Citrus Sinensis ID: 043594
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| 224140139 | 526 | predicted protein [Populus trichocarpa] | 0.918 | 0.150 | 0.670 | 2e-28 | |
| 449448934 | 524 | PREDICTED: pentatricopeptide repeat-cont | 0.860 | 0.141 | 0.671 | 5e-26 | |
| 297741511 | 1400 | unnamed protein product [Vitis vinifera] | 0.883 | 0.054 | 0.657 | 4e-25 | |
| 357508177 | 487 | Pentatricopeptide repeat-containing prot | 0.883 | 0.156 | 0.684 | 9e-25 | |
| 356564808 | 501 | PREDICTED: pentatricopeptide repeat-cont | 0.918 | 0.157 | 0.670 | 1e-24 | |
| 359481497 | 510 | PREDICTED: pentatricopeptide repeat-cont | 0.883 | 0.149 | 0.657 | 1e-24 | |
| 255568478 | 501 | pentatricopeptide repeat-containing prot | 0.837 | 0.143 | 0.597 | 3e-20 | |
| 15228119 | 500 | pentatricopeptide repeat-containing prot | 0.918 | 0.158 | 0.544 | 1e-19 | |
| 297823557 | 500 | pentatricopeptide repeat-containing prot | 0.918 | 0.158 | 0.518 | 3e-18 | |
| 357127969 | 567 | PREDICTED: pentatricopeptide repeat-cont | 0.918 | 0.139 | 0.430 | 3e-12 |
| >gi|224140139|ref|XP_002323442.1| predicted protein [Populus trichocarpa] gi|222868072|gb|EEF05203.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 129 bits (324), Expect = 2e-28, Method: Composition-based stats.
Identities = 53/79 (67%), Positives = 69/79 (87%)
Query: 3 VTSCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMPVRNV 62
V+SC STR++RGG QY CLA+ +GF+AN Y+GSSL++F GKCGE + YK+F++MPVRNV
Sbjct: 135 VSSCASTRDLRGGIQYHCLAISAGFIANAYIGSSLVTFYGKCGELDNAYKVFKEMPVRNV 194
Query: 63 VSWTAIIAAFAQEWEVDMC 81
VSWTAII+ FAQ+W+VDMC
Sbjct: 195 VSWTAIISGFAQDWQVDMC 213
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449448934|ref|XP_004142220.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Cucumis sativus] gi|449502632|ref|XP_004161699.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297741511|emb|CBI32643.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357508177|ref|XP_003624377.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499392|gb|AES80595.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356564808|ref|XP_003550640.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359481497|ref|XP_002273989.2| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255568478|ref|XP_002525213.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535510|gb|EEF37179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15228119|ref|NP_181269.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216847|sp|Q9ZUT4.1|PP192_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g37320 gi|4056486|gb|AAC98052.1| hypothetical protein [Arabidopsis thaliana] gi|37202040|gb|AAQ89635.1| At2g37320 [Arabidopsis thaliana] gi|51969760|dbj|BAD43572.1| hypothetical protein [Arabidopsis thaliana] gi|330254289|gb|AEC09383.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297823557|ref|XP_002879661.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325500|gb|EFH55920.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357127969|ref|XP_003565649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| TAIR|locus:2049736 | 500 | AT2G37320 "AT2G37320" [Arabido | 0.918 | 0.158 | 0.544 | 1.4e-19 | |
| TAIR|locus:2121055 | 559 | AT4G38010 "AT4G38010" [Arabido | 0.848 | 0.130 | 0.445 | 3.1e-11 | |
| TAIR|locus:2149664 | 588 | MEF1 "mitochondrial RNA editin | 0.848 | 0.124 | 0.410 | 1.2e-10 | |
| TAIR|locus:2058812 | 613 | AT2G02750 [Arabidopsis thalian | 0.790 | 0.110 | 0.441 | 1.6e-10 | |
| TAIR|locus:2205425 | 743 | AT1G68930 "AT1G68930" [Arabido | 0.837 | 0.096 | 0.375 | 5.7e-10 | |
| TAIR|locus:2151694 | 550 | AT5G37570 "AT5G37570" [Arabido | 0.860 | 0.134 | 0.378 | 5.9e-10 | |
| TAIR|locus:2054131 | 697 | SLO2 "AT2G13600" [Arabidopsis | 0.837 | 0.103 | 0.361 | 2.3e-09 | |
| TAIR|locus:2011892 | 596 | AT1G50270 "AT1G50270" [Arabido | 0.813 | 0.117 | 0.408 | 3.8e-09 | |
| TAIR|locus:2124603 | 617 | AT4G18520 [Arabidopsis thalian | 0.825 | 0.115 | 0.422 | 4e-09 | |
| TAIR|locus:2040565 | 501 | AT2G36730 [Arabidopsis thalian | 0.906 | 0.155 | 0.346 | 6.1e-09 |
| TAIR|locus:2049736 AT2G37320 "AT2G37320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 240 (89.5 bits), Expect = 1.4e-19, P = 1.4e-19
Identities = 43/79 (54%), Positives = 59/79 (74%)
Query: 3 VTSCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMPVRNV 62
V SCG R+ R G+ + CLA++ GF+++VY+GSSL+ GE + YK+FE+MP RNV
Sbjct: 127 VRSCGLNRDFRTGSGFHCLALKGGFISDVYLGSSLVVLYRDSGEVENAYKVFEEMPERNV 186
Query: 63 VSWTAIIAAFAQEWEVDMC 81
VSWTA+I+ FAQEW VD+C
Sbjct: 187 VSWTAMISGFAQEWRVDIC 205
|
|
| TAIR|locus:2121055 AT4G38010 "AT4G38010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149664 MEF1 "mitochondrial RNA editing factor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058812 AT2G02750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205425 AT1G68930 "AT1G68930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151694 AT5G37570 "AT5G37570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011892 AT1G50270 "AT1G50270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2124603 AT4G18520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040565 AT2G36730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XVI.2589.1 | hypothetical protein (467 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 86 | |||
| PLN03081 | 697 | PLN03081, PLN03081, pentatricopeptide (PPR) repeat | 6e-11 | |
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 1e-10 | |
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 6e-09 | |
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 9e-08 | |
| PLN03081 | 697 | PLN03081, PLN03081, pentatricopeptide (PPR) repeat | 2e-07 | |
| PLN03081 | 697 | PLN03081, PLN03081, pentatricopeptide (PPR) repeat | 2e-06 | |
| PLN03218 | 1060 | PLN03218, PLN03218, maturation of RBCL 1; Provisio | 0.001 | |
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 0.004 |
| >gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
Score = 56.4 bits (136), Expect = 6e-11
Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
Query: 3 VTSCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMPVRNV 62
GS R G Q C +++G V + +V +LI KCG+ D +F+ MP +
Sbjct: 234 SAGLGS---ARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTT 290
Query: 63 VSWTAIIAAFA 73
V+W +++A +A
Sbjct: 291 VAWNSMLAGYA 301
|
Length = 697 |
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.89 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.85 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.85 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.84 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.82 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.81 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.7 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.55 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.51 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.24 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.74 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 98.54 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 98.53 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.5 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.5 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 98.41 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 98.4 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.38 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 98.12 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 97.97 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 97.87 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.82 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.81 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 97.78 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.78 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 97.73 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.71 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 97.67 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.65 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 97.58 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.57 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.57 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.56 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.52 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.21 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.2 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.1 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.09 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.05 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.01 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 97.0 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 96.96 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.95 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 96.84 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 96.84 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 96.82 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.72 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.69 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.67 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.64 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.63 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.59 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 96.59 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.57 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.53 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.52 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.51 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.51 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.43 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 96.37 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.31 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.3 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.26 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.25 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.24 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.18 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.17 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 96.16 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 96.15 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.14 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.13 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.12 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 96.1 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 96.05 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 95.94 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 95.81 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 95.8 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 95.78 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 95.68 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 95.66 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 95.6 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.59 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 95.56 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 95.47 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 95.35 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.33 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 95.31 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.17 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 95.12 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 95.04 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 94.94 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 94.9 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 94.87 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 94.81 | |
| TIGR02508 | 115 | type_III_yscG type III secretion protein, YscG fam | 94.69 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 94.66 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 94.61 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 94.58 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 94.44 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 94.38 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 94.34 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 94.3 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 94.17 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 94.12 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 94.11 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 94.05 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 94.0 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 93.92 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 93.83 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 93.77 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 93.62 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 93.54 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 93.53 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 93.48 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 93.47 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 93.47 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 93.3 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 93.29 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 93.23 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 93.2 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 93.07 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 93.03 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 92.79 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 92.54 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 92.53 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 92.41 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 92.37 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 92.21 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 92.17 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 92.14 | |
| PF09205 | 161 | DUF1955: Domain of unknown function (DUF1955); Int | 92.1 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 92.05 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 91.89 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 91.56 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 91.43 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 91.41 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 91.39 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 91.34 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 91.0 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 90.78 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 90.69 | |
| PF11848 | 48 | DUF3368: Domain of unknown function (DUF3368); Int | 90.28 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 90.04 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 89.97 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 89.81 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 89.78 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 89.57 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 89.51 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 89.02 | |
| PF13170 | 297 | DUF4003: Protein of unknown function (DUF4003) | 88.61 | |
| KOG2280 | 829 | consensus Vacuolar assembly/sorting protein VPS16 | 88.53 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 88.27 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 88.16 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 87.99 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 87.96 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 87.87 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 87.52 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 87.28 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 87.14 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 87.01 | |
| PF09477 | 116 | Type_III_YscG: Bacterial type II secretion system | 86.86 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 86.23 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 86.21 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 85.93 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 85.87 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 85.69 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 85.6 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 85.49 | |
| KOG4570 | 418 | consensus Uncharacterized conserved protein [Funct | 85.24 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 84.74 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 84.73 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 84.68 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 84.1 | |
| PF10366 | 108 | Vps39_1: Vacuolar sorting protein 39 domain 1; Int | 83.67 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 83.66 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 83.62 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 83.51 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 83.08 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 82.91 | |
| PF10366 | 108 | Vps39_1: Vacuolar sorting protein 39 domain 1; Int | 82.44 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 82.38 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 82.12 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 82.03 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 81.79 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 81.06 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 81.05 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 81.05 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 80.72 | |
| PF13929 | 292 | mRNA_stabil: mRNA stabilisation | 80.37 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 80.13 |
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.2e-23 Score=145.25 Aligned_cols=86 Identities=20% Similarity=0.397 Sum_probs=83.0
Q ss_pred ChhcchhcCCchhHHHHHHHHHHHHcCCchHHHHHHHHHHHHhcCChHHHHHhhcCCCCCChhhHHHHHHHHhhcCChhH
Q 043594 1 MPVTSCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMPVRNVVSWTAIIAAFAQEWEVDM 80 (86)
Q Consensus 1 ~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~~~~~t~~~li~~~~~~g~~~~ 80 (86)
++|++|++.|.+++|+++|++|.+.|+.||..++|+||++|+++|++++|.++|++|.+||++|||+||.+|++.|+.++
T Consensus 330 ~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~ 409 (697)
T PLN03081 330 IMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTK 409 (697)
T ss_pred HHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHH
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhccC
Q 043594 81 CYTFIV 86 (86)
Q Consensus 81 a~~~f~ 86 (86)
|+++|+
T Consensus 410 A~~lf~ 415 (697)
T PLN03081 410 AVEMFE 415 (697)
T ss_pred HHHHHH
Confidence 999884
|
|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02508 type_III_yscG type III secretion protein, YscG family | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13170 DUF4003: Protein of unknown function (DUF4003) | Back alignment and domain information |
|---|
| >KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4570 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF13929 mRNA_stabil: mRNA stabilisation | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.87 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.85 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.85 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.67 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.16 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.11 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.44 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.44 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.41 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.41 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.38 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.33 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.3 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.25 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.18 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.16 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.15 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.13 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.08 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.08 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.06 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.06 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.06 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.06 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.04 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.03 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.03 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.03 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.01 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.99 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.99 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.99 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.97 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.96 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.96 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.96 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.95 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.95 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.95 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.95 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.94 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.93 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.91 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.91 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.89 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.8 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.8 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.78 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.78 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.76 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.74 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.74 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.73 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.73 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.72 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.7 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.67 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.65 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.65 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.64 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.63 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.61 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.6 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.59 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.57 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.57 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.56 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.55 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.53 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.53 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.52 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.51 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.51 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.49 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.49 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.47 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.46 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.45 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.42 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.38 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.37 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.34 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.33 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.32 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.31 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.28 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.27 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.27 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.23 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.2 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.2 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.14 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.12 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.11 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.09 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.08 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.07 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.03 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.02 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.0 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.99 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.93 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.92 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.9 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.9 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.89 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.87 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 96.86 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.85 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.85 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.83 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.75 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.73 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 96.72 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.7 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.66 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.62 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.62 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.62 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.61 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.6 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.6 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.59 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.54 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.52 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.51 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.48 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.47 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 96.46 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 96.45 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.43 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.38 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.31 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.3 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.29 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.29 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.28 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 96.22 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.2 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.2 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.16 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.15 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.09 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.07 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.05 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.03 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.0 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.96 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.93 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 95.92 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.91 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.9 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 95.89 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.87 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.85 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.82 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.81 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 95.76 | |
| 2p58_C | 116 | Putative type III secretion protein YSCG; type III | 95.73 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.68 | |
| 2uwj_G | 115 | Type III export protein PSCG; virulence, chaperone | 95.64 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.63 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.52 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.49 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 95.44 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.36 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 95.32 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 95.3 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 95.13 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.13 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 94.89 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 94.81 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 94.81 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 94.74 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.73 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.6 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.52 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 94.46 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 94.45 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 94.45 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.31 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 94.21 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 94.06 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.01 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 93.86 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 93.83 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 93.8 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.65 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 93.37 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 93.15 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 93.1 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 93.09 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 92.67 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 92.16 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 91.81 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 91.7 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 91.55 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 91.46 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 91.27 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 90.84 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 90.32 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 90.24 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 90.12 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 89.89 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 89.88 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 89.8 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 88.89 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 88.8 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 88.76 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 88.45 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 87.88 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 86.66 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 86.44 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 86.06 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 85.29 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 83.07 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 81.22 |
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
Probab=99.87 E-value=7.5e-23 Score=137.64 Aligned_cols=86 Identities=9% Similarity=-0.010 Sum_probs=81.2
Q ss_pred ChhcchhcCCchhHHHHHHHHHHHHcCCchHHHHHHHHHHHHhcCChHHHHHhhcCCC----CCChhhHHHHHHHHhhcC
Q 043594 1 MPVTSCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMP----VRNVVSWTAIIAAFAQEW 76 (86)
Q Consensus 1 ~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~----~~~~~t~~~li~~~~~~g 76 (86)
+||++|++.|++++|.++|++|.+.|+.||..+||+||.+|++.|++++|.++|++|. .||..|||+||.+|++.|
T Consensus 110 ~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g 189 (501)
T 4g26_A 110 NGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTK 189 (501)
T ss_dssp HHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTT
T ss_pred HHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCC
Confidence 4789999999999999999999999999999999999999999999999999999996 589999999999999999
Q ss_pred ChhHhhhccC
Q 043594 77 EVDMCYTFIV 86 (86)
Q Consensus 77 ~~~~a~~~f~ 86 (86)
++++|.++|+
T Consensus 190 ~~d~A~~ll~ 199 (501)
T 4g26_A 190 NADKVYKTLQ 199 (501)
T ss_dssp CHHHHHHHHH
T ss_pred CHHHHHHHHH
Confidence 9999998873
|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.18 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.04 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.89 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.86 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.74 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.64 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.61 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.59 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.53 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.4 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.27 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.19 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.08 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.94 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.94 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.79 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.7 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.46 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.37 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.31 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 96.28 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.92 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.85 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 95.84 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.69 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.59 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.41 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.35 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.67 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.52 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 94.4 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 94.37 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.95 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 93.92 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 93.78 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 93.77 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 93.68 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 92.78 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 92.52 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 92.42 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 91.64 | |
| d1wy6a1 | 161 | Hypothetical protein ST1625 {Archaeon Sulfolobus t | 91.4 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 91.32 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 90.69 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 87.25 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 86.99 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 82.78 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 82.35 |
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.18 E-value=4.3e-06 Score=47.41 Aligned_cols=80 Identities=6% Similarity=-0.171 Sum_probs=69.7
Q ss_pred chhcCCchhHHHHHHHHHHHHcCCchHHHHHHHHHHHHhcCChHHHHHhhcCCCC--C-ChhhHHHHHHHHhhcCChhHh
Q 043594 5 SCGSTRNIRGGTQYQCLAVRSGFVANVYVGSSLISFCGKCGENIDVYKMFEKMPV--R-NVVSWTAIIAAFAQEWEVDMC 81 (86)
Q Consensus 5 ~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~--~-~~~t~~~li~~~~~~g~~~~a 81 (86)
.+.+.|++++|.+.|...++.. +.++..|+.+-.+|.+.|++++|...|++..+ | +..+|..+-..|.+.|++++|
T Consensus 13 ~~~~~g~~~~Ai~~~~kal~~~-p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~~~~a~~~lg~~~~~l~~~~~A 91 (201)
T d2c2la1 13 RLFVGRKYPEAAACYGRAITRN-PLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEA 91 (201)
T ss_dssp HHHHTTCHHHHHHHHHHHHHHC-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHHTTCHHHH
T ss_pred HHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCCcHHHHHHHHHHHHHCCCHHHH
Confidence 4567899999999999998875 45677899999999999999999999998764 5 567899999999999999999
Q ss_pred hhcc
Q 043594 82 YTFI 85 (86)
Q Consensus 82 ~~~f 85 (86)
+..|
T Consensus 92 ~~~~ 95 (201)
T d2c2la1 92 IANL 95 (201)
T ss_dssp HHHH
T ss_pred HHHH
Confidence 8766
|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|