Citrus Sinensis ID: 041113

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980---
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGHGGSKMQNH
cHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccHHHHHcccccccccccccEEEEEccccccHHHHHHHHHccccEEEEEcccccccccccccEEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEcccHHHHHHcccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHcHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHcccEEccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccEEEEEEEcccccccccccccccEEEEEEEEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccccEEEEccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHccccccccEEccccccHHHHHHHHHHccccEEEccccccccccHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHccccccccccccccccccEEEEEEEEEEccccEEEEEEEEccccccccccEEEEEEccccccccHHHHHHHHccccEEEEEccccccccccccc
cHHHHHHHHHHHHcccccccEEEEcccccccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccHHHHHHccHHHHHHccccEEEEEccccccHHHHHHHHHccccEEEEEccccccccccccccEEEEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEccccHHEHHHHccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHccccccEEEEEEEcccccHEccccccccccHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccHEEEEEEEEEEEEcccccccccccccccccccEEEEEEEEEccccEEccccccccccHHHHHHHHHHHHHHHHHHcccccccEEHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEcccHHHHHcccHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEccHHcHHHHHHHHHHHHHHHHHHccccEEcccccccccHcccHHHHHHHHHcccccccEccccccccEHHcHHHHHHHHHHcEEcccEEEEEcccccEEEEEEEEEcccEEEEEEEEEccccccccccEEEEEEccccccccHHHHHHHHccccEEEEEEcccccHHHHccc
MILTTLDSAvhwatsspygpvhincpfrepldnspkhwmssCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECfpctyilvdnhpcrhdpshsvthRIQSTIVQFVDFLLKvqvphrsskwCSFLRALDMMVASEISFQicadysltephVAHELSRAltsnsalfvgnsmairdldmygrnwttCTHTVADImlnsefphqwirvagnrgasgidglLSTAIGFAVGCNKHVLCVVGdisflhdtNGLAILKQRMKRKPILMLVINNHggaifsllpiadrteprildqyfytTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTlnvlsqfsvpdtiscslSICKICRMEYSLYRIqlcapptssyidhnrsrfcrEGFILSLYledgsvgygevapleihkeNLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWiwstlgipaceifpsvRCGLEMAILNAIAVKHGssflnilyplteideeiskrSTSIKICAlidsnkspvEVASIATTLVEEGFTAIKLKVarradpikdAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKdcdlqyieepvqnEEDIIKYCEesglpvaldETIDKFQKDPlnmlekyahpgIVAIVIkpsviggfeNAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVmnrelcppvaqglgtyqwlkedvttdpisichnscrGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGflgtgeewIPIMKAVsgsarcisidlpghggskmqnh
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVlsqfsvpdtiSCSLSICKICRMEYSLYRIQLCAPptssyidhnrSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICalidsnkspvEVASIATTLVEEGFTAiklkvarradpikdaeviqevrkkvghrielrvdanrnwTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISidlpghggskmqnh
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGHGGSKMQNH
****TLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDL***********
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLS********SCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKV************ILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPG*********
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGH********
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTE*******RSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGHG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGHGGSKMQNH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query983 2.2.26 [Sep-21-2011]
Q15KI9 1715 Protein PHYLLO, chloropla yes no 0.990 0.567 0.604 0.0
B4S4J4578 2-succinyl-5-enolpyruvyl- yes no 0.426 0.724 0.317 7e-56
B3QL00583 2-succinyl-5-enolpyruvyl- yes no 0.427 0.720 0.315 4e-53
Q8KBE8582 2-succinyl-5-enolpyruvyl- yes no 0.424 0.716 0.298 7e-53
Q2S2V6591 2-succinyl-5-enolpyruvyl- yes no 0.431 0.717 0.292 4e-52
Q3B612583 2-succinyl-5-enolpyruvyl- yes no 0.423 0.713 0.292 2e-51
A1BI74587 2-succinyl-5-enolpyruvyl- yes no 0.436 0.730 0.304 5e-51
Q3APX4583 2-succinyl-5-enolpyruvyl- yes no 0.418 0.704 0.307 3e-49
B3EMZ5581 2-succinyl-5-enolpyruvyl- yes no 0.435 0.736 0.305 1e-48
Q1AS21574 2-succinyl-5-enolpyruvyl- yes no 0.425 0.728 0.304 3e-48
>sp|Q15KI9|PHYLO_ARATH Protein PHYLLO, chloroplastic OS=Arabidopsis thaliana GN=PHYLLO PE=2 SV=2 Back     alignment and function desciption
 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/983 (60%), Positives = 757/983 (77%), Gaps = 9/983 (0%)

Query: 1    MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYI 60
            M+LTT+DSA+HWAT S  GPVH+NCPFR+PLD SP +W S+CL GLD+W S+ EPFTKY 
Sbjct: 503  MVLTTVDSALHWATGSACGPVHLNCPFRDPLDGSPTNWSSNCLNGLDMWMSNAEPFTKYF 562

Query: 61   QVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
            QVQ SH     T  Q+ E+L++++   KGLLL+GA+H EDEIWA L LA+ + WPVVAD+
Sbjct: 563  QVQ-SHKSDGVTTGQITEILQVIKEAKKGLLLIGAIHTEDEIWASLLLAKELMWPVVADV 621

Query: 121  LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
            LSG+RLRKL   F+E   ++ F+DHLDHAL S+SV++ I+FDV+IQ+GSRITSKR+SQM+
Sbjct: 622  LSGVRLRKLFKPFVEKLTHV-FVDHLDHALFSDSVRNLIEFDVVIQVGSRITSKRVSQML 680

Query: 181  EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDM 240
            E+CFP  YILVD HPCRHDPSH VTHR+QS IVQF + +LK + P R SK    L+ALD 
Sbjct: 681  EKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFANCVLKSRFPWRRSKLHGHLQALDG 740

Query: 241  MVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTV 300
             +A E+SFQI A+ SLTEP+VAH LS+ALTS SALF+GNSM IRD+DMYG +    +H V
Sbjct: 741  AIAREMSFQISAESSLTEPYVAHMLSKALTSKSALFIGNSMPIRDVDMYGCSSENSSHVV 800

Query: 301  ADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLA 360
             D+ML++E P QWI+V GNRGASGIDGLLS+A GFAVGC K V+CVVGDISFLHDTNGLA
Sbjct: 801  -DMMLSAELPCQWIQVTGNRGASGIDGLLSSATGFAVGCKKRVVCVVGDISFLHDTNGLA 859

Query: 361  ILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLN 420
            ILKQR+ RKP+ +LVINN GG IF LLPIA +TEP +L+QYFYT H+ISI+NLCLAHG+ 
Sbjct: 860  ILKQRIARKPMTILVINNRGGGIFRLLPIAKKTEPSVLNQYFYTAHDISIENLCLAHGVR 919

Query: 421  HVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQF 480
            +V V TK ELE+AL +      D ++EVES I+ANA  HS L +FARQ+A+++L ++S  
Sbjct: 920  YVHVGTKSELEDALFVPSVEEMDCIVEVESSINANAIVHSTLERFARQAAENSLGIVSAS 979

Query: 481  SVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVG 540
            S    +  ++ +C++  ++YS YR++LC  PT        S+F REGFILSL LEDGS+G
Sbjct: 980  SFLHPMIKNVLLCQVSGIQYSQYRVKLCDRPT--ICSDEFSQFHREGFILSLTLEDGSIG 1037

Query: 541  YGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIF 600
            YGEVAPL  + ENL+D E QL+ +LH M  AK SY LPLL GS SSWIWS LGI A  IF
Sbjct: 1038 YGEVAPLNSNVENLMDVEGQLQLVLHLMNEAKFSYMLPLLNGSISSWIWSELGITASSIF 1097

Query: 601  PSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVA 660
            PSVRCGLEMA+LNA+AV+H SS L IL+   + +E  S +  S++ICAL+DS  +P+EVA
Sbjct: 1098 PSVRCGLEMALLNAMAVRHDSSLLGILH--YQKEENGSAQPHSVQICALLDSEGTPLEVA 1155

Query: 661  SIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEF 720
             +A  LV+EGF+AIKLKV RR   ++DA V+QEVR+ VG +IELR DAN  WT++EA EF
Sbjct: 1156 YVARKLVQEGFSAIKLKVGRRVSSVQDALVMQEVRRAVGVQIELRADANCRWTFEEAREF 1215

Query: 721  GFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVA 780
            G L+  C+L+YIEEPVQN++D+I++ EE+GLPVALDET+D F++ PL ML KY HPGIVA
Sbjct: 1216 GLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEECPLRMLTKYTHPGIVA 1275

Query: 781  IVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKV 840
            +VIKPSV+GGFENA LIARWAQ+HGKMAV+SAA+ESGLGLSAYI+F+SYLE++N      
Sbjct: 1276 VVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILFASYLEMENVKASTE 1335

Query: 841  MNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVI 900
              +   P VA GLGTY+WL EDV  + + I  +   GFVE  +A A+  L++++INNDVI
Sbjct: 1336 QKQGTPPSVAHGLGTYRWLSEDVMMNTLGIFRSPYSGFVEGFIADASRNLKDVKINNDVI 1395

Query: 901  CKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKA 960
             +TS    V RY+L V+   F  FI+V ++G+  + + ++ LFLHGFLGTGEEWIPIM  
Sbjct: 1396 VRTSKGIPVRRYELRVDVDGFSHFIRVHDVGE--NAEGSVALFLHGFLGTGEEWIPIMTG 1453

Query: 961  VSGSARCISIDLPGHGGSKMQNH 983
            +SGSARCIS+D+PGHG S++Q+H
Sbjct: 1454 ISGSARCISVDIPGHGRSRVQSH 1476
Multifunctional enzyme required for phylloquinone (vitamin K1) biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 9EC: 9EC: .EC: 2EC: 0
>sp|B4S4J4|MEND_PROA2 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|B3QL00|MEND_CHLP8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|Q8KBE8|MEND_CHLTE 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=menD PE=3 SV=2 Back     alignment and function description
>sp|Q2S2V6|MEND_SALRD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|Q3B612|MEND_PELLD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pelodictyon luteolum (strain DSM 273) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|A1BI74|MEND_CHLPD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|Q3APX4|MEND_CHLCH 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|B3EMZ5|MEND_CHLPB 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeobacteroides (strain BS1) GN=menD PE=3 SV=1 Back     alignment and function description
>sp|Q1AS21|MEND_RUBXD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=menD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query983
359473493 1614 PREDICTED: LOW QUALITY PROTEIN: protein 0.995 0.606 0.693 0.0
255546995 1679 menaquinone biosynthesis protein, putati 0.993 0.581 0.690 0.0
449478619 1794 PREDICTED: protein PHYLLO, chloroplastic 0.994 0.545 0.617 0.0
449435274 1794 PREDICTED: protein PHYLLO, chloroplastic 0.994 0.545 0.617 0.0
297838661 1716 2-oxoglutarate decarboxylase/ hydro-lyas 0.990 0.567 0.613 0.0
71738181 1715 chloroplast Phyllo [Arabidopsis thaliana 0.990 0.567 0.604 0.0
110742201 1371 hypothetical protein [Arabidopsis thalia 0.990 0.710 0.604 0.0
145337303 1715 2-oxoglutarate decarboxylase/ hydro-lyas 0.990 0.567 0.604 0.0
356555334 1614 PREDICTED: protein PHYLLO, chloroplastic 0.945 0.575 0.610 0.0
242062128 1704 hypothetical protein SORBIDRAFT_04g02416 0.991 0.572 0.512 0.0
>gi|359473493|ref|XP_002268761.2| PREDICTED: LOW QUALITY PROTEIN: protein PHYLLO, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/983 (69%), Positives = 806/983 (81%), Gaps = 4/983 (0%)

Query: 1    MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYI 60
            MILTTLDSAV+WATSSP GPVHINCPFREPL+NSPK WM SCLKGLD W SS EPFTKYI
Sbjct: 394  MILTTLDSAVYWATSSPCGPVHINCPFREPLENSPKEWMLSCLKGLDSWMSSAEPFTKYI 453

Query: 61   QVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
            Q+QHSHA    +  QMAEV+E++QG  +GLLL+GA+  ED+IWA L LA+H+ WPVVADI
Sbjct: 454  QLQHSHAPDD-SQGQMAEVIEVIQGAKRGLLLIGAITTEDDIWAALLLAKHLCWPVVADI 512

Query: 121  LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
            LSGLRLRKL  SF E E N+LFLDHLDHALLS+ V+ W Q DVIIQIGSRITSKRISQMI
Sbjct: 513  LSGLRLRKLSTSFQEIEDNVLFLDHLDHALLSDFVRVWAQADVIIQIGSRITSKRISQMI 572

Query: 181  EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDM 240
            E+CFPC+YI+VD HPCRHDPSH +THRIQSTI QF D L K Q P  SSKW   LRALDM
Sbjct: 573  EDCFPCSYIMVDKHPCRHDPSHLLTHRIQSTITQFADCLCKAQFPLMSSKWSVSLRALDM 632

Query: 241  MVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTV 300
            MVA EIS  I ++  LTEP+VAH +  ALT +SALF+GNSMAIRD DMY RN   CTH +
Sbjct: 633  MVAQEISSLIHSESFLTEPYVAHVILEALTCDSALFIGNSMAIRDADMYARNSADCTHRI 692

Query: 301  ADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLA 360
             D +L+   P  WIRV+GNRGASGIDGLLSTAIGFAVGCNK VLCV+GD+SFL+DTNGL+
Sbjct: 693  GDTVLSLGLPFHWIRVSGNRGASGIDGLLSTAIGFAVGCNKRVLCVIGDVSFLYDTNGLS 752

Query: 361  ILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLN 420
            IL QRM+RKP+ +LV+NNHGGAIFSLLPIA+RTE R+LDQYFYT+HN+SI  LCLAHG+ 
Sbjct: 753  ILSQRMRRKPMTILVLNNHGGAIFSLLPIAERTERRVLDQYFYTSHNVSIGKLCLAHGMK 812

Query: 421  HVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQF 480
            H++V+TK+EL++AL  SQ    D VIEVESCID+NA FHS LRKFA Q+ADH LN+LS+F
Sbjct: 813  HLEVRTKIELQDALFTSQQENRDCVIEVESCIDSNAAFHSTLRKFACQAADHALNMLSKF 872

Query: 481  SVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVG 540
            S+PD I     +CKI  MEYS+YRI LCAPPTS+ +++  + F R+GFIL L LE G VG
Sbjct: 873  SIPDFIFHGSFLCKIHGMEYSIYRIPLCAPPTSASVNYKTTTFYRDGFILILSLEGGHVG 932

Query: 541  YGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIF 600
            +GEVAPLEIH+E+LLD EEQLRFL H + GAKIS++LPLLKGSFSSWIWS LGIP   IF
Sbjct: 933  FGEVAPLEIHEEDLLDVEEQLRFLHHVIKGAKISFYLPLLKGSFSSWIWSCLGIPPSSIF 992

Query: 601  PSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVA 660
            PSVRCGLEMAILNAIA + GSS LNIL+P  +++EEIS+RS  ++ICAL+DSN SP+EVA
Sbjct: 993  PSVRCGLEMAILNAIAAQEGSSLLNILHPY-KVEEEISERSKRVQICALLDSNGSPLEVA 1051

Query: 661  SIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEF 720
             +A TLVEEGFTAIKLKVARRADPI+DA VIQE+RK VG +IELR DANRNWTY++A++F
Sbjct: 1052 YLAKTLVEEGFTAIKLKVARRADPIEDATVIQEIRKMVGLQIELRADANRNWTYEQAIQF 1111

Query: 721  GFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVA 780
               +K+CDL+YIEEPV++E+DIIK+CEE+GLPVALDET+DK  + PL  L K++H GIVA
Sbjct: 1112 SSYVKNCDLKYIEEPVKDEDDIIKFCEETGLPVALDETMDKIGETPLQKLAKFSHSGIVA 1171

Query: 781  IVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKV 840
            +VIKPSV+GGFENA LIARWAQ+ GKMAVVSAAFESGL LSAYI  SSY ELQ+A +CK+
Sbjct: 1172 VVIKPSVVGGFENAALIARWAQQQGKMAVVSAAFESGLSLSAYIQLSSYFELQSAEICKL 1231

Query: 841  MNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVI 900
            MN++L P VA GLGTY+WLKEDVT +P+SI  +   GF+EASV  A  ILQ  QIN D I
Sbjct: 1232 MNKQLVPSVAHGLGTYRWLKEDVTFEPLSINRSQDSGFIEASVVDADRILQKFQINRDTI 1291

Query: 901  CKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKA 960
             +   EEQV  +QL V+S  F   + V EIG    I++++++FLHGFLGTG +WI  MKA
Sbjct: 1292 IRIFSEEQVYTHQLAVDSDGFSCLLNVHEIGA--SIENDVVVFLHGFLGTGGDWIATMKA 1349

Query: 961  VSGSARCISIDLPGHGGSKMQNH 983
            +SGSARCISIDLPGHGGSK+QNH
Sbjct: 1350 ISGSARCISIDLPGHGGSKIQNH 1372

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546995|ref|XP_002514555.1| menaquinone biosynthesis protein, putative [Ricinus communis] gi|223546159|gb|EEF47661.1| menaquinone biosynthesis protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449478619|ref|XP_004155371.1| PREDICTED: protein PHYLLO, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435274|ref|XP_004135420.1| PREDICTED: protein PHYLLO, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297838661|ref|XP_002887212.1| 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333053|gb|EFH63471.1| 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|71738181|gb|AAZ40195.1| chloroplast Phyllo [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110742201|dbj|BAE99027.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145337303|ref|NP_177055.2| 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding protein [Arabidopsis thaliana] gi|341941250|sp|Q15KI9.2|PHYLO_ARATH RecName: Full=Protein PHYLLO, chloroplastic; Includes: RecName: Full=Inactive isochorismate synthase; AltName: Full=MENF; Includes: RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate synthase; AltName: Full=MEND; Includes: RecName: Full=o-succinylbenzoate synthase; AltName: Full=MENC; Includes: RecName: Full=2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase; AltName: Full=MENH; Flags: Precursor gi|332196734|gb|AEE34855.1| 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356555334|ref|XP_003545988.1| PREDICTED: protein PHYLLO, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|242062128|ref|XP_002452353.1| hypothetical protein SORBIDRAFT_04g024160 [Sorghum bicolor] gi|241932184|gb|EES05329.1| hypothetical protein SORBIDRAFT_04g024160 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query983
TAIR|locus:2205450 1715 PHYLLO "PHYLLO" [Arabidopsis t 0.990 0.567 0.605 0.0
TIGR_CMR|SO_4573573 SO_4573 "2-succinyl-6-hydroxy- 0.273 0.469 0.271 1.2e-26
TIGR_CMR|BA_5111584 BA_5111 "2-succinyl-6-hydroxy- 0.144 0.243 0.350 3e-24
UNIPROTKB|P17109556 menD "MenD" [Escherichia coli 0.200 0.354 0.326 5.8e-18
UNIPROTKB|Q9KQM3570 menD "2-succinyl-5-enolpyruvyl 0.275 0.475 0.286 2.9e-17
TIGR_CMR|VC_1975570 VC_1975 "2-succinyl-6-hydroxy- 0.275 0.475 0.286 2.9e-17
UNIPROTKB|Q9KQM6332 menC "o-succinylbenzoate synth 0.162 0.481 0.307 1.6e-16
TIGR_CMR|VC_1972332 VC_1972 "O-succinylbenzoate-Co 0.162 0.481 0.307 1.6e-16
UNIPROTKB|O06421554 menD "2-succinyl-5-enolpyruvyl 0.214 0.380 0.276 2.8e-13
TIGR_CMR|SO_4575374 SO_4575 "O-succinylbenzoate-Co 0.309 0.812 0.252 1.8e-11
TAIR|locus:2205450 PHYLLO "PHYLLO" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3085 (1091.0 bits), Expect = 0., P = 0.
 Identities = 595/983 (60%), Positives = 756/983 (76%)

Query:     1 MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYI 60
             M+LTT+DSA+HWAT S  GPVH+NCPFR+PLD SP +W S+CL GLD+W S+ EPFTKY 
Sbjct:   503 MVLTTVDSALHWATGSACGPVHLNCPFRDPLDGSPTNWSSNCLNGLDMWMSNAEPFTKYF 562

Query:    61 QVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
             QVQ SH     T  Q+ E+L++++   KGLLL+GA+H EDEIWA L LA+ + WPVVAD+
Sbjct:   563 QVQ-SHKSDGVTTGQITEILQVIKEAKKGLLLIGAIHTEDEIWASLLLAKELMWPVVADV 621

Query:   121 LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
             LSG+RLRKL   F+E   ++ F+DHLDHAL S+SV++ I+FDV+IQ+GSRITSKR+SQM+
Sbjct:   622 LSGVRLRKLFKPFVEKLTHV-FVDHLDHALFSDSVRNLIEFDVVIQVGSRITSKRVSQML 680

Query:   181 EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDM 240
             E+CFP  YILVD HPCRHDPSH VTHR+QS IVQF + +LK + P R SK    L+ALD 
Sbjct:   681 EKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFANCVLKSRFPWRRSKLHGHLQALDG 740

Query:   241 MVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTV 300
              +A E+SFQI A+ SLTEP+VAH LS+ALTS SALF+GNSM IRD+DMYG +    +H V
Sbjct:   741 AIAREMSFQISAESSLTEPYVAHMLSKALTSKSALFIGNSMPIRDVDMYGCSSENSSHVV 800

Query:   301 ADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLA 360
              D+ML++E P QWI+V GNRGASGIDGLLS+A GFAVGC K V+CVVGDISFLHDTNGLA
Sbjct:   801 -DMMLSAELPCQWIQVTGNRGASGIDGLLSSATGFAVGCKKRVVCVVGDISFLHDTNGLA 859

Query:   361 ILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLN 420
             ILKQR+ RKP+ +LVINN GG IF LLPIA +TEP +L+QYFYT H+ISI+NLCLAHG+ 
Sbjct:   860 ILKQRIARKPMTILVINNRGGGIFRLLPIAKKTEPSVLNQYFYTAHDISIENLCLAHGVR 919

Query:   421 HVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQF 480
             +V V TK ELE+AL +      D ++EVES I+ANA  HS L +FARQ+A+++L ++S  
Sbjct:   920 YVHVGTKSELEDALFVPSVEEMDCIVEVESSINANAIVHSTLERFARQAAENSLGIVSAS 979

Query:   481 SVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVG 540
             S    +  ++ +C++  ++YS YR++LC  PT        S+F REGFILSL LEDGS+G
Sbjct:   980 SFLHPMIKNVLLCQVSGIQYSQYRVKLCDRPT--ICSDEFSQFHREGFILSLTLEDGSIG 1037

Query:   541 YGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIF 600
             YGEVAPL  + ENL+D E QL+ +LH M  AK SY LPLL GS SSWIWS LGI A  IF
Sbjct:  1038 YGEVAPLNSNVENLMDVEGQLQLVLHLMNEAKFSYMLPLLNGSISSWIWSELGITASSIF 1097

Query:   601 PSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVA 660
             PSVRCGLEMA+LNA+AV+H SS L IL+   E  E  S +  S++ICAL+DS  +P+EVA
Sbjct:  1098 PSVRCGLEMALLNAMAVRHDSSLLGILHYQKE--ENGSAQPHSVQICALLDSEGTPLEVA 1155

Query:   661 SIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEF 720
              +A  LV+EGF+AIKLKV RR   ++DA V+QEVR+ VG +IELR DAN  WT++EA EF
Sbjct:  1156 YVARKLVQEGFSAIKLKVGRRVSSVQDALVMQEVRRAVGVQIELRADANCRWTFEEAREF 1215

Query:   721 GFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVA 780
             G L+  C+L+YIEEPVQN++D+I++ EE+GLPVALDET+D F++ PL ML KY HPGIVA
Sbjct:  1216 GLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEECPLRMLTKYTHPGIVA 1275

Query:   781 IVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKV 840
             +VIKPSV+GGFENA LIARWAQ+HGKMAV+SAA+ESGLGLSAYI+F+SYLE++N      
Sbjct:  1276 VVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILFASYLEMENVKASTE 1335

Query:   841 MNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVI 900
               +   P VA GLGTY+WL EDV  + + I  +   GFVE  +A A+  L++++INNDVI
Sbjct:  1336 QKQGTPPSVAHGLGTYRWLSEDVMMNTLGIFRSPYSGFVEGFIADASRNLKDVKINNDVI 1395

Query:   901 CKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKA 960
              +TS    V RY+L V+   F  FI+V ++G+  + + ++ LFLHGFLGTGEEWIPIM  
Sbjct:  1396 VRTSKGIPVRRYELRVDVDGFSHFIRVHDVGE--NAEGSVALFLHGFLGTGEEWIPIMTG 1453

Query:   961 VSGSARCISIDLPGHGGSKMQNH 983
             +SGSARCIS+D+PGHG S++Q+H
Sbjct:  1454 ISGSARCISVDIPGHGRSRVQSH 1476
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0009063 "cellular amino acid catabolic process" evidence=IEA
GO:0009234 "menaquinone biosynthetic process" evidence=IEA
GO:0016836 "hydro-lyase activity" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0070204 "2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase activity" evidence=IEA
GO:0042372 "phylloquinone biosynthetic process" evidence=IMP
GO:0042550 "photosystem I stabilization" evidence=IMP
TIGR_CMR|SO_4573 SO_4573 "2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5111 BA_5111 "2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P17109 menD "MenD" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQM3 menD "2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1975 VC_1975 "2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQM6 menC "o-succinylbenzoate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1972 VC_1972 "O-succinylbenzoate-CoA synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|O06421 menD "2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4575 SO_4575 "O-succinylbenzoate-CoA synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.2.1.90.737
3rd Layer2.2.1LOW CONFIDENCE prediction!
3rd Layer4.2.1.113LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query983
PLN02980 1655 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ 0.0
PRK07449568 PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hyd 2e-99
COG1165566 COG1165, MenD, 2-succinyl-6-hydroxy-2,4-cyclohexad 9e-84
TIGR00173430 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydrox 3e-69
cd02009175 cd02009, TPP_SHCHC_synthase, Thiamine pyrophosphat 2e-60
cd03320263 cd03320, OSBS, o-Succinylbenzoate synthase (OSBS) 7e-38
TIGR01927307 TIGR01927, menC_gamma/gm+, o-succinylbenzoate synt 5e-30
COG4948372 COG4948, COG4948, L-alanine-DL-glutamate epimerase 7e-27
cd03315265 cd03315, MLE_like, Muconate lactonizing enzyme (ML 7e-26
PRK05105322 PRK05105, PRK05105, O-succinylbenzoate synthase; P 5e-23
cd03319316 cd03319, L-Ala-DL-Glu_epimerase, L-Ala-D/L-Glu epi 5e-23
COG1441321 COG1441, MenC, O-succinylbenzoate synthase [Coenzy 2e-21
cd03316357 cd03316, MR_like, Mandelate racemase (MR)-like sub 7e-18
smart0092297 smart00922, MR_MLE, Mandelate racemase / muconate 1e-17
cd03317354 cd03317, NAAAR, N-acylamino acid racemase (NAAAR), 8e-17
PRK02901327 PRK02901, PRK02901, O-succinylbenzoate synthase; P 2e-16
PRK02714320 PRK02714, PRK02714, O-succinylbenzoate synthase; P 3e-16
cd00308229 cd00308, enolase_like, Enolase-superfamily, charac 9e-15
TIGR01928324 TIGR01928, menC_lowGC/arch, o-succinylbenzoate syn 6e-14
pfam0118869 pfam01188, MR_MLE, Mandelate racemase / muconate l 1e-13
cd03318365 cd03318, MLE, Muconate Lactonizing Enzyme (MLE), a 2e-12
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 5e-11
cd03329368 cd03329, MR_like_4, Mandelate racemase (MR)-like s 4e-10
cd03321355 cd03321, mandelate_racemase, Mandelate racemase (M 6e-10
TIGR03695 252 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cy 4e-09
PRK11126 242 PRK11126, PRK11126, 2-succinyl-6-hydroxy-2,4-cyclo 1e-08
cd03328352 cd03328, MR_like_3, Mandelate racemase (MR)-like s 3e-08
TIGR02534368 TIGR02534, mucon_cyclo, muconate and chloromuconat 1e-07
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 6e-07
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 2e-06
pfam12697 187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 2e-06
cd03324415 cd03324, rTSbeta_L-fuconate_dehydratase, Human rTS 6e-06
cd03323395 cd03323, D-glucarate_dehydratase, D-Glucarate dehy 1e-05
PRK14017382 PRK14017, PRK14017, galactonate dehydratase; Provi 7e-05
cd03327341 cd03327, MR_like_2, Mandelate racemase (MR)-like s 3e-04
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 4e-04
PRK14875 371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 4e-04
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 6e-04
TIGR03056 278 TIGR03056, bchO_mg_che_rel, putative magnesium che 0.001
cd07037162 cd07037, TPP_PYR_MenD, Pyrimidine (PYR) binding do 0.002
COG0596 282 COG0596, MhpC, Predicted hydrolases or acyltransfe 0.003
>gnl|CDD|215530 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information 
 Score = 1682 bits (4357), Expect = 0.0
 Identities = 700/983 (71%), Positives = 817/983 (83%), Gaps = 6/983 (0%)

Query: 1    MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYI 60
            M+LTTLDSAVHWATSSP GPVHINCPFREPLD SP +WMSSCLKGLD+W S+ EPFTKYI
Sbjct: 440  MVLTTLDSAVHWATSSPCGPVHINCPFREPLDGSPTNWMSSCLKGLDMWMSNAEPFTKYI 499

Query: 61   QVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
            Q+Q S A    T  Q+ EVLE++Q   +GLLL+GA+H ED+IWA L LA+H+ WPVVADI
Sbjct: 500  QMQSSKADGDTT-GQITEVLEVIQEAKRGLLLIGAIHTEDDIWAALLLAKHLMWPVVADI 558

Query: 121  LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
            LSGLRLRKL  SF E E NILF+DHLDHALLS+SV++WIQFDV+IQIGSRITSKR+SQM+
Sbjct: 559  LSGLRLRKLFKSFPEFELNILFVDHLDHALLSDSVRNWIQFDVVIQIGSRITSKRVSQML 618

Query: 181  EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDM 240
            E+CFP +YILVD HPCRHDPSH VTHR+QS IVQF D LLK Q P R SKW   L+ALD 
Sbjct: 619  EKCFPFSYILVDKHPCRHDPSHLVTHRVQSNIVQFADCLLKAQFPRRRSKWHGHLQALDG 678

Query: 241  MVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTV 300
            MVA EISFQI A+ SLTEP+VAH +S ALTS+SALF+GNSMAIRD DMYG +    +  +
Sbjct: 679  MVAQEISFQIHAESSLTEPYVAHVISEALTSDSALFIGNSMAIRDADMYGCSSENYSSRI 738

Query: 301  ADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLA 360
             D+ML++E P QWI+VAGNRGASGIDGLLSTAIGFAVGCNK VLCVVGDISFLHDTNGL+
Sbjct: 739  VDMMLSAELPCQWIQVAGNRGASGIDGLLSTAIGFAVGCNKRVLCVVGDISFLHDTNGLS 798

Query: 361  ILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLN 420
            IL QR+ RKP+ +LVINNHGGAIFSLLPIA RTEPR+L+QYFYT+H+ISI+NLCLAHG+ 
Sbjct: 799  ILSQRIARKPMTILVINNHGGAIFSLLPIAKRTEPRVLNQYFYTSHDISIENLCLAHGVR 858

Query: 421  HVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQF 480
            H+ V TK ELE+AL  SQ    D V+EVES IDANA FHS LRKFA Q+A+H L +LS+ 
Sbjct: 859  HLHVGTKSELEDALFTSQVEQMDCVVEVESSIDANAAFHSTLRKFACQAAEHALGILSES 918

Query: 481  SVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVG 540
            S   +I   + +CKI  MEYSLYRIQLCAPPTS+ +D +  +F REGFILSL LEDGSVG
Sbjct: 919  SCLHSIIDGVFLCKISGMEYSLYRIQLCAPPTSASVDFS--QFHREGFILSLSLEDGSVG 976

Query: 541  YGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIF 600
            +GEVAPLEIH+E+LLD EEQLRFLLH + GAKIS+ LPLLKGSFSSWIWS LGIP   IF
Sbjct: 977  FGEVAPLEIHEEDLLDVEEQLRFLLHVIKGAKISFMLPLLKGSFSSWIWSELGIPPSSIF 1036

Query: 601  PSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVA 660
            PSVRCGLEMAILNAIAV+HGSS LNIL P  + DE  S++S S++ICAL+DSN SP+EVA
Sbjct: 1037 PSVRCGLEMAILNAIAVRHGSSLLNILDPY-QKDENGSEQSHSVQICALLDSNGSPLEVA 1095

Query: 661  SIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEF 720
             +A  LVEEGF+AIKLKV RR  PI+DA VIQEVRK VG++IELR DANRNWTY+EA+EF
Sbjct: 1096 YVARKLVEEGFSAIKLKVGRRVSPIQDAAVIQEVRKAVGYQIELRADANRNWTYEEAIEF 1155

Query: 721  GFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVA 780
            G L+K C+L+YIEEPVQ+E+D+IK+CEE+GLPVALDETIDKF++ PL ML KY HPGIVA
Sbjct: 1156 GSLVKSCNLKYIEEPVQDEDDLIKFCEETGLPVALDETIDKFEECPLRMLTKYTHPGIVA 1215

Query: 781  IVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKV 840
            +VIKPSV+GGFENA LIARWAQ+HGKMAV+SAA+ESGLGLSAYI F+SYLE+QNA   + 
Sbjct: 1216 VVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYIQFASYLEMQNAKASRE 1275

Query: 841  MNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFVEASVAKATHILQNLQINNDVI 900
            MN+  CP VA GLGTY+WLKEDVT +P+ I  +   GF+EASVA A+  LQ  QINNDVI
Sbjct: 1276 MNKGTCPSVAHGLGTYRWLKEDVTMNPLGIFRSPYSGFIEASVADASRNLQKFQINNDVI 1335

Query: 901  CKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKA 960
             +T  EEQV  Y+L V+   F   IKV E+GQ  +   +++LFLHGFLGTGE+WIPIMKA
Sbjct: 1336 VRTFKEEQVRTYELRVDVDGFSCLIKVHEVGQNAE--GSVVLFLHGFLGTGEDWIPIMKA 1393

Query: 961  VSGSARCISIDLPGHGGSKMQNH 983
            +SGSARCISIDLPGHGGSK+QNH
Sbjct: 1394 ISGSARCISIDLPGHGGSKIQNH 1416

Length = 1655
>gnl|CDD|236020 PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate synthase; Validated Back     alignment and domain information
>gnl|CDD|224087 COG1165, MenD, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|232855 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylic-acid synthase Back     alignment and domain information
>gnl|CDD|238967 cd02009, TPP_SHCHC_synthase, Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>gnl|CDD|239436 cd03320, OSBS, o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>gnl|CDD|233641 TIGR01927, menC_gamma/gm+, o-succinylbenzoate synthase Back     alignment and domain information
>gnl|CDD|227284 COG4948, COG4948, L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>gnl|CDD|239431 cd03315, MLE_like, Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>gnl|CDD|235345 PRK05105, PRK05105, O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>gnl|CDD|239435 cd03319, L-Ala-DL-Glu_epimerase, L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>gnl|CDD|224358 COG1441, MenC, O-succinylbenzoate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|239432 cd03316, MR_like, Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>gnl|CDD|214914 smart00922, MR_MLE, Mandelate racemase / muconate lactonizing enzyme, C-terminal domain Back     alignment and domain information
>gnl|CDD|239433 cd03317, NAAAR, N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>gnl|CDD|235084 PRK02901, PRK02901, O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>gnl|CDD|235061 PRK02714, PRK02714, O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>gnl|CDD|238188 cd00308, enolase_like, Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>gnl|CDD|213667 TIGR01928, menC_lowGC/arch, o-succinylbenzoate synthase Back     alignment and domain information
>gnl|CDD|201648 pfam01188, MR_MLE, Mandelate racemase / muconate lactonizing enzyme, C-terminal domain Back     alignment and domain information
>gnl|CDD|239434 cd03318, MLE, Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|239445 cd03329, MR_like_4, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>gnl|CDD|239437 cd03321, mandelate_racemase, Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>gnl|CDD|234315 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|236855 PRK11126, PRK11126, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>gnl|CDD|239444 cd03328, MR_like_3, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>gnl|CDD|162905 TIGR02534, mucon_cyclo, muconate and chloromuconate cycloisomerases Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|239440 cd03324, rTSbeta_L-fuconate_dehydratase, Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>gnl|CDD|239439 cd03323, D-glucarate_dehydratase, D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>gnl|CDD|184455 PRK14017, PRK14017, galactonate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|239443 cd03327, MR_like_2, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|132100 TIGR03056, bchO_mg_che_rel, putative magnesium chelatase accessory protein Back     alignment and domain information
>gnl|CDD|132920 cd07037, TPP_PYR_MenD, Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1- carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 983
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK06154565 hypothetical protein; Provisional 100.0
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 100.0
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 100.0
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 100.0
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK11269591 glyoxylate carboligase; Provisional 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PLN02470585 acetolactate synthase 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
PRK08611576 pyruvate oxidase; Provisional 100.0
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08273597 thiamine pyrophosphate protein; Provisional 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
CHL00099585 ilvB acetohydroxyacid synthase large subunit 100.0
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 100.0
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PRK05858542 hypothetical protein; Provisional 100.0
PRK09124574 pyruvate dehydrogenase; Provisional 100.0
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 100.0
PRK06546578 pyruvate dehydrogenase; Provisional 100.0
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 100.0
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 100.0
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octame 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK14017382 galactonate dehydratase; Provisional 100.0
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 100.0
PLN02573578 pyruvate decarboxylase 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
PRK06457549 pyruvate dehydrogenase; Provisional 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PRK07524535 hypothetical protein; Provisional 100.0
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 100.0
PRK07064544 hypothetical protein; Provisional 100.0
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 100.0
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
KOG4166675 consensus Thiamine pyrophosphate-requiring enzyme 100.0
cd03322361 rpsA The starvation sensing protein RpsA from E.co 100.0
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 100.0
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 100.0
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 100.0
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 100.0
PRK08266542 hypothetical protein; Provisional 100.0
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK15129321 L-Ala-D/L-Glu epimerase; Provisional 100.0
PRK15440394 L-rhamnonate dehydratase; Provisional 100.0
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 100.0
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 100.0
PRK12474518 hypothetical protein; Provisional 100.0
PRK07586514 hypothetical protein; Validated 100.0
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 100.0
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 100.0
PRK02714320 O-succinylbenzoate synthase; Provisional 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
PRK05105322 O-succinylbenzoate synthase; Provisional 100.0
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 100.0
COG3962617 Acetolactate synthase [Amino acid transport and me 100.0
TIGR01502408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 100.0
cd03314369 MAL Methylaspartate ammonia lyase (3-methylasparta 100.0
COG3960592 Glyoxylate carboligase [General function predictio 100.0
cd00308229 enolase_like Enolase-superfamily, characterized by 100.0
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK02901327 O-succinylbenzoate synthase; Provisional 100.0
PRK00077425 eno enolase; Provisional 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
TIGR01060425 eno phosphopyruvate hydratase. Alternate name: eno 100.0
cd03313408 enolase Enolase: Enolases are homodimeric enzymes 100.0
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 100.0
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.98
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.97
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.97
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.97
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.97
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.97
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.96
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.96
PLN00191457 enolase 99.96
PRK06163202 hypothetical protein; Provisional 99.96
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.95
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.95
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.94
COG1441321 MenC O-succinylbenzoate synthase [Coenzyme metabol 99.94
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.94
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.94
PTZ00081439 enolase; Provisional 99.93
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.93
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.92
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.92
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.92
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.92
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.91
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.9
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.88
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.88
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.87
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.86
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.85
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.84
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.84
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.83
PF02746117 MR_MLE_N: Mandelate racemase / muconate lactonizin 99.75
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 99.68
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 99.65
COG0148423 Eno Enolase [Carbohydrate transport and metabolism 99.65
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 99.63
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.6
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 99.6
PRK08350341 hypothetical protein; Provisional 99.6
PF0118867 MR_MLE: Mandelate racemase / muconate lactonizing 99.59
PF13378111 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FC 99.57
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 99.49
PRK05899624 transketolase; Reviewed 99.44
PTZ00378518 hypothetical protein; Provisional 99.26
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.24
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 99.24
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.15
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.15
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 99.12
KOG2670433 consensus Enolase [Carbohydrate transport and meta 99.1
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 99.08
COG3799410 Mal Methylaspartate ammonia-lyase [Amino acid tran 98.92
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 98.79
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 98.77
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 98.75
PF07476248 MAAL_C: Methylaspartate ammonia-lyase C-terminus; 98.74
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.74
PRK00870 302 haloalkane dehalogenase; Provisional 98.69
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 98.69
PLN02824 294 hydrolase, alpha/beta fold family protein 98.66
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.65
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 98.65
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 98.64
PRK03592 295 haloalkane dehalogenase; Provisional 98.6
PLN02679 360 hydrolase, alpha/beta fold family protein 98.56
PLN02790654 transketolase 98.55
PRK03204 286 haloalkane dehalogenase; Provisional 98.54
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.54
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 98.54
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.43
PTZ00089661 transketolase; Provisional 98.41
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 98.39
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 98.37
PF00113295 Enolase_C: Enolase, C-terminal TIM barrel domain; 98.35
PRK12753663 transketolase; Reviewed 98.34
PRK12754663 transketolase; Reviewed 98.33
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.33
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 98.33
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 98.32
PLN02578 354 hydrolase 98.32
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 98.27
PRK10673 255 acyl-CoA esterase; Provisional 98.27
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 98.26
KOG0225394 consensus Pyruvate dehydrogenase E1, alpha subunit 98.24
PRK06489 360 hypothetical protein; Provisional 98.2
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 98.19
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 98.18
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 98.16
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.12
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 98.11
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.11
PRK05855 582 short chain dehydrogenase; Validated 98.1
PHA02857 276 monoglyceride lipase; Provisional 98.08
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 98.06
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 98.01
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 97.99
PLN02225701 1-deoxy-D-xylulose-5-phosphate synthase 97.97
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 97.93
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 97.92
PLN02211 273 methyl indole-3-acetate methyltransferase 97.89
PLN02894 402 hydrolase, alpha/beta fold family protein 97.87
COG0021663 TktA Transketolase [Carbohydrate transport and met 97.87
PLN02385 349 hydrolase; alpha/beta fold family protein 97.87
KOG2564 343 consensus Predicted acetyltransferases and hydrola 97.86
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 97.86
COG1154627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 97.82
PLN02582677 1-deoxy-D-xylulose-5-phosphate synthase 97.81
PRK10749 330 lysophospholipase L2; Provisional 97.8
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.78
TIGR00239929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 97.78
KOG1454 326 consensus Predicted hydrolase/acyltransferase (alp 97.74
PRK09404924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 97.7
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.69
PLN02298 330 hydrolase, alpha/beta fold family protein 97.62
PRK07581 339 hypothetical protein; Validated 97.6
PRK08775 343 homoserine O-acetyltransferase; Provisional 97.59
PLN02652 395 hydrolase; alpha/beta fold family protein 97.58
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 97.53
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.5
PRK091931165 indolepyruvate ferredoxin oxidoreductase; Validate 97.49
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.48
TIGR03186889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 97.46
PF03952132 Enolase_N: Enolase, N-terminal domain; InterPro: I 97.44
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.42
PRK05261785 putative phosphoketolase; Provisional 97.4
KOG0523632 consensus Transketolase [Carbohydrate transport an 97.39
PRK130301159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.38
KOG2565 469 consensus Predicted hydrolases or acyltransferases 97.28
KOG1182432 consensus Branched chain alpha-keto acid dehydroge 97.28
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 97.25
PRK13012896 2-oxoacid dehydrogenase subunit E1; Provisional 97.15
TIGR00759885 aceE pyruvate dehydrogenase E1 component, homodime 97.15
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.11
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 97.1
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.04
PLN02511 388 hydrolase 96.95
PRK130291186 2-oxoacid ferredoxin oxidoreductase; Provisional 96.94
PRK10566 249 esterase; Provisional 96.89
COG1647 243 Esterase/lipase [General function prediction only] 96.87
PRK09405891 aceE pyruvate dehydrogenase subunit E1; Reviewed 96.83
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 96.67
PF05034159 MAAL_N: Methylaspartate ammonia-lyase N-terminus; 96.58
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 96.56
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 96.47
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 96.42
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.33
PRK10985 324 putative hydrolase; Provisional 96.13
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 96.06
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 96.03
PRK05077 414 frsA fermentation/respiration switch protein; Revi 95.97
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 95.89
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 95.86
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 95.85
PRK13604 307 luxD acyl transferase; Provisional 95.7
PLN00021 313 chlorophyllase 95.64
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 95.64
KOG2984 277 consensus Predicted hydrolase [General function pr 95.54
PLN02872 395 triacylglycerol lipase 95.53
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.16
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 95.11
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 95.08
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 94.93
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 94.68
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 94.63
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 94.62
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 94.59
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 94.43
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 94.35
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 94.26
PRK10605362 N-ethylmaleimide reductase; Provisional 94.22
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 93.94
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 93.87
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 93.73
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 93.7
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 93.59
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 93.55
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 93.3
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 93.28
PRK13523337 NADPH dehydrogenase NamA; Provisional 93.17
PRK13761248 hypothetical protein; Provisional 93.13
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 93.1
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 93.09
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 93.07
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 93.02
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 92.87
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 92.69
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 92.33
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 91.91
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 91.91
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.85
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 91.78
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 91.66
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 91.56
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 91.44
PRK07868 994 acyl-CoA synthetase; Validated 91.28
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 91.25
COG1701256 Uncharacterized protein conserved in archaea [Func 91.12
PRK11460 232 putative hydrolase; Provisional 91.01
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 90.93
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 90.76
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 90.64
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 90.41
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 90.33
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 90.06
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 90.02
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 89.97
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 89.96
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 89.6
PRK08611576 pyruvate oxidase; Provisional 89.53
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 89.49
PF09364379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 89.4
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.35
PRK00481242 NAD-dependent deacetylase; Provisional 89.32
PRK14138244 NAD-dependent deacetylase; Provisional 89.21
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.97
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 88.6
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 88.55
PRK08322547 acetolactate synthase; Reviewed 88.52
PRK07586514 hypothetical protein; Validated 88.5
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 88.48
PRK08617552 acetolactate synthase; Reviewed 88.23
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 88.12
PRK07709285 fructose-bisphosphate aldolase; Provisional 88.0
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 87.98
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 87.94
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 87.92
PRK03363313 fixB putative electron transfer flavoprotein FixB; 87.91
PRK10162 318 acetyl esterase; Provisional 87.66
PRK06457549 pyruvate dehydrogenase; Provisional 87.56
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 87.35
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 87.28
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 87.22
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 87.09
PLN02442 283 S-formylglutathione hydrolase 87.0
PRK07524535 hypothetical protein; Provisional 86.94
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 86.77
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 86.74
PRK05858542 hypothetical protein; Provisional 86.7
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 86.57
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 86.41
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 86.39
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 86.29
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 86.25
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 86.22
PRK08155564 acetolactate synthase catalytic subunit; Validated 86.14
PRK05333285 NAD-dependent deacetylase; Provisional 86.09
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 86.06
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 86.03
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 86.02
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 85.76
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 85.7
PRK06112578 acetolactate synthase catalytic subunit; Validated 85.59
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 85.52
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 85.38
PRK08199557 thiamine pyrophosphate protein; Validated 85.32
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 85.3
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 85.17
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 85.17
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 84.87
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 84.83
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 84.82
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 84.74
PTZ00408242 NAD-dependent deacetylase; Provisional 84.1
PRK11269591 glyoxylate carboligase; Provisional 83.75
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 83.58
PLN02470585 acetolactate synthase 83.57
PRK06765 389 homoserine O-acetyltransferase; Provisional 83.53
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 83.47
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 83.41
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 83.41
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 83.21
PRK05835307 fructose-bisphosphate aldolase; Provisional 83.16
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 83.15
PRK14024241 phosphoribosyl isomerase A; Provisional 82.91
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 82.82
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 82.58
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 82.51
KOG1552 258 consensus Predicted alpha/beta hydrolase [General 82.36
PRK08266542 hypothetical protein; Provisional 82.33
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 82.31
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 82.19
CHL00099585 ilvB acetohydroxyacid synthase large subunit 82.05
KOG1838 409 consensus Alpha/beta hydrolase [General function p 81.57
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 81.38
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 81.37
PRK12474518 hypothetical protein; Provisional 81.3
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 81.19
cd02768386 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The Nuo 81.17
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 81.16
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 81.08
PRK08327569 acetolactate synthase catalytic subunit; Validated 80.95
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 80.94
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 80.78
PRK06546578 pyruvate dehydrogenase; Provisional 80.77
PRK122701228 kgd alpha-ketoglutarate decarboxylase; Reviewed 80.76
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 80.6
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 80.55
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 80.48
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 80.37
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 80.34
PRK07092530 benzoylformate decarboxylase; Reviewed 80.28
PRK09124574 pyruvate dehydrogenase; Provisional 80.04
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 80.03
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information 
Probab=100.00  E-value=4e-127  Score=1243.73  Aligned_cols=972  Identities=71%  Similarity=1.145  Sum_probs=778.8

Q ss_pred             HHHHHHHHHHHccCCCCCcEEEcCCCCCCCCCCCCcccccccccccccccCCCCccccccccccccccccchhhHHHHHH
Q 041113            2 ILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYCQMAEVLE   81 (983)
Q Consensus         2 i~~~i~~A~~~a~~~~~GPV~l~iP~d~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~   81 (983)
                      +++++++|++.|+++|||||||+||+|+|+++...+.+..+.+.++.|.....+........ ..+.+.++++.++++++
T Consensus       441 l~~~v~~A~~~A~s~rpGPVhL~iP~~~pld~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~i~~a~~  519 (1655)
T PLN02980        441 VLTTLDSAVHWATSSPCGPVHINCPFREPLDGSPTNWMSSCLKGLDMWMSNAEPFTKYIQMQ-SSKADGDTTGQITEVLE  519 (1655)
T ss_pred             HHHHHHHHHHHHhCCCCCCEEEECccCCccccccccccccccccchhcccCCCccccccccc-cccccccchhhHHHHHH
Confidence            46899999999999999999999999887765422111011111222211111111110000 00112345678999999


Q ss_pred             HHhcCCceEEEEccCCChhHHHHHHHHHHhcCCcEEeccccCccchhhhhhhhh--hccccccccchhhhccCccccccC
Q 041113           82 LVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLE--TEQNILFLDHLDHALLSESVKDWI  159 (983)
Q Consensus        82 ~L~~AkrPvIl~G~g~~~~~~~~l~~lae~l~~Pv~~t~~sg~~~~~~kg~~~~--~hp~~~~~g~~g~~~~~~~~~~~~  159 (983)
                      +|.+||||+||+|+|+......++.+|||++|+||++|+++|+|.+..||+||+  +||++  +|++|..........+.
T Consensus       520 ~L~~AkRPvIvaG~G~~~~~a~~~~~LAe~l~~PV~tt~~sg~~~~~~~g~ipe~~~~pl~--~g~~g~~~~~~~~~~~~  597 (1655)
T PLN02980        520 VIQEAKRGLLLIGAIHTEDDIWAALLLAKHLMWPVVADILSGLRLRKLFKSFPEFELNILF--VDHLDHALLSDSVRNWI  597 (1655)
T ss_pred             HHHhCCCcEEEEcCCCchHHHHHHHHHHHhCCCeEEEeCCCCCCCCccccccccccccccc--cchHHHHhCchhhhccC
Confidence            999999999999999865444466999999999999999877544434599999  88885  78887644344455678


Q ss_pred             CCCEEEEeCCccccHHHHHHHHhcCCceEEEEcCCCCCCCCCCCeeEEEEcCHHHHHHHHHhccCCCCChhHHHHHHHHH
Q 041113          160 QFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALD  239 (983)
Q Consensus       160 ~aDlvl~iG~~~~~~~~~~~~~~~~~~~~i~id~d~~~~~~~~~~~~~i~~d~~~~l~~L~~~~~~~~~~~w~~~~~~~~  239 (983)
                      ++|+||+||+++++..++++...+.+.++||||+|+.++++++..++.|++|++.++++|.+.........|.+.+...+
T Consensus       598 ~aDlVl~iG~rl~s~~~t~~~~~~~~~~~I~ID~d~~~i~~~~~~~~~i~~D~~~~l~~L~~~~~~~~~~~w~~~~~~~~  677 (1655)
T PLN02980        598 QFDVVIQIGSRITSKRVSQMLEKCFPFSYILVDKHPCRHDPSHLVTHRVQSNIVQFADCLLKAQFPRRRSKWHGHLQALD  677 (1655)
T ss_pred             CCCEEEEeCCccccHHHHHHHHhCCCCeEEEECCCCCccCCcccceEEEEeCHHHHHHHhhhccCcchhHHHHHHHHHHH
Confidence            99999999999976666555544444569999999999999999999999999999999976433222346776665554


Q ss_pred             HHHHHHHHhhhcccCCCCHHHHHHHHHhhcCCCceEEEecCcchhhhhhhcCCCcccccccccccccCCCCCcceeEeec
Q 041113          240 MMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHTVADIMLNSEFPHQWIRVAGN  319 (983)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~iv~~d~g~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~  319 (983)
                      ...............++++.++++.|++.+|++++|++|+|+++|++++|...++++...+++++.+...|+.++.++++
T Consensus       678 ~~~~~~~~~~~~~~~~l~~~~v~~~L~~~Lp~d~ivv~d~g~~ird~~~~~~~~~~~~~~~~~~~~~~~~p~~~i~~~~~  757 (1655)
T PLN02980        678 GMVAQEISFQIHAESSLTEPYVAHVISEALTSDSALFIGNSMAIRDADMYGCSSENYSSRIVDMMLSAELPCQWIQVAGN  757 (1655)
T ss_pred             HHHHHHHHhhhhcCCCcchHHHHHHHHHhCCCCCeEEEECcHHHHHHHHcCCccccccccccccccccccccccceEEec
Confidence            43322221111112358899999999999999999999999999999999866554211344444333345556656799


Q ss_pred             CCCCCccchHHHHHhhhhccCceEEEEEccchhhhccchHHHHHhhccCCCEEEEEEeCCCCccccCCCCCCCCCccccc
Q 041113          320 RGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILD  399 (983)
Q Consensus       320 ~G~mG~~g~lpaaiGaalA~~~~vv~i~GDGsf~~~~~eL~Ta~~~~~~lpv~iiV~NN~g~g~~~~~~~~~~~~~~~~~  399 (983)
                      +|+|||||++|+|||+++|.+++||||+|||||+|++|||+|++++.|++|++|||+||++|+|+++++.........++
T Consensus       758 ~G~mG~~G~lpaAIGaala~~r~Vv~i~GDGsF~m~~~EL~Ta~r~~~~lpi~iVV~NN~gggi~~~l~~~~~~~~~~~~  837 (1655)
T PLN02980        758 RGASGIDGLLSTAIGFAVGCNKRVLCVVGDISFLHDTNGLSILSQRIARKPMTILVINNHGGAIFSLLPIAKRTEPRVLN  837 (1655)
T ss_pred             CCccchhhhHHHHHHHhhcCCCCEEEEEehHHHHhhhhHHHHhhcccCCCCEEEEEEeCCCcHhhhcCccCCCCcchhHH
Confidence            99999999999999999998899999999999999999999999822499999999999999999886543211112244


Q ss_pred             cccccCCCCCHHHHHHHcCCceeeeCCHHHHHHHHHhhhccCCCEEEEEEcCcccchHHHHHHHHHHHHHHHHHHhhhhc
Q 041113          400 QYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQ  479 (983)
Q Consensus       400 ~~~~~~~~~df~~la~a~G~~~~~v~~~~eL~~aL~~a~~~~~p~lIeV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  479 (983)
                      +++.+.+++||.++|++||+++.+|++++||+++|+++++.++|+||||.++++++.+.++.+.+++.+.+..||.++..
T Consensus       838 ~~~~~~~~~df~~lA~a~G~~~~rV~~~~eL~~aL~~a~~~~~p~lIEV~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  917 (1655)
T PLN02980        838 QYFYTSHDISIENLCLAHGVRHLHVGTKSELEDALFTSQVEQMDCVVEVESSIDANAAFHSTLRKFACQAAEHALGILSE  917 (1655)
T ss_pred             HHhcCCCCCCHHHHHHHcCCceeecCCHHHHHHHHHHhhccCCCEEEEEecChhhhHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            55666778999999999999999999999999999999989999999999999999999999999999999999999999


Q ss_pred             CCCCCcccCCccceeEeEEEEEEEEeeCCCCCccccccccCcceeeeEEEEEEEECCCCEEEEeecCcCcCcccHHHHHH
Q 041113          480 FSVPDTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDAEE  559 (983)
Q Consensus       480 ~~~~~~~~~~~~~mkI~~v~~~~~~~pl~~p~~~~~~~~~~~~~~~~~~lv~v~t~~G~~G~GE~~~~~~~~~~~~~~~~  559 (983)
                      ++.++...+....|||++|+++.+++||+.|+.++.+++  +.+.++.++|+|++++|.+||||++|.+++.|++.++.+
T Consensus       918 ~~~~~~~~~~~~~~~I~~i~~~~~~lpl~~p~~~a~g~~--~~~~r~~~lV~l~~ddG~~G~GEa~pl~~~~et~~~~~~  995 (1655)
T PLN02980        918 SSCLHSIIDGVFLCKISGMEYSLYRIQLCAPPTSASVDF--SQFHREGFILSLSLEDGSVGFGEVAPLEIHEEDLLDVEE  995 (1655)
T ss_pred             CCcccccccccccceEeEEEEEEEEeeccCCcEeecccc--ccceeeEEEEEEEECCCCEEEEecCCCCCCccccccHHH
Confidence            999988888744599999999999999999999988653  124589999999999999999999998777777776666


Q ss_pred             HHHHHHhHhccCcccccccccccCchhhhhhhcCCCCCcchhhHHHHHHHHHHHHHHHHcCCChhhhcCCCCcccccccc
Q 041113          560 QLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISK  639 (983)
Q Consensus       560 ~l~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~aid~AlwDl~gk~~g~pv~~lLGg~~~~~~~~~~  639 (983)
                      ++..+...+.+.....+.+++.+.+.++.+..+.......++++++|||||||||+||..|+|||+||||.+. ......
T Consensus       996 ~l~~~~~~l~~~~~~~l~p~l~G~~~~~~~~~l~~~~~~~~psa~~ald~ALwDl~gk~~g~Pl~~LLGg~~~-~~~~~~ 1074 (1655)
T PLN02980        996 QLRFLLHVIKGAKISFMLPLLKGSFSSWIWSELGIPPSSIFPSVRCGLEMAILNAIAVRHGSSLLNILDPYQK-DENGSE 1074 (1655)
T ss_pred             HHHHHHHHHhhhhhhhhhHhhcCcchHHHHHHhhccccccchHHHHHHHHHHHHHHHHHcCCcHHHHhCCCCC-Ccceec
Confidence            6666655554433333455555554444444332222245789999999999999999999999999988431 001111


Q ss_pred             ccceeEEEEeecCCCCHHHHHHHHHHhhhcCCCEEEEeccCCCChHHHHHHHHHHHHHcCCCcEEEEEcCCCCCHHHHHH
Q 041113          640 RSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALE  719 (983)
Q Consensus       640 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~KiKig~~~~~~~d~~~v~~vr~~~g~~~~l~vDaN~~~~~~~a~~  719 (983)
                      .+.+|++|+.+....+++++++++++++++||++||+|+|...++++|+++|++||+++|+++.||+|||++||+++|++
T Consensus      1075 ~~~~v~v~~~~~~~~~~~~~~~~a~~~~~~Gf~~~KlKvG~~~~~~~D~~~i~alRe~~G~~~~LrlDAN~~ws~~~A~~ 1154 (1655)
T PLN02980       1075 QSHSVQICALLDSNGSPLEVAYVARKLVEEGFSAIKLKVGRRVSPIQDAAVIQEVRKAVGYQIELRADANRNWTYEEAIE 1154 (1655)
T ss_pred             cccceeeeeccCCCCCHHHHHHHHHHHHHcCCCEEEEecCCCCCHHHHHHHHHHHHHHcCCCCeEEEECCCCCCHHHHHH
Confidence            23568888876555689999999999999999999999986335789999999999999999999999999999999999


Q ss_pred             HHhhcccCCCceeecCCCChHHHHHHHhhcCCcEEeCCCccCcCCChHHHHHhhcCCCceEEEEcCCCcCCHHHHHHHHH
Q 041113          720 FGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLIAR  799 (983)
Q Consensus       720 ~~~~l~~~~i~~iEeP~~~~~~~~~l~~~~~ipIa~dEs~~~~~~~~~~~~~~~~~~~~~~i~~k~~~~GGl~~~~~~~~  799 (983)
                      +++.|++++++|||||+++.+++++|++++++|||+||++.+..+.+...+..+++.+++++++|++++||+++++++++
T Consensus      1155 ~~~~L~~~~i~~iEqPl~~~~~l~~l~~~~~iPIA~DEs~~~~~~~~~~~~~~~i~~~~~~i~iK~~~~GGit~~~~ia~ 1234 (1655)
T PLN02980       1155 FGSLVKSCNLKYIEEPVQDEDDLIKFCEETGLPVALDETIDKFEECPLRMLTKYTHPGIVAVVIKPSVVGGFENAALIAR 1234 (1655)
T ss_pred             HHHHHhhcCCCEEECCCCCHHHHHHHHHhCCCCEEeCCCcCCcccchHHHHHHHHHCCCeEEEeChhhhCCHHHHHHHHH
Confidence            99999999999999999988999999999999999999999876423345666776778889999999999999999999


Q ss_pred             HHHHcCCcEEeCCCCchHHHHHHHHHHHhhchhhhhhhhhhccccCCCCCccCccchhcccccCCCCCceeeccCCCCee
Q 041113          800 WAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICHNSCRGFV  879 (983)
Q Consensus       800 ~A~~~gi~~~~~~~~es~ig~~a~~~laa~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~d~~~~p~~~~~~P~~pGl  879 (983)
                      +|+++|++++++|++||+||+++++|+|+.++..+...++.......++.++|++|+.||.+|+...|+.++.-|.++|.
T Consensus      1235 ~A~~~gi~~~~~s~~es~Ig~aA~~hlaa~~~~~~~~~~~~~~~~~~~~~a~Gl~t~~~~~~d~~~~pl~~~~~~~~~~~ 1314 (1655)
T PLN02980       1235 WAQQHGKMAVISAAYESGLGLSAYIQFASYLEMQNAKASREMNKGTCPSVAHGLGTYRWLKEDVTMNPLGIFRSPYSGFI 1314 (1655)
T ss_pred             HHHHcCCeEEecCcccCHHHHHHHHHHHHhchhhcccccccccccCCCCcCCCCchHhHhhccCccCCccccccCCCCce
Confidence            99999999999999999999999999999986443222222223345778999999999999998899999999999999


Q ss_pred             eEEecchhhhhhhcccccccccccccccceeEEEEEEcccCceeEEEEeecCCccCCCCceEEEeCCCCCChhhHHHHHH
Q 041113          880 EASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMK  959 (983)
Q Consensus       880 Gv~~d~a~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~lv~lHG~~~~~~~w~~~~~  959 (983)
                      ++.+.++..++++++++.+.+.+++..++++...+.++..+.+|.+++...|...  ++++|||+|||++++..|.++++
T Consensus      1315 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~v~~~~~~~~i~~~~~G~~~--~~~~vVllHG~~~s~~~w~~~~~ 1392 (1655)
T PLN02980       1315 EASVADASRNLQKFQINNDVIVRTFKEEQVRTYELRVDVDGFSCLIKVHEVGQNA--EGSVVLFLHGFLGTGEDWIPIMK 1392 (1655)
T ss_pred             eeechhhHHHHHHhccCHHHHHHHhccCCCceEEEEEccCceEEEEEEEecCCCC--CCCeEEEECCCCCCHHHHHHHHH
Confidence            9999999999999999999999999999999999989888888988888777521  26899999999999999999999


Q ss_pred             HhhCCCEEEEEcCCCCCCCCCC
Q 041113          960 AVSGSARCISIDLPGHGGSKMQ  981 (983)
Q Consensus       960 ~l~~~~~vi~~Dl~G~G~S~~~  981 (983)
                      .|+++|+||++|+||||.|+.+
T Consensus      1393 ~L~~~~rVi~~Dl~G~G~S~~~ 1414 (1655)
T PLN02980       1393 AISGSARCISIDLPGHGGSKIQ 1414 (1655)
T ss_pred             HHhCCCEEEEEcCCCCCCCCCc
Confidence            9999999999999999999753

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK15129 L-Ala-D/L-Glu epimerase; Provisional Back     alignment and domain information
>PRK15440 L-rhamnonate dehydratase; Provisional Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK00077 eno enolase; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>TIGR01060 eno phosphopyruvate hydratase Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>PLN00191 enolase Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>COG1441 MenC O-succinylbenzoate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PTZ00081 enolase; Provisional Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PF02746 MR_MLE_N: Mandelate racemase / muconate lactonizing enzyme, N-terminal domain; InterPro: IPR013341 Mandelate racemase 5 Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>COG0148 Eno Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PRK08350 hypothetical protein; Provisional Back     alignment and domain information
>PF01188 MR_MLE: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain; InterPro: IPR013342 Mandelate racemase 5 Back     alignment and domain information
>PF13378 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FCP_B 3P0W_D 3VFC_A 3VDG_A 3FJ4_B 3CT2_B 3DGB_A 3V3W_A 3V4B_A 3NO1_E Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PTZ00378 hypothetical protein; Provisional Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>KOG2670 consensus Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>COG3799 Mal Methylaspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PF07476 MAAL_C: Methylaspartate ammonia-lyase C-terminus; InterPro: IPR022662 Methylaspartate ammonia-lyase 4 Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PF00113 Enolase_C: Enolase, C-terminal TIM barrel domain; InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ] Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PF03952 Enolase_N: Enolase, N-terminal domain; InterPro: IPR020811 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PF05034 MAAL_N: Methylaspartate ammonia-lyase N-terminus; InterPro: IPR022665 Methylaspartate ammonia-lyase 4 Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK13761 hypothetical protein; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>COG1701 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query983
3lq1_A578 Crystal Structure Of 2-Succinyl-6-Hydroxy-2,4-Cyclo 2e-41
2jla_A558 Crystal Structure Of E.Coli Mend, 2-Succinyl-5-Enol 1e-38
3flm_A556 Crystal Structure Of Mend From E.Coli Length = 556 2e-38
2jlc_A577 Crystal Structure Of E.Coli Mend, 2-Succinyl-5-Enol 2e-38
2x7j_A604 Structure Of The Menaquinone Biosynthesis Protein M 1e-36
1jpm_A366 L-ala-d/l-glu Epimerase Length = 366 1e-14
2pge_A377 Crystal Structure Of Menc From Desulfotalea Psychro 8e-14
2opj_A327 Crystal Structure Of O-Succinylbenzoate Synthase Le 9e-11
1sja_A368 X-Ray Structure Of O-Succinylbenzoate Synthase Comp 1e-10
4a6g_A368 N-Acyl Amino Acid Racemase From Amycalotopsis Sp. T 2e-10
1r6w_A322 Crystal Structure Of The K133r Mutant Of O-Succinyl 3e-10
1fhv_A323 Crystal Structure Analysis Of O-Succinylbenzoate Sy 3e-10
1fhu_A320 Crystal Structure Analysis Of O-Succinylbenzoate Sy 3e-10
3gc2_A323 1.85 Angstrom Crystal Structure Of O-Succinylbenzoa 3e-10
3dfy_A345 Crystal Structure Of Apo Dipeptide Epimerase From T 5e-10
2ofj_A323 Crystal Structure Of The E190a Mutant Of O-succinyl 1e-09
3q45_A368 Crystal Structure Of Dipeptide Epimerase From Cytop 2e-09
2zad_A345 Crystal Structure Of Muconate Cycloisomerase From T 2e-09
3dg3_A367 Crystal Structure Of Muconate Lactonizing Enzyme Fr 5e-08
2qde_A397 Crystal Structure Of Mandelate RacemaseMUCONATE LAC 1e-07
3cyj_A372 Crystal Structure Of A Mandelate RacemaseMUCONATE L 1e-07
3ozm_A389 Crystal Structure Of Enolase Superfamily Member Fro 2e-07
3h12_A397 Crystal Structure Of Putative Mandelate Racemase Fr 2e-07
3qld_A388 Structure Of Probable Mandelate Racemase (Aalaa1dra 2e-07
3ugv_A390 Crystal Structure Of An Enolase From Alpha Pretobac 4e-07
3op2_A397 Crystal Structure Of Putative Mandelate Racemase Fr 6e-07
3tj4_A372 Crystal Structure Of An Enolase From Agrobacterium 7e-07
2pp0_A398 Crystal Structure Of L-TalarateGALACTARATE DEHYDRAT 2e-06
3i4k_A383 Crystal Structure Of Muconate Lactonizing Enzyme Fr 2e-06
4it1_A446 Crystal Structure Of Enolase Pfl01_3283 (target Efi 2e-06
1nu5_A370 Crystal Structure Of Pseudomonas Sp. P51 Chloromuco 3e-06
1wuf_A393 Crystal Structure Of Protein Gi:16801725, Member Of 3e-06
2ovl_A371 Crystal Structure Of A Racemase From Streptomyces C 5e-06
2pp3_A398 Crystal Structure Of L-TalarateGALACTARATE DEHYDRAT 7e-06
2qdd_A378 Crystal Structure Of A Member Of Enolase Superfamil 1e-05
3h70_A343 Crystal Structure Of O-Succinylbenzoic Acid Synthet 1e-05
2p88_A369 Crystal Structure Of N-succinyl Arg/lys Racemase Fr 1e-05
2okt_A342 Crystal Structure Of O-Succinylbenzoic Acid Synthet 1e-05
3r0k_A379 Crystal Structure Of Nysgrc Enolase Target 200555, 2e-05
2fkp_A375 The Mutant G127c-T313c Of Deinococcus Radiodurans N 5e-05
3jva_A354 Crystal Structure Of Dipeptide Epimerase From Enter 6e-05
3tcs_A388 Crystal Structure Of A Putative Racemase From Roseo 9e-05
4ggb_A378 Crystal Structure Of A Proposed Galactarolactone Cy 2e-04
3ddm_A392 Crystal Structure Of Mandelate RacemaseMUCONATE Lac 2e-04
4h2h_A376 Crystal Structure Of An Enolase (Mandalate Racemase 2e-04
3vc5_A441 Crystal Structure Of Enolase Tbis_1083(Target Efi-5 2e-04
3cb3_A393 Crystal Structure Of L-talarate Dehydratase From Po 2e-04
3my9_A377 Crystal Structure Of A Muconate Cycloisomerase From 2e-04
2pmq_A377 Crystal Structure Of A Mandelate RacemaseMUCONATE L 3e-04
2og9_A393 Crystal Structure Of Mandelate RacemaseMUCONATE LAC 4e-04
2hne_A436 Crystal Structure Of L-fuconate Dehydratase From Xa 7e-04
2hxt_A441 Crystal Structure Of L-Fuconate Dehydratase From Xa 7e-04
3u9i_A393 The Crystal Structure Of Mandelate RacemaseMUCONATE 8e-04
>pdb|3LQ1|A Chain A, Crystal Structure Of 2-Succinyl-6-Hydroxy-2,4-Cyclohexadiene 1-Carboxylic Acid Synthase2-Oxoglutarate Decarboxylase From Listeria Monocytogenes Str. 4b F2365 Length = 578 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (424), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 140/471 (29%), Positives = 227/471 (48%), Gaps = 74/471 (15%)
Query: 9   AVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHAC 68
           AV  A  +P GPVH+N P REPL              + I   S  PFT   + +H H  
Sbjct: 159 AVDIAMKTPRGPVHLNFPLREPL--------------VPILEPS--PFTATGK-KHHHVH 201
Query: 69  KSYTYCQMAEVLE--LVQGV------NKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
             YT+    EVL+   +Q +       KG+ +VG +  ++    ++ LA+ + WP++AD 
Sbjct: 202 IYYTH----EVLDDSSIQKMVTECTGKKGVFVVGPIDKKELEQPMVDLAKKLGWPILADP 257
Query: 121 LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
           LSGLR    L        + + +D  D  L    + D +  +V+I+ GS   SK +   +
Sbjct: 258 LSGLRSYGAL--------DEVVIDQYDAFLKEAEIIDKLTPEVVIRFGSMPVSKPLKNWL 309
Query: 181 EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLKVQVPHRS------SKWCSF 234
           E+     + +VD      DP  +VT  I     +F+  +++  +P  +      + W S+
Sbjct: 310 EQLSDIRFYVVDPGAAWKDPIKAVTDMIHCD-ERFLLDIMQQNMPDDAKDAAWLNGWTSY 368
Query: 235 LRALDMMVASEISFQICADYS-LTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNW 293
            +     VA EI     A+ + L E  +  EL R L   + LF+GNSM IRD+D Y    
Sbjct: 369 NK-----VAREIVLAEMANTTILEEGKIVAELRRLLPDKAGLFIGNSMPIRDVDTYFSQI 423
Query: 294 TTCTHTVADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFL 353
                             + I++  NRGA+GIDG++S+A+G +V   + +  ++GD+SF 
Sbjct: 424 D-----------------KKIKMLANRGANGIDGVVSSALGASV-VFQPMFLLIGDLSFY 465
Query: 354 HDTNGLAILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNL 413
           HD NGL + K+   +  + ++++NN GG IFS LP A+  EP+  +  F T+  +  +  
Sbjct: 466 HDMNGLLMAKKY--KMNLTIVIVNNDGGGIFSFLPQAN--EPKYFESLFGTSTELDFRFA 521
Query: 414 CLAHGLNHVQVKTKVELEEALS-MSQHLGTDRVIEVESCIDANATFHSMLR 463
              +  ++ + K+  ELEEA+   S H G D +IEV++    N   H  L 
Sbjct: 522 AAFYDADYHEAKSVDELEEAIDKASYHKGLD-IIEVKTNRHENKANHQALE 571
>pdb|2JLA|A Chain A, Crystal Structure Of E.Coli Mend, 2-Succinyl-5-Enolpyruvyl- 6-Hydroxy-3-Cyclohexadiene-1-Carboxylate Synthase - Semet Protein Length = 558 Back     alignment and structure
>pdb|3FLM|A Chain A, Crystal Structure Of Mend From E.Coli Length = 556 Back     alignment and structure
>pdb|2JLC|A Chain A, Crystal Structure Of E.Coli Mend, 2-Succinyl-5-Enolpyruvyl- 6-Hydroxy-3-Cyclohexadiene-1-Carboxylate Synthase - Native Protein Length = 577 Back     alignment and structure
>pdb|2X7J|A Chain A, Structure Of The Menaquinone Biosynthesis Protein Mend From Bacillus Subtilis Length = 604 Back     alignment and structure
>pdb|1JPM|A Chain A, L-ala-d/l-glu Epimerase Length = 366 Back     alignment and structure
>pdb|2PGE|A Chain A, Crystal Structure Of Menc From Desulfotalea Psychrophila Lsv54 Length = 377 Back     alignment and structure
>pdb|2OPJ|A Chain A, Crystal Structure Of O-Succinylbenzoate Synthase Length = 327 Back     alignment and structure
>pdb|1SJA|A Chain A, X-Ray Structure Of O-Succinylbenzoate Synthase Complexed With N-Acetylmethionine Length = 368 Back     alignment and structure
>pdb|4A6G|A Chain A, N-Acyl Amino Acid Racemase From Amycalotopsis Sp. Ts-1-60: G291d-F323y Mutant In Complex With N-Acetyl Methionine Length = 368 Back     alignment and structure
>pdb|1R6W|A Chain A, Crystal Structure Of The K133r Mutant Of O-Succinylbenzoate Synthase (Osbs) From Escherichia Coli. Complex With Shchc Length = 322 Back     alignment and structure
>pdb|1FHV|A Chain A, Crystal Structure Analysis Of O-Succinylbenzoate Synthase From E. Coli Complexed With Mg And Osb Length = 323 Back     alignment and structure
>pdb|1FHU|A Chain A, Crystal Structure Analysis Of O-Succinylbenzoate Synthase From E. Coli Length = 320 Back     alignment and structure
>pdb|3GC2|A Chain A, 1.85 Angstrom Crystal Structure Of O-Succinylbenzoate Synthase From Salmonella Typhimurium In Complex With Succinic Acid Length = 323 Back     alignment and structure
>pdb|3DFY|A Chain A, Crystal Structure Of Apo Dipeptide Epimerase From Thermotoga Maritima Length = 345 Back     alignment and structure
>pdb|2OFJ|A Chain A, Crystal Structure Of The E190a Mutant Of O-succinylbenzoate Synthase From Escherichia Coli Length = 323 Back     alignment and structure
>pdb|3Q45|A Chain A, Crystal Structure Of Dipeptide Epimerase From Cytophaga Hutchinsonii Complexed With Mg And Dipeptide D-Ala-L-Val Length = 368 Back     alignment and structure
>pdb|2ZAD|A Chain A, Crystal Structure Of Muconate Cycloisomerase From Thermotoga Maritima Msb8 Length = 345 Back     alignment and structure
>pdb|3DG3|A Chain A, Crystal Structure Of Muconate Lactonizing Enzyme From Mucobacterium Smegmatis Length = 367 Back     alignment and structure
>pdb|2QDE|A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE LACTONIZING FAMILY Protein From Azoarcus Sp. Ebn1 Length = 397 Back     alignment and structure
>pdb|3CYJ|A Chain A, Crystal Structure Of A Mandelate RacemaseMUCONATE LACTONIZING ENZYME- Like Protein From Rubrobacter Xylanophilus Length = 372 Back     alignment and structure
>pdb|3OZM|A Chain A, Crystal Structure Of Enolase Superfamily Member From Bordetella Bronchiseptica Complexed With Mg, M-Xylarate And L-Lyxarate Length = 389 Back     alignment and structure
>pdb|3H12|A Chain A, Crystal Structure Of Putative Mandelate Racemase From Bordetella Bronchiseptica Rb50 Length = 397 Back     alignment and structure
>pdb|3QLD|A Chain A, Structure Of Probable Mandelate Racemase (Aalaa1draft_2112) From Alicyclobacillus Acidocaldarius Length = 388 Back     alignment and structure
>pdb|3UGV|A Chain A, Crystal Structure Of An Enolase From Alpha Pretobacterium Bal199 (Efi Target Efi-501650) With Bound Mg Length = 390 Back     alignment and structure
>pdb|3OP2|A Chain A, Crystal Structure Of Putative Mandelate Racemase From Bordetella Bronchiseptica Rb50 Complexed With 2-OxoglutaratePHOSPHATE Length = 397 Back     alignment and structure
>pdb|3TJ4|A Chain A, Crystal Structure Of An Enolase From Agrobacterium Tumefaciens (Efi Target Efi-502087) No Mg Length = 372 Back     alignment and structure
>pdb|2PP0|A Chain A, Crystal Structure Of L-TalarateGALACTARATE DEHYDRATASE FROM Salmonella Typhimurium Lt2 Length = 398 Back     alignment and structure
>pdb|3I4K|A Chain A, Crystal Structure Of Muconate Lactonizing Enzyme From Corynebacterium Glutamicum Length = 383 Back     alignment and structure
>pdb|4IT1|A Chain A, Crystal Structure Of Enolase Pfl01_3283 (target Efi-502286) From Pseudomonas Fluorescens Pf0-1 With Bound Magnesium, Potassium And Tartrate Length = 446 Back     alignment and structure
>pdb|1NU5|A Chain A, Crystal Structure Of Pseudomonas Sp. P51 Chloromuconate Lactonizing Enzyme Length = 370 Back     alignment and structure
>pdb|1WUF|A Chain A, Crystal Structure Of Protein Gi:16801725, Member Of Enolase Superfamily From Listeria Innocua Clip11262 Length = 393 Back     alignment and structure
>pdb|2OVL|A Chain A, Crystal Structure Of A Racemase From Streptomyces Coelicolor A3(2) Length = 371 Back     alignment and structure
>pdb|2PP3|A Chain A, Crystal Structure Of L-TalarateGALACTARATE DEHYDRATASE MUTANT K197A Liganded With Mg And L-Glucarate Length = 398 Back     alignment and structure
>pdb|2QDD|A Chain A, Crystal Structure Of A Member Of Enolase Superfamily From Roseovarius Nubinhibens Ism Length = 378 Back     alignment and structure
>pdb|3H70|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid Synthetase From Staphylococcus Aureus Complexed With Mg In The Active Site Length = 343 Back     alignment and structure
>pdb|2P88|A Chain A, Crystal Structure Of N-succinyl Arg/lys Racemase From Bacillus Cereus Atcc 14579 Length = 369 Back     alignment and structure
>pdb|2OKT|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid Synthetase From Staphylococcus Aureus, Ligand-Free Form Length = 342 Back     alignment and structure
>pdb|3R0K|A Chain A, Crystal Structure Of Nysgrc Enolase Target 200555, A Putative Dipeptide Epimerase From Francisella Philomiragia : Tartrate Bound, No Mg Length = 379 Back     alignment and structure
>pdb|2FKP|A Chain A, The Mutant G127c-T313c Of Deinococcus Radiodurans N- Acylamino Acid Racemase Length = 375 Back     alignment and structure
>pdb|3JVA|A Chain A, Crystal Structure Of Dipeptide Epimerase From Enterococcus Faecalis V583 Length = 354 Back     alignment and structure
>pdb|3TCS|A Chain A, Crystal Structure Of A Putative Racemase From Roseobacter Denitrificans Length = 388 Back     alignment and structure
>pdb|4GGB|A Chain A, Crystal Structure Of A Proposed Galactarolactone Cycloisomerase From Agrobacterium Tumefaciens, Target Efi-500704, With Bound Ca, Disordered Loops Length = 378 Back     alignment and structure
>pdb|3DDM|A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE Lactonizing Enzyme From Bordetella Bronchiseptica Rb50 Length = 392 Back     alignment and structure
>pdb|4H2H|A Chain A, Crystal Structure Of An Enolase (Mandalate Racemase Subgroup, Target Efi-502101) From Pelagibaca Bermudensis Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine (Betonicine) Length = 376 Back     alignment and structure
>pdb|3VC5|A Chain A, Crystal Structure Of Enolase Tbis_1083(Target Efi-502310) From Thermobispora Bispora Dsm 43833 Complexed With Phosphate Length = 441 Back     alignment and structure
>pdb|3CB3|A Chain A, Crystal Structure Of L-talarate Dehydratase From Polaromonas Sp. Js666 Complexed With Mg And L-glucarate Length = 393 Back     alignment and structure
>pdb|3MY9|A Chain A, Crystal Structure Of A Muconate Cycloisomerase From Azorhizobium Caulinodans Length = 377 Back     alignment and structure
>pdb|2PMQ|A Chain A, Crystal Structure Of A Mandelate RacemaseMUCONATE LACTONIZING ENZYME From Roseovarius Sp. Htcc2601 Length = 377 Back     alignment and structure
>pdb|2OG9|A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE LACTONIZING ENZYME From Polaromonas Sp. Js666 Length = 393 Back     alignment and structure
>pdb|2HNE|A Chain A, Crystal Structure Of L-fuconate Dehydratase From Xanthomonas Campestris Pv. Campestris Str. Atcc 33913 Length = 436 Back     alignment and structure
>pdb|2HXT|A Chain A, Crystal Structure Of L-Fuconate Dehydratase From Xanthomonas Campestris Liganded With Mg++ And D-Erythronohydroxamate Length = 441 Back     alignment and structure
>pdb|3U9I|A Chain A, The Crystal Structure Of Mandelate RacemaseMUCONATE LACTONIZING Enzyme From Roseiflexus Sp. Length = 393 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query983
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-103
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 1e-101
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 2e-97
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; e 5e-56
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 2e-52
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 3e-51
3caw_A330 O-succinylbenzoate synthase; structural genomics, 1e-43
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 1e-43
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 5e-39
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 3e-38
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 1e-37
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 3e-37
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 8e-37
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 2e-36
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 2e-36
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 2e-36
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 2e-36
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 2e-36
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 4e-36
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 4e-36
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 2e-35
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 5e-35
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 3e-34
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 4e-34
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 1e-33
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 1e-33
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 2e-33
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 2e-33
3r0u_A379 Enzyme of enolase superfamily; structural genomics 2e-33
2pmq_A377 Mandelate racemase/muconate lactonizing enzyme; st 4e-33
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 7e-33
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 7e-33
3eez_A378 Putative mandelate racemase/muconate lactonizing e 8e-33
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 1e-32
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 1e-32
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 2e-32
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 4e-32
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 4e-32
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 6e-32
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 2e-31
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 3e-31
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 2e-30
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 8e-29
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 1e-27
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 2e-26
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 2e-25
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 3e-25
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 4e-24
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 2e-22
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 3e-22
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 5e-22
3no1_A398 Isomerase, mandelate racemase/muconate lactonizing 7e-22
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 4e-21
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 4e-21
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 7e-21
2oz8_A389 MLL7089 protein; structural genomics, unknown func 9e-21
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 1e-20
1tzz_A392 Hypothetical protein L1841; structural genomics, m 4e-20
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 1e-19
3va8_A445 Probable dehydratase; enolase, magnesium binding s 2e-19
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 4e-19
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 7e-19
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 9e-19
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 1e-18
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 1e-18
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 2e-18
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 2e-18
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 3e-18
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 3e-18
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 1e-17
2qgy_A391 Enolase from the environmental genome shotgun sequ 2e-17
2ppg_A399 Putative isomerase; structural genomics, PSI-2, pr 2e-17
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 2e-17
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 3e-17
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 7e-17
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 2e-16
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 5e-16
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 8e-16
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 1e-15
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 2e-15
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 2e-15
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 3e-15
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 3e-15
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 1e-14
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 1e-14
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 2e-14
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 4e-14
2o56_A407 Putative mandelate racemase; dehydratase, structur 4e-14
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 5e-14
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 2e-13
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 5e-13
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; st 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2p3z_A415 L-rhamnonate dehydratase; enolase, structural geno 9e-13
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enola 1e-12
2gl5_A410 Putative dehydratase protein; structural genomics, 1e-12
2poz_A392 Putative dehydratase; octamer, structural genomics 1e-12
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 2e-12
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 3e-12
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 5e-12
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 1e-11
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 1e-10
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 2e-10
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 3e-10
1r3d_A 264 Conserved hypothetical protein VC1974; structural 4e-10
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 5e-10
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 1e-09
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 1e-09
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 3e-09
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 6e-09
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 2e-07
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 2e-07
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 2e-07
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 3e-07
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 7e-07
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 1e-06
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 2e-06
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 2e-06
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 3e-06
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 4e-06
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 4e-06
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 4e-06
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 5e-06
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 6e-06
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 1e-05
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 2e-05
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 2e-05
1iup_A 282 META-cleavage product hydrolase; aromatic compound 2e-05
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 3e-05
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 3e-05
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 3e-05
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 3e-05
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 4e-05
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 4e-05
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 8e-05
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 1e-04
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 1e-04
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 2e-04
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 2e-04
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 2e-04
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 2e-04
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 2e-04
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 3e-04
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 3e-04
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 3e-04
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 5e-04
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 6e-04
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 6e-04
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 9e-04
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
 Score =  332 bits (853), Expect = e-103
 Identities = 120/470 (25%), Positives = 211/470 (44%), Gaps = 44/470 (9%)

Query: 1   MILTTLDSAVHWATSSPYGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYI 60
                   AV  A  +P GPVH+N P REPL           L+      +  +    +I
Sbjct: 151 YAKWHGSRAVDIAMKTPRGPVHLNFPLREPLVPI--------LEPSPFTATGKKHHHVHI 202

Query: 61  QVQHSHACKSYTYCQMAEVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADI 120
              H     S     + +++    G  KG+ +VG +  ++    ++ LA+ + WP++AD 
Sbjct: 203 YYTHEVLDDS----SIQKMVTECTG-KKGVFVVGPIDKKELEQPMVDLAKKLGWPILADP 257

Query: 121 LSGLRLRKLLASFLETEQNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMI 180
           LSGLR             + + +D  D  L    + D +  +V+I+ GS   SK +   +
Sbjct: 258 LSGLRS--------YGALDEVVIDQYDAFLKEAEIIDKLTPEVVIRFGSMPVSKPLKNWL 309

Query: 181 EECFPCTYILVDNHPCRHDPSHSVTHRIQSTIVQFVDFLLK-VQVPHRSSKWCSFLRALD 239
           E+     + +VD      DP  +VT  I       +D + + +    + + W +   + +
Sbjct: 310 EQLSDIRFYVVDPGAAWKDPIKAVTDMIHCDERFLLDIMQQNMPDDAKDAAWLNGWTSYN 369

Query: 240 MMVASEISFQICADYSLTEPHVAHELSRALTSNSALFVGNSMAIRDLDMYGRNWTTCTHT 299
            +    +  ++     L E  +  EL R L   + LF+GNSM IRD+D Y          
Sbjct: 370 KVAREIVLAEMANTTILEEGKIVAELRRLLPDKAGLFIGNSMPIRDVDTYFSQI------ 423

Query: 300 VADIMLNSEFPHQWIRVAGNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGL 359
                       + I++  NRGA+GIDG++S+A+G +V   + +  ++GD+SF HD NGL
Sbjct: 424 -----------DKKIKMLANRGANGIDGVVSSALGASVV-FQPMFLLIGDLSFYHDMNGL 471

Query: 360 AILKQRMKRKPILMLVINNHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGL 419
            + K+   +  + ++++NN GG IFS LP A+  EP+  +  F T+  +  +     +  
Sbjct: 472 LMAKKY--KMNLTIVIVNNDGGGIFSFLPQAN--EPKYFESLFGTSTELDFRFAAAFYDA 527

Query: 420 NHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQS 469
           ++ + K+  ELEEA+  + +     +IEV++    N   H  L       
Sbjct: 528 DYHEAKSVDELEEAIDKASYHKGLDIIEVKTNRHENKANHQALEGHHHHH 577
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>1r6w_A OSB synthase, O-succinylbenzoate synthase, OSBS; enolase superfamily, TIM barrel, capping alpha+beta domain, lyase; HET: 164; 1.62A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1fhv_A* 1fhu_A 2ofj_A 3gc2_A* Length = 322 Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Length = 377 Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Length = 332 Back     alignment and structure
>3caw_A O-succinylbenzoate synthase; structural genomics, PSI-2, NYSGXRC, target 9462A, protein structure initiative; 1.87A {Bdellovibrio bacteriovorus HD100} Length = 330 Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Length = 342 Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Length = 366 Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Length = 381 Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Length = 354 Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Length = 386 Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Length = 388 Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Length = 356 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Length = 393 Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Length = 370 Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Length = 368 Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Length = 367 Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Length = 400 Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Length = 382 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Length = 369 Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Length = 385 Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Length = 327 Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Length = 368 Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} SCOP: c.1.11.2 d.54.1.1 PDB: 2chr_A Length = 370 Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Length = 378 Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Length = 383 Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Length = 375 Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Length = 379 Back     alignment and structure
>2pmq_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, isomerase, PSI-2; HET: MSE; 1.72A {Roseovarius SP} Length = 377 Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Length = 386 Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Length = 389 Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Length = 378 Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Length = 397 Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Length = 369 Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Length = 371 Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Length = 379 Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Length = 377 Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Length = 345 Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Length = 391 Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Length = 324 Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Length = 365 Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Length = 393 Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Length = 384 Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Length = 392 Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Length = 398 Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Length = 338 Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Length = 359 Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Length = 441 Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Length = 391 Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Length = 383 Back     alignment and structure
>3no1_A Isomerase, mandelate racemase/muconate lactonizing enzyme; enolase,metal-binding,PSI-II, NYSGXRC, structural genomics; 2.16A {Marine actinobacterium} PDB: 3msy_A Length = 398 Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Length = 445 Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Length = 401 Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Length = 382 Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Length = 389 Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Length = 390 Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Length = 392 Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Length = 413 Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Length = 445 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Length = 371 Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Length = 389 Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Length = 428 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Length = 450 Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Length = 398 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Length = 393 Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Length = 372 Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Length = 388 Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} Length = 372 Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Length = 374 Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Length = 391 Back     alignment and structure
>2ppg_A Putative isomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.49A {Sinorhizobium meliloti} Length = 399 Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Length = 392 Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Length = 382 Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Length = 393 Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 3nxl_A Length = 470 Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Length = 464 Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Length = 388 Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* Length = 455 Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Length = 433 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Length = 412 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Length = 413 Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Length = 405 Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Length = 394 Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Length = 412 Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Length = 410 Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Length = 404 Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Length = 407 Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Length = 410 Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Length = 409 Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Length = 403 Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Length = 404 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Length = 415 Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Length = 455 Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Length = 410 Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Length = 392 Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Length = 400 Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Length = 422 Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Length = 394 Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 3s47_A 3gy1_A Length = 401 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Length = 440 Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Length = 424 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Length = 418 Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4fi4_A 3thu_A Length = 425 Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Length = 426 Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Length = 441 Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Length = 441 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query983
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 100.0
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 100.0
3r0u_A379 Enzyme of enolase superfamily; structural genomics 100.0
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 100.0
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 100.0
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 100.0
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 100.0
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 100.0
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 100.0
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 100.0
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 100.0
3eez_A378 Putative mandelate racemase/muconate lactonizing e 100.0
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 100.0
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 100.0
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 100.0
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 100.0
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 100.0
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 100.0
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 100.0
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 100.0
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 100.0
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 100.0
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 100.0
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 100.0
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 100.0
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 100.0
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 100.0
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 100.0
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 100.0
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 100.0
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 100.0
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 100.0
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 100.0
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 100.0
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 100.0
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 100.0
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 100.0
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 100.0
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 100.0
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 100.0
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 100.0
3va8_A445 Probable dehydratase; enolase, magnesium binding s 100.0
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 100.0
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 100.0
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 100.0
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 100.0
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 100.0
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 100.0
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 100.0
3v5c_A392 Mandelate racemase/muconate lactonizing protein; e 100.0
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 100.0
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 100.0
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 100.0
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 100.0
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 100.0
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 100.0
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 100.0
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 100.0
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 100.0
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 100.0
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 100.0
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 100.0
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 100.0
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 100.0
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 100.0
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 100.0
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 100.0
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 100.0
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 100.0
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 100.0
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 100.0
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 100.0
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 100.0
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 100.0
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 100.0
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 100.0
2qgy_A391 Enolase from the environmental genome shotgun sequ 100.0
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 100.0
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 100.0
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 100.0
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 100.0
2o56_A407 Putative mandelate racemase; dehydratase, structur 100.0
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 100.0
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 100.0
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 100.0
2poz_A392 Putative dehydratase; octamer, structural genomics 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 100.0
2gl5_A410 Putative dehydratase protein; structural genomics, 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 100.0
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 100.0
2oz8_A389 MLL7089 protein; structural genomics, unknown func 100.0
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 100.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; st 100.0
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enola 100.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
1tzz_A392 Hypothetical protein L1841; structural genomics, m 100.0
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 100.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 100.0
4gfi_A329 Mandelate racemase/muconate lactonizing enzyme FA 100.0
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 100.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; e 100.0
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
3caw_A330 O-succinylbenzoate synthase; structural genomics, 100.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
2p3z_A415 L-rhamnonate dehydratase; enolase, structural geno 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 100.0
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 100.0
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 100.0
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 100.0
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 100.0
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 100.0
1w6t_A444 Enolase; bacterial infection, surface protein, moo 100.0
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 100.0
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 100.0
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 100.0
3qn3_A417 Enolase; structural genomics, center for structura 100.0
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 100.0
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 100.0
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 99.87
3otr_A452 Enolase; structural genomics, center for structura 99.82
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.69
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.69
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 99.61
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 99.6
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.6
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 99.59
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 99.56
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 99.53
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.5
3l84_A632 Transketolase; TKT, structural genomics, center fo 99.46
3uk1_A711 Transketolase; structural genomics, seattle struct 99.44
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 99.43
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 99.42
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.42
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.41
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.41
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 99.4
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 99.4
1gpu_A680 Transketolase; transferase(ketone residues); HET: 99.38
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 99.29
3rim_A700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 98.98
2yic_A868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 98.97
2xt6_A1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 98.84
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.82
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.82
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.71
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 98.67
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.66
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 98.66
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.66
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.64
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.62
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.6
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 98.58
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 98.58
2jgd_A933 2-oxoglutarate dehydrogenase E1 component; flavopr 98.58
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.56
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 98.56
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.56
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.55
2qtc_A886 Pyruvate dehydrogenase E1 component; thiamin dipho 98.55
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.54
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 98.54
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.53
1iup_A 282 META-cleavage product hydrolase; aromatic compound 98.53
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 98.53
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.52
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.52
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.5
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.5
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.47
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.45
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.45
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.42
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.42
1r3d_A 264 Conserved hypothetical protein VC1974; structural 98.39
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.38
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.37
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 98.37
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.37
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.36
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 98.33
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.31
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 98.3
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 98.3
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.29
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.28
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.27
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.27
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 98.26
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.23
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.22
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.21
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.21
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.2
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.19
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 98.18
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.15
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.14
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.14
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 98.12
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.39
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 98.04
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.03
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 98.02
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.02
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.95
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.95
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 97.93
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.93
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.92
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 97.9
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.89
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 97.89
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.88
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.86
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 97.84
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.84
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.84
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 97.83
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 97.83
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.82
1imj_A 210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.82
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.76
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 97.68
3llc_A 270 Putative hydrolase; structural genomics, joint cen 97.66
3bdi_A 207 Uncharacterized protein TA0194; NP_393672.1, predi 97.66
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 97.65
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 97.64
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.64
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 97.62
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.61
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.58
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.57
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.53
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 97.52
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 97.52
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 97.5
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.49
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 97.49
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.48
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 97.46
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.43
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.42
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 97.34
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 97.34
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 97.34
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 97.34
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.23
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 97.21
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.19
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 97.19
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.17
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.16
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.15
3trd_A 208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.14
3ahc_A845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 97.09
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 97.09
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.06
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 97.06
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 97.06
2r8b_A 251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.03
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.0
2fuk_A 220 XC6422 protein; A/B hydrolase, structural genomics 96.98
2o2g_A 223 Dienelactone hydrolase; YP_324580.1, structural ge 96.97
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 96.95
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 96.95
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 96.95
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.94
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 96.93
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 96.92
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.92
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 96.91
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 96.9
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 96.89
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 96.88
3h04_A 275 Uncharacterized protein; protein with unknown func 96.88
3og9_A 209 Protein YAHD A copper inducible hydrolase; alpha/b 96.86
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 96.84
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 96.79
2h1i_A 226 Carboxylesterase; structural genomics, PSI-2, prot 96.76
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.76
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.7
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 96.69
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 96.68
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 96.64
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 96.63
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 96.62
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 96.61
3cn9_A 226 Carboxylesterase; alpha/beta hydrolase fold super- 96.59
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 96.54
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 96.38
3b5e_A 223 MLL8374 protein; NP_108484.1, carboxylesterase, st 96.33
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 96.3
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 96.21
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.19
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 96.1
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 96.07
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 96.04
1fj2_A 232 Protein (acyl protein thioesterase 1); alpha/beta 96.03
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 96.01
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 95.98
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 95.93
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 95.82
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 95.78
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 95.76
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 95.72
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 95.69
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 95.68
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 95.57
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 95.5
4h0c_A 210 Phospholipase/carboxylesterase; PSI-biology, midwe 95.46
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 95.45
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.42
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 95.27
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 95.26
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 95.13
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 95.13
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 94.98
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 94.94
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.85
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 94.72
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 94.69
3u0v_A 239 Lysophospholipase-like protein 1; alpha, beta hydr 94.67
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 94.45
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 94.3
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 94.28
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 94.13
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 93.9
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 93.77
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 93.52
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 93.48
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 93.46
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 93.43
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 93.4
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 93.22
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 93.04
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 93.0
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 92.91
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 92.89
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 92.85
3bdv_A 191 Uncharacterized protein DUF1234; DUF1234 family pr 92.82
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 92.52
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.24
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.09
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 91.95
1o97_D320 Electron transferring flavoprotein alpha-subunit; 91.87
4fhz_A 285 Phospholipase/carboxylesterase; alpha/beta hydrola 91.51
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.15
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 90.95
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 90.66
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 90.04
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 90.03
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 89.19
4f21_A 246 Carboxylesterase/phospholipase family protein; str 89.14
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 88.87
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 88.84
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 88.63
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 88.48
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 88.26
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 87.9
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 87.73
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 87.73
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 87.72
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 87.63
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 87.07
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 86.83
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 86.82
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 86.76
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 86.33
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 86.23
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 86.21
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 86.05
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 85.86
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 85.45
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.26
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 85.18
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 84.9
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 84.68
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 84.54
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 84.51
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 84.22
1efv_A315 Electron transfer flavoprotein; electron transport 83.87
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 83.74
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 83.58
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 83.4
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 83.31
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 83.13
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 82.91
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 82.86
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 82.82
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 82.78
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 82.77
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 82.74
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 82.6
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 82.39
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 82.38
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 82.38
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 82.37
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 82.36
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.28
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 82.2
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 82.18
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 82.09
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 81.79
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 81.52
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 81.33
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 81.11
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 81.07
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 80.9
1m2k_A249 Silent information regulator 2; protein-ligand com 80.74
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 80.45
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 80.41
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 80.23
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 80.22
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
Probab=100.00  E-value=9.1e-63  Score=558.49  Aligned_cols=362  Identities=18%  Similarity=0.224  Sum_probs=312.8

Q ss_pred             ccceeEeEEEEEEEEeeCCCCCccccccccCcceeeeEEEEEEEECCCCEEEEeecCc--C-cCcccHHHHHHHHHH-HH
Q 041113          490 LSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPL--E-IHKENLLDAEEQLRF-LL  565 (983)
Q Consensus       490 ~~~mkI~~v~~~~~~~pl~~p~~~~~~~~~~~~~~~~~~lv~v~t~~G~~G~GE~~~~--~-~~~~~~~~~~~~l~~-~~  565 (983)
                      |++|||++|+++.+++||+.||.++.+.+    ..++.++|||+|++|++||||+.+.  + +++++.+.+...++. +.
T Consensus         3 m~~MkI~~i~~~~~~~pl~~p~~~s~~~~----~~~~~~~V~v~td~G~~G~GE~~~~~~~~~~~e~~~~~~~~i~~~l~   78 (383)
T 3i4k_A            3 LSDLTIQKVESRILDVPLIRPHGFATTTS----TEQHILLVSVHLENGVIGYGEGVVPGGPWWGGESVETMKALVDGYLA   78 (383)
T ss_dssp             --CCBEEEEEEEEEEEEEEEEEECSSCEE----EEEEEEEEEEEETTSCEEEEEECCSSSTTTTSCCHHHHHHHHHHTTH
T ss_pred             CCCCEEEEEEEEEEeccccCCeEecceEE----EeeeEEEEEEEECCCCEEEEecccCCCCccCCCCHHHHHHHHHhhhh
Confidence            66799999999999999999999998764    4589999999999999999999876  2 556777777777754 89


Q ss_pred             hHhccCcccccccccccCchhhhhhhcCCCCCcchhhHHHHHHHHHHHHHHHHcCCChhhhcCCCCccccccccccceeE
Q 041113          566 HFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIK  645 (983)
Q Consensus       566 ~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~aid~AlwDl~gk~~g~pv~~lLGg~~~~~~~~~~~~~~i~  645 (983)
                      |.++|+++.+++.++..     +++.+.     ..++|++|||+|||||+||.+|+|||+||||..         +++|+
T Consensus        79 p~l~G~d~~~~~~~~~~-----l~~~~~-----~~~~A~said~ALwDl~gk~~g~Pv~~LLGg~~---------r~~v~  139 (383)
T 3i4k_A           79 PVLIGRAVSELAGIMAD-----LERVVA-----RARYAKAAVDVAMHDAWARSLNVPVRDLLGGTV---------RDKVD  139 (383)
T ss_dssp             HHHTTSBGGGHHHHHHH-----HHHHCC-----SCHHHHHHHHHHHHHHHHHHTTSBGGGGTTCCS---------CSEEE
T ss_pred             HHHcCCCccCHHHHHHH-----HHHHhc-----CCHHHHHHHHHHHHHHHHHHcCCCHHHHhCCCC---------CCeEE
Confidence            99999999887665532     122111     257899999999999999999999999999976         57899


Q ss_pred             EEEeecCCCCHHHHHHHHHHhhhc-CCCEEEEeccCCCChHHHHHHHHHHHHHcCCCcEEEEEcCCCCCHHHHHHHHhhc
Q 041113          646 ICALIDSNKSPVEVASIATTLVEE-GFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLI  724 (983)
Q Consensus       646 ~~~~~~~~~~~~~~~~~~~~~~~~-G~~~~KiKig~~~~~~~d~~~v~~vr~~~g~~~~l~vDaN~~~~~~~a~~~~~~l  724 (983)
                      +|+++. ..+++++++++++++++ ||++||+|+|. .++++|++++++||+++|+++.|++|+|++|+.++|+++++.|
T Consensus       140 ~~~t~~-~~~~~~~~~~a~~~~~~~G~~~~K~Kvg~-~~~~~d~~~v~avR~a~g~~~~l~vDan~~~~~~~A~~~~~~l  217 (383)
T 3i4k_A          140 VTWALG-VLPLDVAVAEIEERIEEFGNRSFKLKMGA-GDPAEDTRRVAELAREVGDRVSLRIDINARWDRRTALHYLPIL  217 (383)
T ss_dssp             BCEEEC-SCCHHHHHHHHHHHHHHHCCSEEEEECCS-SCHHHHHHHHHHHHHTTTTTSEEEEECTTCSCHHHHHHHHHHH
T ss_pred             EeEEee-CCCHHHHHHHHHHHHHhcCCcEEEEeeCC-CCHHHHHHHHHHHHHHcCCCCEEEEECCCCCCHHHHHHHHHHH
Confidence            998874 56899999999999987 99999999997 3799999999999999999999999999999999999999999


Q ss_pred             ccCCCceeecCCC--ChHHHHHHHhhcCCcEEeCCCccCcCCChHHHHHhhcCC-CceEEEEcCCCcCCHHHHHHHHHHH
Q 041113          725 KDCDLQYIEEPVQ--NEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHP-GIVAIVIKPSVIGGFENAGLIARWA  801 (983)
Q Consensus       725 ~~~~i~~iEeP~~--~~~~~~~l~~~~~ipIa~dEs~~~~~~~~~~~~~~~~~~-~~~~i~~k~~~~GGl~~~~~~~~~A  801 (983)
                      +++++.|||||++  +++++++|++++++||++||++.+..+     +..+++. .+|++++|++++||++++++++++|
T Consensus       218 ~~~~i~~iEqP~~~~d~~~~~~l~~~~~iPIa~dE~~~~~~~-----~~~~i~~~~~d~v~~k~~~~GGit~~~~ia~~A  292 (383)
T 3i4k_A          218 AEAGVELFEQPTPADDLETLREITRRTNVSVMADESVWTPAE-----ALAVVKAQAADVIALKTTKHGGLLESKKIAAIA  292 (383)
T ss_dssp             HHTTCCEEESCSCTTCHHHHHHHHHHHCCEEEESTTCSSHHH-----HHHHHHHTCCSEEEECTTTTTSHHHHHHHHHHH
T ss_pred             HhcCCCEEECCCChhhHHHHHHHHhhCCCCEEecCccCCHHH-----HHHHHHcCCCCEEEEcccccCCHHHHHHHHHHH
Confidence            9999999999998  688899999999999999999998753     5566654 5799999999999999999999999


Q ss_pred             HHcCCcEEeCCCCchHHHHHHHHHHHhhchhhhhhhhhhccccCCCCCccCccchhcccccCCCCCceeec----cCCCC
Q 041113          802 QRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICH----NSCRG  877 (983)
Q Consensus       802 ~~~gi~~~~~~~~es~ig~~a~~~laa~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~d~~~~p~~~~~----~P~~p  877 (983)
                      +++|++++++|++|++|++++++|+++++||+.              .++.+++..++.+|++.+|+.+++    +|++|
T Consensus       293 ~~~gi~~~~~~~~es~i~~aa~~hlaaa~p~~~--------------~~~e~~~~~~~~~d~~~~~~~~~~G~i~~p~~P  358 (383)
T 3i4k_A          293 EAGGLACHGATSLEGPIGTAASLQFAASTKAIS--------------YGTELFGPQLLKDTYIVQEFEYKDGQVAIPQGP  358 (383)
T ss_dssp             HHTTCEEEECCSCCCHHHHHHHHHHHHHCTTEE--------------EEECCCHHHHBSSCSSSSCCCEETTEEECCCSS
T ss_pred             HHcCCeEEeCCCCccHHHHHHHHHHHHcCCCCC--------------ccccccchhhhhhhccCCCceeeCCEEECCCCC
Confidence            999999999999999999999999999998641              112344566788899999999884    99999


Q ss_pred             eeeEEecchhhhhhhccccc
Q 041113          878 FVEASVAKATHILQNLQINN  897 (983)
Q Consensus       878 GlGv~~d~a~~~~~~~~~~~  897 (983)
                      ||||++|  ++.++++++..
T Consensus       359 GlGv~~d--~~~l~~~~~~~  376 (383)
T 3i4k_A          359 GLGVDVD--MDKVNFYTRKE  376 (383)
T ss_dssp             BTSCCCC--HHHHHHHBC--
T ss_pred             CcceeeC--HHHHHHhhhcc
Confidence            9999999  88888887654
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3v5c_A Mandelate racemase/muconate lactonizing protein; enolase fold, galacturonate dehydratase, double Mg site, LYA; 1.53A {Paenibacillus SP} PDB: 3v5f_A* 3p3b_A* 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>4gfi_A Mandelate racemase/muconate lactonizing enzyme FA protein; putative L-Ala-L/D-Glu epimerase; HET: GLU; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>1r6w_A OSB synthase, O-succinylbenzoate synthase, OSBS; enolase superfamily, TIM barrel, capping alpha+beta domain, lyase; HET: 164; 1.62A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1fhv_A* 1fhu_A 2ofj_A 3gc2_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3caw_A O-succinylbenzoate synthase; structural genomics, PSI-2, NYSGXRC, target 9462A, protein structure initiative; 1.87A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 983
d1r6wa1221 c.1.11.2 (A:100-320) O-succinylbenzoate synthase { 2e-23
d1jdfa1309 c.1.11.2 (A:138-446) D-glucarate dehydratase {Esch 3e-16
d1jpdx1208 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Esch 9e-15
d1yeya1252 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas 5e-14
d1muca1242 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme { 1e-12
d1tzza1247 c.1.11.2 (A:1146-1392) Hypothetical protein Bll673 4e-11
d1jpma1234 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Baci 7e-11
d2chra1244 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase 1e-10
d1nu5a1243 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase 2e-10
d1sjda1242 c.1.11.2 (A:126-367) N-acylamino acid racemase {Am 3e-09
d1kcza1253 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostri 3e-09
d1kkoa1251 c.1.11.2 (A:161-411) beta-Methylaspartase {Citroba 6e-09
d1r0ma1243 c.1.11.2 (A:133-375) N-acylamino acid racemase {De 7e-09
d1wufa1244 c.1.11.2 (A:1127-1370) N-acylamino acid racemase { 1e-08
d1wuea1241 c.1.11.2 (A:1127-1367) N-acylamino acid racemase { 2e-08
d1r6wa2101 d.54.1.1 (A:-2-99) O-succinylbenzoate synthase {Es 5e-08
d2mnra1227 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomon 8e-08
d2gdqa1256 c.1.11.2 (A:119-374) Hypothetical protein YitF {Ba 4e-07
d1m33a_ 256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 1e-06
d1rvka1255 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 2e-06
d1mj5a_ 298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 5e-06
d1pjaa_ 268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 4e-05
d1xkla_ 258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 6e-05
d3c70a1 256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 3e-04
d2gl5a1278 c.1.11.2 (A:123-400) Putative dehydratase protein 4e-04
d1bn7a_ 291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 0.001
d1brta_ 277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 0.001
d1cvla_ 319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 0.001
d1ex9a_ 285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 0.003
d1wm1a_ 313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 0.004
d1uk8a_ 271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 0.004
d1ehya_ 293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 0.004
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Length = 221 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: D-glucarate dehydratase-like
domain: O-succinylbenzoate synthase
species: Escherichia coli [TaxId: 562]

 Score = 97.9 bits (243), Expect = 2e-23
 Identities = 40/212 (18%), Positives = 77/212 (36%), Gaps = 22/212 (10%)

Query: 656 PVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQ 715
           P ++      +   G    K++V    + ++D  V+  + + +   + LR+DANR WT  
Sbjct: 15  PDDLILKLADM--PGEKVAKVRVGLY-EAVRDGMVVNLLLEAIPD-LHLRLDANRAWTPL 70

Query: 716 EALEFGFLIKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAH 775
           +  +F   +       I    +  +        +          +  ++         A 
Sbjct: 71  KGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAF---VAE 127

Query: 776 PGIVAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNA 835
            G+ A+VIKP++ G  E      + A   G  AV+S++ ES LGL+     +++L     
Sbjct: 128 EGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLT---- 183

Query: 836 YLCKVMNRELCPPVAQGLGTYQWLKEDVTTDP 867
                      P    GL T   ++       
Sbjct: 184 -----------PDTIPGLDTLDLMQAQQVRRW 204
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Length = 309 Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Length = 208 Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 252 Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Length = 242 Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Length = 247 Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Length = 244 Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Length = 243 Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Length = 242 Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Length = 253 Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Length = 251 Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Length = 243 Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Length = 244 Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Length = 241 Back     information, alignment and structure
>d1r6wa2 d.54.1.1 (A:-2-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Length = 227 Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Length = 256 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Length = 255 Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Length = 278 Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query983
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 100.0
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 100.0
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 100.0
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 100.0
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 100.0
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 100.0
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 100.0
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 100.0
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 100.0
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 100.0
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 100.0
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 100.0
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 100.0
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 100.0
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 100.0
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1r6wa1221 O-succinylbenzoate synthase {Escherichia coli [Tax 100.0
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.98
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.98
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.98
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.98
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.97
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.97
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 99.97
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.97
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.97
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.97
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 99.92
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 99.91
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.91
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.9
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.9
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.89
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.89
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.88
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.88
d1jpma2125 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 99.87
d2chra2126 Chlormuconate cycloisomerase {Alcaligenes eutrophu 99.84
d1nu5a2126 Chlormuconate cycloisomerase {Pseudomonas sp. p51 99.84
d1rvka2126 Hypothetical protein Atu3453 {Agrobacterium tumefa 99.83
d2gdqa2115 Hypothetical protein YitF {Bacillus subtilis [TaxI 99.83
d1wufa2126 N-acylamino acid racemase {Listeria innocua [TaxId 99.82
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.82
d2mnra2130 Mandelate racemase {Pseudomonas putida [TaxId: 303 99.81
d2gl5a2122 Putative dehydratase protein STM2273 {Salmonella t 99.81
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.8
d1muca2127 Muconate-lactonizing enzyme (cis muconate cycloiso 99.8
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.79
d1wuea2126 N-acylamino acid racemase {Enterococcus faecalis [ 99.79
d1r0ma2127 N-acylamino acid racemase {Deinococcus radiodurans 99.77
d1jdfa2133 D-glucarate dehydratase {Escherichia coli [TaxId: 99.77
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.76
d1jpdx2116 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 99.76
d1sjda2125 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 99.74
d1tzza2140 Hypothetical protein Bll6730 {Bradyrhizobium japon 99.73
d1bqga2132 D-glucarate dehydratase {Pseudomonas putida [TaxId 99.72
d1yeya2139 RTS beta protein {Xanthomonas campestris pv. campe 99.64
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.59
d1r6wa2101 O-succinylbenzoate synthase {Escherichia coli [Tax 99.54
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 98.91
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 98.85
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.82
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.82
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 98.78
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.77
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 98.75
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 98.73
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.71
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.66
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.63
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 98.63
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.63
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.62
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 98.61
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.59
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 98.59
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.59
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.58
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.58
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.58
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.57
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.57
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.55
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.51
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.5
d2c42a2447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 98.48
d2akza1294 Enolase {Human (Homo sapiens), gamma isoform [TaxI 98.44
d2fyma1292 Enolase {Escherichia coli [TaxId: 562]} 98.4
d2al1a1295 Enolase {Baker's yeast (Saccharomyces cerevisiae) 98.37
d1w6ta1296 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 98.35
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.35
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.34
d2ptza1291 Enolase {Trypanosoma brucei [TaxId: 5691]} 98.31
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 98.24
d1w6ta2137 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 98.14
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 98.13
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.04
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 98.04
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 98.01
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.95
d2fyma2139 Enolase {Escherichia coli [TaxId: 562]} 97.87
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 97.74
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.7
d2ptza2139 Enolase {Trypanosoma brucei [TaxId: 5691]} 97.59
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.59
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 97.58
d2al1a2141 Enolase {Baker's yeast (Saccharomyces cerevisiae) 97.3
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.15
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 96.98
d2akza2139 Enolase {Human (Homo sapiens), gamma isoform [TaxI 96.76
d1pdza2139 Enolase {European lobster (Homarus vulgaris) [TaxI 96.72
d1kkoa2160 beta-Methylaspartase {Citrobacter amalonaticus [Ta 96.7
d1kcza2160 beta-Methylaspartase {Clostridium tetanomorphum [T 96.68
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 96.6
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.59
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 96.39
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 96.32
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 96.32
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 96.11
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.0
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 95.9
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.88
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 95.83
d3b5ea1 209 Uncharacterized protein Mll8374 {Mesorhizobium lot 95.45
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 95.42
d2r8ba1 203 Uncharacterized protein Atu2452 {Agrobacterium tum 95.37
d2fuka1 218 XC6422 protein {Xanthomonas campestris [TaxId: 339 95.34
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 95.22
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.17
d3clsd2123 C-terminal domain of the electron transfer flavopr 95.12
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 94.72
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 94.59
d1efva2124 C-terminal domain of the electron transfer flavopr 94.53
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 94.51
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 94.05
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 93.09
d2i3da1 218 Hypothetical protein Atu1826 {Agrobacterium tumefa 92.62
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 92.38
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 92.0
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 91.81
d1fj2a_ 229 Acyl protein thioesterase 1 {Human (Homo sapiens) 90.61
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 89.73
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 88.43
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 86.72
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 85.61
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 85.48
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 84.81
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 84.61
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.57
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 83.99
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 83.93
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 83.62
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 83.35
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 82.2
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 81.95
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 81.47
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 81.27
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 80.94
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 80.29
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 80.05
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: D-glucarate dehydratase-like
domain: Chlormuconate cycloisomerase
species: Alcaligenes eutrophus [TaxId: 106590]

Probab=100.00  E-value=8.1e-42  Score=360.60  Aligned_cols=232  Identities=18%  Similarity=0.236  Sum_probs=204.4

Q ss_pred             cceeEEEEeecCCCCHHHHHHHHHHhhhcCCCEEEEeccCCCChHHHHHHHHHHHHHcCCCcEEEEEcCCCCCHHHHHHH
Q 041113          641 STSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEF  720 (983)
Q Consensus       641 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~KiKig~~~~~~~d~~~v~~vr~~~g~~~~l~vDaN~~~~~~~a~~~  720 (983)
                      |++||+|+++....+++++.+.++.+.++||++||+|+|.. ++++|+++|+++|+++|+++.|++|+|++|++++|+++
T Consensus         3 r~~vP~~~~~~~~~~~~~~~~~~~~~~~~Gf~~~KiKvG~~-~~~~D~~~v~~ir~~~g~~~~l~vDaN~~~~~~~A~~~   81 (244)
T d2chra1           3 RSAIPIAWTLASGDTKRDLDSAVEMIERRRHNRFKVKLGFR-SPQDDLIHMEALSNSLGSKAYLRVDVNQAWDEQVASVY   81 (244)
T ss_dssp             CSEEEBEEEECSSCHHHHHHHHHHHHHTTSCCEEEEECSSS-CHHHHHHHHHHHHHHTTTTSEEEEECTTCCCTHHHHHH
T ss_pred             CCcEEEEEEEcCCCcHHHHHHHHHHHHhCCCCEEEEEcCCC-CHHHHHHHHHHHHHhcCCCceEEEeCCCCcchHHHHHH
Confidence            68899999986556666666666777778999999999973 89999999999999999999999999999999999999


Q ss_pred             HhhcccCCCceeecCCC--ChHHHHHHHhhcCCcEEeCCCccCcCCChHHHHHhhcCCC-ceEEEEcCCCcCCHHHHHHH
Q 041113          721 GFLIKDCDLQYIEEPVQ--NEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPG-IVAIVIKPSVIGGFENAGLI  797 (983)
Q Consensus       721 ~~~l~~~~i~~iEeP~~--~~~~~~~l~~~~~ipIa~dEs~~~~~~~~~~~~~~~~~~~-~~~i~~k~~~~GGl~~~~~~  797 (983)
                      ++.|+++++.|+|||++  |++++++|++++++||++||++++..+     +..+++.+ +|++++|++++||+++++++
T Consensus        82 ~~~l~~~~i~~iEeP~~~~d~~~~~~l~~~~~ipia~~E~~~~~~~-----~~~~i~~~~~d~v~~d~~~~GGit~~~~i  156 (244)
T d2chra1          82 IPELEALGVELIEQPVGRENTQALRRLSDNNRVAIMADESLSTLAS-----AFDLARDRSVDVFSLKLCNMGGVSATQKI  156 (244)
T ss_dssp             HHHHHTTTCCEEECCSCSSCHHHHHHHHHHCSSEEEESSSCCSHHH-----HHHHHTTTCCSEECCCHHHHTSHHHHHHH
T ss_pred             HHHHhhhhHHHHhhhhhhccchhhhhhccceeeeeeecccccccch-----hhhhhhcceeEEEeeccccccchHHHHHH
Confidence            99999999999999998  788999999999999999999999753     66666655 79999999999999999999


Q ss_pred             HHHHHHcCCcEEeCCCCchHHHHHHHHHHHhhchhhhhhhhhhccccCCCCCccCccchhcccccCCCCCceeec----c
Q 041113          798 ARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQWLKEDVTTDPISICH----N  873 (983)
Q Consensus       798 ~~~A~~~gi~~~~~~~~es~ig~~a~~~laa~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~d~~~~p~~~~~----~  873 (983)
                      +++|+++|+++++||+++++|+.++++|++++++|..              ..+.+....++.++++.+|+.+++    +
T Consensus       157 ~~~a~~~gi~~~~~~~~~~~i~~~a~~hl~a~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~G~~~~  222 (244)
T d2chra1         157 AAVAEASGIASYGGTMLDSTIGTSVALQLYSTVPSLP--------------FGCELIGPFVLADTLSHEPLEIRDYELQV  222 (244)
T ss_dssp             HHHHHHHTCEECCCCCSCCHHHHHHHHHHHTTSSCCT--------------TCBCCCHHHHBSCCSBSCCCCBCSSEEEC
T ss_pred             HHHHHHcCCCeeeccccccccchhHHHHHHHhCCCCc--------------ceeccCchhhhhhhcccCCceeECCEEEC
Confidence            9999999999999999999999999999999998642              112233445567788888998884    9


Q ss_pred             CCCCeeeEEecchhhhhhhcc
Q 041113          874 SCRGFVEASVAKATHILQNLQ  894 (983)
Q Consensus       874 P~~pGlGv~~d~a~~~~~~~~  894 (983)
                      |++||||+++|  ++.++++.
T Consensus       223 p~~pGlGv~~d--~~~l~~~~  241 (244)
T d2chra1         223 PTGVGHGMTLD--EDKVRQYA  241 (244)
T ss_dssp             CCSSSTTCCBC--HHHHHHHC
T ss_pred             CCCCCCCeEEC--HHHHHHHh
Confidence            99999999999  88888765
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jpma2 d.54.1.1 (A:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2chra2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1nu5a2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1rvka2 d.54.1.1 (A:1-126) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gdqa2 d.54.1.1 (A:4-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wufa2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mnra2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gl5a2 d.54.1.1 (A:1-122) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1muca2 d.54.1.1 (A:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1r0ma2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jdfa2 d.54.1.1 (A:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sjda2 d.54.1.1 (A:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1bqga2 d.54.1.1 (A:12-143) D-glucarate dehydratase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yeya2 d.54.1.1 (A:2-140) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ptza1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2fyma2 d.54.1.1 (A:1-139) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ptza2 d.54.1.1 (A:0-138) Enolase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2al1a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2akza2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1pdza2 d.54.1.1 (A:1-139) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]} Back     information, alignment and structure
>d1kkoa2 d.54.1.1 (A:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1kcza2 d.54.1.1 (A:1-160) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure