2e-04
PRK10892326 PRK10892, PRK10892, D-arabinose 5-phosphate isomer 3e-04
cd04606109 cd04606, CBS_pair_Mg_transporter, This cd contains 4e-04
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 4e-04
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 5e-04
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 6e-04
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after 8e-04
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 8e-04
PRK11543321 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; 8e-04
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 9e-04
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 0.002
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 0.002
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 0.002
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after 0.002
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 0.002
COG2524294 COG2524, COG2524, Predicted transcriptional regula 0.003
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 0.004
cd04594104 cd04594, CBS_pair_EriC_assoc_archaea, This cd cont 0.004
>gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
 Score =  151 bits (383), Expect = 3e-46
 Identities = 55/114 (48%), Positives = 77/114 (67%), Gaps = 2/114 (1%)

Query: 59  SKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTV 118
           +K  T+   T V +A + M  +RV  VL+ D N L  GI T KDI  RV+A+GL P+ T+
Sbjct: 1   TKPATVSPTTTVQEAAKLMREKRVSCVLVMDGNKL-VGIFTSKDIALRVVAQGLDPESTL 59

Query: 119 VSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVV-ENGEVIAILDITKCLYD 171
           V ++MT NP+  TSD+  +EAL  MVQGKFRHLPVV ++G+V+ +LD+TK  + 
Sbjct: 60  VERVMTPNPVCATSDTPVLEALHLMVQGKFRHLPVVDKSGQVVGLLDVTKLTHA 113


Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Length = 113

>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein Back     alignment and domain information
>gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|239991 cd04619, CBS_pair_6, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|239989 cd04617, CBS_pair_4, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225148 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|182814 PRK10892, PRK10892, D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239967 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 294
COG2524294 Predicted transcriptional regulator, contains C-te 99.82
COG2524294 Predicted transcriptional regulator, contains C-te 99.79
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.77
COG3620187 Predicted transcriptional regulator with C-termina 99.75
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.71
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.7
COG3620187 Predicted transcriptional regulator with C-termina 99.7
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.7
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.67
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.66
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.65
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.64
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.64
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.64
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.64
COG2905 610 Predicted signal-transduction protein containing c 99.64
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.64
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.63
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.62
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.6
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.6
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.59
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.59
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.59
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.58
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.58
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.58
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.58
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.58
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.58
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.57
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.57
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.57
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.57
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.57
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.57
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.57
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.57
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.56
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.56
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.56
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.56
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.56
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.56
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.55
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.55
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.55
COG4109 432 Predicted transcriptional regulator containing CBS 99.55
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.55
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.55
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.55
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.55
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.55
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.55
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.55
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.55
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.54
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.54
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.54
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.54
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.54
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.54
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.53
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.53
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.53
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.53
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.53
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.53
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.53
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.52
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.52
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.52
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.52
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.51
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.51
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.51
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.51
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.51
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.51
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.51
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.51
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.51
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.51
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.5
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.5
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.5
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.5
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.5
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.5
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.5
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.5
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.5
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.5
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.49
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.49
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.49
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.49
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.49
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.49
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.49
PRK11573413 hypothetical protein; Provisional 99.48
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.48
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.48
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.48
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.47
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.47
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.47
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.47
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.47
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.47
COG2905 610 Predicted signal-transduction protein containing c 99.47
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.47
COG0517117 FOG: CBS domain [General function prediction only] 99.47
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.47
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.46
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.46
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.46
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.46
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.46
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.46
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.46
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.46
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.46
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.45
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.45
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.45
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.45
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.45
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.45
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.45
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.45
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.44
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.44
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.44
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.44
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.44
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.44
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.44
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.43
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.43
COG4109432 Predicted transcriptional regulator containing CBS 99.43
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.43
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.42
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.42
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.42
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.42
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.42
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.42
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.42
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.41
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.4
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.4
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.4
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.39
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.39
COG0517117 FOG: CBS domain [General function prediction only] 99.39
COG1253429 TlyC Hemolysins and related proteins containing CB 99.38
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.38
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.37
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.37
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.37
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.36
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.36
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.36
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.36
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.35
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.35
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.34
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.34
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.34
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.32
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.32
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.31
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.31
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.29
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.27
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.24
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.23
PRK11573413 hypothetical protein; Provisional 99.22
COG1253429 TlyC Hemolysins and related proteins containing CB 99.2
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.19
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.08
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.04
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.96
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.9
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.87
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.83
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.78
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.71
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.69
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.67
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.53
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.51
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.48
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.48
COG4175386 ProV ABC-type proline/glycine betaine transport sy 98.23
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.22
smart0011649 CBS Domain in cystathionine beta-synthase and othe 98.04
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 98.01
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.01
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.94
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 97.62
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.09
KOG0476931 consensus Cl- channel CLC-2 and related proteins ( 96.74
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 96.7
COG4175386 ProV ABC-type proline/glycine betaine transport sy 96.48
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 95.88
KOG2118498 consensus Predicted membrane protein, contains two 94.21
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 93.04
KOG2118 498 consensus Predicted membrane protein, contains two 87.35
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
Probab=99.82  E-value=1.6e-19  Score=146.98  Aligned_cols=122  Identities=25%  Similarity=0.342  Sum_probs=112.0

Q ss_pred             CcccchhccccCCceeecCCCCHHHHHHHHHhCCCCEEEEEcCCCcEEEEEeHHHHHHHHHHcCCCCcccccccccccCC
Q 041090           48 GGERTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNP  127 (294)
Q Consensus        48 ~~~~~v~dl~~~~~~~v~~~~sv~~a~~~~~~~~~~~lpV~d~~~~~~Givt~~di~~~~~~~~~~~~~~~v~~~~~~~~  127 (294)
                      -.+.+|+++|+++++++.+++|+.||.++|.++++++.||+|++ +++|++|.+|+. ..+.++ .. ..+|+++|.+++
T Consensus       169 iPk~~V~~~~s~~~i~v~~d~tl~eaak~f~~~~i~GaPVvd~d-k~vGiit~~dI~-~aia~g-~~-~~kV~~~M~k~v  244 (294)
T COG2524         169 IPKEKVKNLMSKKLITVRPDDTLREAAKLFYEKGIRGAPVVDDD-KIVGIITLSDIA-KAIANG-NL-DAKVSDYMRKNV  244 (294)
T ss_pred             cCcchhhhhccCCceEecCCccHHHHHHHHHHcCccCCceecCC-ceEEEEEHHHHH-HHHHcC-Cc-cccHHHHhccCC
Confidence            45778999999999999999999999999999999999999965 999999999996 455555 33 679999999999


Q ss_pred             eEEcCCCcHHHHHHHHHhCCCcEEEEEE-CCEEEEEEehHHHHHHHH
Q 041090          128 IFVTSDSLAIEALQKMVQGKFRHLPVVE-NGEVIAILDITKCLYDAI  173 (294)
Q Consensus       128 ~~v~~~~~l~~~~~~~~~~~~~~~~V~~-~~~~vGivt~~dll~~~~  173 (294)
                      +++.+++.+.+|+++|..+++.++.|+| +|+++|++|+.|++..+.
T Consensus       245 itI~eDe~i~dAir~M~~~nVGRLlV~ds~gkpvGiITrTDIL~~ia  291 (294)
T COG2524         245 ITINEDEDIYDAIRLMNKNNVGRLLVTDSNGKPVGIITRTDILTRIA  291 (294)
T ss_pred             ceEcCchhHHHHHHHHHhcCcceEEEEccCCcEEEEEehHHHHHHhh
Confidence            9999999999999999999999999999 999999999999998654



>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
3fhm_A165 Crystal Structure Of The Cbs-Domain Containing Prot 5e-12
4fry_A157 The Structure Of A Putative Signal-Transduction Pro 4e-08
2rc3_A135 Crystal Structure Of Cbs Domain, Ne2398 Length = 13 8e-08
2yzi_A138 Crystal Structure Of Uncharacterized Conserved Prot 2e-06
>pdb|3FHM|A Chain A, Crystal Structure Of The Cbs-Domain Containing Protein Atu1752 From Agrobacterium Tumefaciens Length = 165 Back     alignment and structure

Iteration: 1

Score = 68.2 bits (165), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 35/113 (30%), Positives = 62/113 (54%) Query: 70 VSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIF 129 + +A + + ++ AV++TDA+ ++ GI T++D+ V +G Q VS MT+N + Sbjct: 46 IGEAAGTLHAHKIGAVVVTDADGVVLGIFTERDLVKAVAGQGAASLQQSVSVAMTKNVVR 105 Query: 130 VTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYDAISRMEKAAEQ 182 +S + ++ M G+FRH+PV ENG + I+ I + I +E AE Sbjct: 106 CQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVKARIGEIEAEAEH 158
>pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein With Cbs Domains From Burkholderia Ambifaria Mc40-6 Length = 157 Back     alignment and structure
>pdb|2RC3|A Chain A, Crystal Structure Of Cbs Domain, Ne2398 Length = 135 Back     alignment and structure
>pdb|2YZI|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Pyrococcus Horikoshii Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 4e-45
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 5e-10
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 1e-07
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 3e-41
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 2e-08
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 5e-08
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 2e-39
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 2e-09
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 2e-08
4fry_A157 Putative signal-transduction protein with CBS DOM; 2e-37
4fry_A157 Putative signal-transduction protein with CBS DOM; 4e-10
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 3e-30
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 8e-10
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 4e-08
1pvm_A184 Conserved hypothetical protein TA0289; structural 3e-25
1pvm_A184 Conserved hypothetical protein TA0289; structural 7e-09
1pvm_A 184 Conserved hypothetical protein TA0289; structural 3e-06
1pvm_A184 Conserved hypothetical protein TA0289; structural 4e-04
1pbj_A125 Hypothetical protein; structural genomics, domain, 6e-25
1pbj_A125 Hypothetical protein; structural genomics, domain, 6e-11
1pbj_A125 Hypothetical protein; structural genomics, domain, 2e-06
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 1e-24
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 8e-10
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 9e-08
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 2e-04
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 2e-24
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 5e-07
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 4e-05
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 5e-23
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 4e-20
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 3e-22
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 3e-09
3ddj_A296 CBS domain-containing protein; structural genomics 7e-22
3ddj_A296 CBS domain-containing protein; structural genomics 5e-19
3ddj_A296 CBS domain-containing protein; structural genomics 3e-16
3ddj_A 296 CBS domain-containing protein; structural genomics 3e-10
3ddj_A296 CBS domain-containing protein; structural genomics 1e-05
3ddj_A 296 CBS domain-containing protein; structural genomics 6e-05
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 3e-21
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 4e-16
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 4e-07
3fio_A70 A cystathionine beta-synthase domain protein fused 2e-20
3fio_A70 A cystathionine beta-synthase domain protein fused 2e-16
2o16_A160 Acetoin utilization protein ACUB, putative; struct 2e-18
2o16_A160 Acetoin utilization protein ACUB, putative; struct 7e-11
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 2e-17
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 3e-17
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 2e-07
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 5e-17
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 1e-09
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 2e-05
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 1e-15
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 6e-09
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 3e-05
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-14
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-13
1vr9_A213 CBS domain protein/ACT domain protein; structural 2e-14
1vr9_A213 CBS domain protein/ACT domain protein; structural 2e-07
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 3e-14
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 4e-08
3lqn_A150 CBS domain protein; csgid, structural genomics, un 4e-14
3lqn_A150 CBS domain protein; csgid, structural genomics, un 5e-04
3lqn_A150 CBS domain protein; csgid, structural genomics, un 5e-04
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 6e-14
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 7e-05
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 7e-05
1o50_A157 CBS domain-containing predicted protein TM0935; CB 9e-14
1o50_A157 CBS domain-containing predicted protein TM0935; CB 1e-10
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 1e-13
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 2e-04
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 6e-04
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 1e-13
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 1e-08
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 2e-13
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 1e-04
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 2e-04
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 3e-12
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 1e-11
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 4e-08
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-11
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-05
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-04
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 5e-11
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 4e-07
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 1e-09
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 5e-06
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 2e-09
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 2e-06
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 8e-08
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 2e-05
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 2e-04
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 2e-04
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
 Score =  149 bits (378), Expect = 4e-45
 Identities = 38/139 (27%), Positives = 70/139 (50%)

Query: 51  RTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAE 110
           + +   +    +T+     + +A   + + ++ AV++TDA+ ++ GI T++D+   V  +
Sbjct: 27  KDLLDRKGRDVVTVGPDVSIGEAAGTLHAHKIGAVVVTDADGVVLGIFTERDLVKAVAGQ 86

Query: 111 GLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLY 170
           G    Q  VS  MT+N +    +S   + ++ M  G+FRH+PV ENG +  I+ I   + 
Sbjct: 87  GAASLQQSVSVAMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK 146

Query: 171 DAISRMEKAAEQGSAIAAA 189
             I  +E  AE   A  A 
Sbjct: 147 ARIGEIEAEAEHIKAYIAG 165


>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
3ddj_A296 CBS domain-containing protein; structural genomics 99.96
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.96
3ddj_A296 CBS domain-containing protein; structural genomics 99.95
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.95
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.95
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.94
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.93
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.93
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.92
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.92
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.92
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.91
4esy_A170 CBS domain containing membrane protein; structural 99.87
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.86
4esy_A170 CBS domain containing membrane protein; structural 99.85
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.85
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.83
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.83
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.83
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.83
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.83
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.83
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.83
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.83
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.83
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.82
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.82
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.82
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.82
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.82
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.82
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.82
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.82
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.82
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.81
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.81
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.81
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.81
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.81
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.8
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.8
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.8
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.8
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.8
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.79
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.79
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.79
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.79
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.79
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.78
3ocm_A173 Putative membrane protein; structural genomics, PS 99.78
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.78
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.78
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.78
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.78
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.78
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.78
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.77
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.77
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.77
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.77
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.77
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.76
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.76
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.76
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.75
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.75
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.75
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.75
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.75
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.75
3ocm_A173 Putative membrane protein; structural genomics, PS 99.75
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.75
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.75
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.74
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.74
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.74
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.74
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.73
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.73
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.72
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.72
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.72
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.71
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.71
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.71
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.71
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.7
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.7
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.7
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.7
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.7
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.69
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.69
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.68
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.68
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.67
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.66
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.65
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.64
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.64
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 99.64
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.63
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.56
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.56
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.55
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.53
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.51
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.51
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.49
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.46
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.42
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.41
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.39
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.38
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.36
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.34
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.33
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.32
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.31
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.29
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.24
3fio_A70 A cystathionine beta-synthase domain protein fused 99.23
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.22
3fio_A70 A cystathionine beta-synthase domain protein fused 99.17
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.13
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.11
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.57
1tif_A78 IF3-N, translation initiation factor 3; IF3 N-term 82.13
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
Probab=99.96  E-value=4.7e-29  Score=216.77  Aligned_cols=212  Identities=16%  Similarity=0.197  Sum_probs=172.5

Q ss_pred             CCCCCCCcCCCCcccchhccccCCceeecCCCCHHHHHHHHHhCCCCEEEEEcCCCcEEEEEeHHHHHHHHHHcCC----
Q 041090           37 QGESSSSVGGAGGERTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGL----  112 (294)
Q Consensus        37 ~~~~~~~~~~~~~~~~v~dl~~~~~~~v~~~~sv~~a~~~~~~~~~~~lpV~d~~~~~~Givt~~di~~~~~~~~~----  112 (294)
                      .+-.+.|.++.|...+|+|+|.++++++++++|+.+|++.|.+++++.+||+|  |+++|++|.+||++.+.....    
T Consensus         6 ~~~~~~~~~~~~~~~~V~dim~~~~~~v~~~~~v~~a~~~m~~~~~~~~~V~d--~~l~GivT~~Di~~~~~~~~~~~~~   83 (296)
T 3ddj_A            6 IHHHHHHENLYFQGMNIETLMIKNPPILSKEDRLGSAFKKINEGGIGRIIVAN--EKIEGLLTTRDLLSTVESYCKDSCS   83 (296)
T ss_dssp             --------CCTTCCSSGGGTCEESCCEECTTSBHHHHHHHTTGGGCCEEEEES--SSEEEEEEHHHHHGGGTTCC---CC
T ss_pred             cccchhhhhhhhcccCHHHhccCCCcEECCCccHHHHHHHHHHCCCceEEEEC--CeEEEEEeHHHHHHHhccccccccc
Confidence            34455667889999999999999999999999999999999999999999999  899999999999854421110    


Q ss_pred             -----CCcccccccccccCCeEEcCCCcHHHHHHHHHhCCCcEEEEEE-CCEEEEEEehHHHHHHHHHHHHHHHhhchhH
Q 041090          113 -----RPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVE-NGEVIAILDITKCLYDAISRMEKAAEQGSAI  186 (294)
Q Consensus       113 -----~~~~~~v~~~~~~~~~~v~~~~~l~~~~~~~~~~~~~~~~V~~-~~~~vGivt~~dll~~~~~~~~~~~~~~~~~  186 (294)
                           .....+++++|.++++++.+++++.++++.|.+++++++||+| +|+++|++|..|++....             
T Consensus        84 ~~~~~~~~~~~v~~im~~~~~~v~~~~~~~~a~~~m~~~~~~~lpVvd~~~~lvGivt~~dl~~~~~-------------  150 (296)
T 3ddj_A           84 QGDLYHISTTPIIDYMTPNPVTVYNTSDEFTAINIMVTRNFGSLPVVDINDKPVGIVTEREFLLLYK-------------  150 (296)
T ss_dssp             HHHHHHHHTSBGGGTSEESCCCEETTSCHHHHHHHHHHHTCSEEEEECTTSCEEEEEEHHHHGGGGG-------------
T ss_pred             chhhHHHhcccHHHhccCCCEEEcCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeHHHHHHhhh-------------
Confidence                 1124689999999999999999999999999999999999998 899999999999875321             


Q ss_pred             HHHHHHHHHhhCCCCCChhhhHHHHHHhhcccchhhhhhcCCceeEeCCCCcHHHHHHHHHHhCCceeEEee-CCeEeEe
Q 041090          187 AAAVEGVERQWGSNFSAPYAFIETLRERMFKPSLSTIITENAKVAIVSPSDPVAVAAKKMREFRSNSALIVT-GSKIQGI  265 (294)
Q Consensus       187 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd-~g~~vGi  265 (294)
                                                ......++.++|.+  ++.++.+++++.+++++|.+++++.+||+| +|+++|+
T Consensus       151 --------------------------~~~~~~~v~~~m~~--~~~~v~~~~~l~~~~~~m~~~~~~~~~Vvd~~~~~~Gi  202 (296)
T 3ddj_A          151 --------------------------DLDEIFPVKVFMST--KVQTIYKEVRLDQAVKLMLRRGFRRLPVIDDDNKVVGI  202 (296)
T ss_dssp             --------------------------GSCCCCBHHHHSBC--SCCCEETTSBHHHHHHHHHHHTCSEEEEECTTSCEEEE
T ss_pred             --------------------------cccccccHHHhhcC--CCeEECCCCCHHHHHHHHHHcCCCEEEEEcCCCEEEEE
Confidence                                      11234578999976  899999999999999999999999999999 8999999


Q ss_pred             eehhHHHHHHHHccCC------CCcceeeeccc
Q 041090          266 LTSKDVLMRVVAQNLS------PELTLVERFIM  292 (294)
Q Consensus       266 vt~~Dil~~~~~~~~~------~~~~~v~~~~~  292 (294)
                      ||..|+++.+. ....      ....++.++|+
T Consensus       203 vt~~dl~~~~~-~~~~~~~~~~~~~~~v~~~m~  234 (296)
T 3ddj_A          203 VTVVNAIKQLA-KAVDKLDPDYFYGKVVKDVMV  234 (296)
T ss_dssp             EEHHHHHHHHH-HHHHHTCTHHHHTCBHHHHSB
T ss_pred             EEHHHHHHHHH-HHHhhcChhhhcCcCHHHHhC
Confidence            99999995544 2211      12456777775



>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>1tif_A IF3-N, translation initiation factor 3; IF3 N-terminal domain, ribosome binding factor; 1.80A {Geobacillus stearothermophilus} SCOP: d.15.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 294
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 2e-15
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 1e-05
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 6e-13
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 2e-05
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 8e-13
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 6e-06
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 1e-12
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 3e-07
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 7e-12
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 7e-04
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 4e-11
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 6e-06
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 8e-11
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 4e-07
d2ooxe2153 d.37.1.1 (E:182-334) Uncharacterized protein C1556 1e-10
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 3e-10
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 2e-07
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 2e-09
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 2e-09
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 8e-07
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 1e-08
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 8e-05
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 2e-08
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 6e-05
d3ddja2135 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 9e-08
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 1e-07
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 2e-04
d2yvxa2144 d.37.1.1 (A:132-275) Magnesium transporter MgtE {T 1e-07
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 2e-07
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 2e-07
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 9e-06
d1pbja3120 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A 1e-06
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 4e-06
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 3e-04
d2ouxa2127 d.37.1.1 (A:136-262) Magnesium transporter MgtE {E 2e-05
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 9e-05
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 0.001
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 3e-04
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 0.002
d2riha1131 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 0.001
d2riha1131 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 0.001
d1zfja4126 d.37.1.1 (A:95-220) Type II inosine monophosphate 0.002
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein NE2398
species: Nitrosomonas europaea [TaxId: 915]
 Score = 69.4 bits (169), Expect = 2e-15
 Identities = 38/127 (29%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 51  RTVKKLRLSKA---LTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRV 107
           +TVK L   K    + I     V +A ++MA+  + A+L+     L+ GI+T++D + + 
Sbjct: 2   KTVKHLLQEKGHTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLV-GILTERDFSRKS 60

Query: 108 IAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITK 167
                    T V +IMTR   +V  ++   + +  + + + RHLPV+++G+VI +L I  
Sbjct: 61  YLLDKPVKDTQVKEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGD 120

Query: 168 CLYDAIS 174
            + DAIS
Sbjct: 121 LVKDAIS 127


>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.9
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.88
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.88
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.88
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.87
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.87
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.86
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.85
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.85
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.85
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.84
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.84
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.84
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.84
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.84
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.84
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.83
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.83
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.83
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.83
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.83
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.82
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.81
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.81
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.8
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.8
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.8
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.8
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.79
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.79
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.79
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.79
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.79
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.79
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.79
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.78
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.77
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.76
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.75
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.75
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.74
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.74
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.74
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.73
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.73
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.72
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.71
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.71
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.68
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.68
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.66
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.65
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 82.8
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein Rv2626c
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.90  E-value=6.8e-24  Score=158.56  Aligned_cols=121  Identities=19%  Similarity=0.349  Sum_probs=113.5

Q ss_pred             cchhccccCCceeecCCCCHHHHHHHHHhCCCCEEEEEcCCCcEEEEEeHHHHHHHHHHcCCCCcccccccccccCCeEE
Q 041090           51 RTVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFV  130 (294)
Q Consensus        51 ~~v~dl~~~~~~~v~~~~sv~~a~~~~~~~~~~~lpV~d~~~~~~Givt~~di~~~~~~~~~~~~~~~v~~~~~~~~~~v  130 (294)
                      .+++|+|.++++++.+++++.+|++.|.+++++.+||+|++|+++|++|.+|++++++.++.......++++|.++++++
T Consensus         1 tt~~diM~~~~~~v~~~~tl~~a~~~m~~~~~~~~pVvd~~~~~~Giit~~Di~~~~~~~~~~~~~~~v~~im~~~~~~v   80 (123)
T d1y5ha3           1 TTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYV   80 (123)
T ss_dssp             CCHHHHSEETCCCEETTSBHHHHHHHHHHHTCSEEEEECGGGBEEEEEEHHHHHHTTGGGTCCTTTSBHHHHHTTCCCCE
T ss_pred             CCHHHhcCCCCcEECCcCcHHHHHHHHHHcCCCceEEEeccchhhhhhhhhhHhhhhhhcCCCcccceEEEEeeccceee
Confidence            37899999999999999999999999999999999999999999999999999877777777776778999999999999


Q ss_pred             cCCCcHHHHHHHHHhCCCcEEEEEECCEEEEEEehHHHHHH
Q 041090          131 TSDSLAIEALQKMVQGKFRHLPVVENGEVIAILDITKCLYD  171 (294)
Q Consensus       131 ~~~~~l~~~~~~~~~~~~~~~~V~~~~~~vGivt~~dll~~  171 (294)
                      .+++++.++++.|.+++++++||+|+|+++|+||..|++++
T Consensus        81 ~~~~~~~~~~~~m~~~~~~~lpVvd~~~lvGiit~~Dil~~  121 (123)
T d1y5ha3          81 DANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARH  121 (123)
T ss_dssp             ETTCCHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHT
T ss_pred             eecchHHHHHHHHHHcCceEEEEEECCEEEEEEEHHHHHhh
Confidence            99999999999999999999999998999999999999874



>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure