Citrus Sinensis ID: 043830

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
cHHHHHHHHHcccccccEEEccccccccccccccccccHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccEEEEcccccccccccEEEEccHHHHHHHHHHccEEEEccccccccccccHHHHHHHcccEEEccccccHHHHHHHHHHcccccEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHccccHccEEEEEEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHEEEccccccccccccccHHHHccccEEEccccccHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHccc
STLQAIRFQLleaspftinfsgdlkyvheydesegdigsIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMqknpnlvtiivprhpqhgKEIAQKLQKEGEVVALRSRHeklmprtnvyVVDTLGELRQlykltpiaviggsflpglaghniSEAAAAGCavltgphighySNMVSAMqrlnpksvlqvsGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
STLQAIRFQlleaspftinfsGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALrsrheklmprtnvyVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
****AIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRH****************VVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAM***********************LFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRA**
STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
S*LQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNFHVFRRA*C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGxxxxxxxxxxxxxxxxxxxxxQMAAKQAFCALSSGIVANVWNLLNFHVFRRALC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q8VZA5447 Probable 3-deoxy-D-manno- yes no 0.983 0.545 0.626 2e-86
P0AC75425 3-deoxy-D-manno-octuloson N/A no 0.770 0.449 0.336 1e-23
P0AC76425 3-deoxy-D-manno-octuloson yes no 0.770 0.449 0.336 1e-23
P0AC77425 3-deoxy-D-manno-octuloson N/A no 0.770 0.449 0.336 1e-23
P44806427 3-deoxy-D-manno-octuloson yes no 0.745 0.433 0.328 1e-20
Q4UND5464 3-deoxy-D-manno-octuloson yes no 0.673 0.359 0.286 3e-15
Q92JE9464 3-deoxy-D-manno-octuloson yes no 0.657 0.351 0.269 9e-14
Q1RGU8418 3-deoxy-D-manno-octuloson yes no 0.685 0.406 0.278 1e-13
Q68XV7462 3-deoxy-D-manno-octuloson yes no 0.693 0.372 0.255 3e-13
O66663353 3-deoxy-D-manno-octuloson yes no 0.673 0.473 0.262 9e-13
>sp|Q8VZA5|KDTA_ARATH Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana GN=KDTA PE=2 SV=1 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 154/246 (62%), Positives = 195/246 (79%), Gaps = 2/246 (0%)

Query: 1   STLQAIRFQLLEASPFTINFSGDLKYV-HEYDESEGDIGSIEDLKASLAHRQVWMASSIH 59
           STLQ IRFQLL A PF IN+SGDLKYV +++  S G   SI DLK  LA  +VW+ASS+H
Sbjct: 192 STLQGIRFQLLHAPPFVINYSGDLKYVVNKFHVSSGTSESIRDLKVELAEMKVWIASSLH 251

Query: 60  RGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPR- 118
           RGEE+V+L VH +L++ +P+ V IIVPRHP HG++IA KL+K+G+ VALRS++EKL PR 
Sbjct: 252 RGEEEVILGVHNMLLESHPDSVVIIVPRHPHHGQQIAHKLRKDGQSVALRSQNEKLTPRK 311

Query: 119 TNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMV 178
           TN+YVVDTLGELR+LY + PIAVIGGSF+PGL GHN+SEAAAAGCAV+TG H+GH+S+MV
Sbjct: 312 TNIYVVDTLGELRELYSVAPIAVIGGSFIPGLTGHNLSEAAAAGCAVITGCHVGHFSHMV 371

Query: 179 SAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLL 238
            AMQ+ NP SV QVS K EL+EA+  L S+  +LE  Q A+K  + +LSS I+ N+W LL
Sbjct: 372 KAMQQANPLSVTQVSTKLELKEAVDLLLSNPEILETHQRASKDVYESLSSCIITNIWKLL 431

Query: 239 NFHVFR 244
           N H+FR
Sbjct: 432 NLHIFR 437
Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Catalyzes the transfer of two 3-deoxy-D-manno-octulosonate (Kdo) residues from CMP-Kdo to lipid IV(A), the tetraacyldisaccharide-1,4'-bisphosphate precursor of lipid A. Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 3
>sp|P0AC75|KDTA_ECOLI 3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) GN=waaA PE=1 SV=1 Back     alignment and function description
>sp|P0AC76|KDTA_ECOL6 3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|P0AC77|KDTA_ECO57 3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|P44806|KDTA_HAEIN 3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=waaA PE=1 SV=1 Back     alignment and function description
>sp|Q4UND5|KDTA_RICFE 3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|Q92JE9|KDTA_RICCN 3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|Q1RGU8|KDTA_RICBR 3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|Q68XV7|KDTA_RICTY 3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=waaA PE=3 SV=1 Back     alignment and function description
>sp|O66663|KDTA_AQUAE 3-deoxy-D-manno-octulosonic acid transferase OS=Aquifex aeolicus (strain VF5) GN=kdtA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
224138782 446 predicted protein [Populus trichocarpa] 1.0 0.556 0.721 1e-102
225441034 441 PREDICTED: 3-deoxy-D-manno-octulosonic-a 0.995 0.560 0.730 1e-98
255575481 446 3-deoxy-d-manno-octulosonic-acid transfe 0.979 0.544 0.687 3e-95
357440223 510 3-deoxy-D-manno-octulosonic-acid transfe 0.987 0.480 0.670 2e-94
356533455 449 PREDICTED: 3-deoxy-D-manno-octulosonic-a 0.987 0.545 0.666 3e-89
449451094 442 PREDICTED: 3-deoxy-D-manno-octulosonic a 0.995 0.558 0.657 1e-85
22326592 447 3-deoxy-D-manno-octulosonic-acid transfe 0.983 0.545 0.626 1e-84
297806347 439 hypothetical protein ARALYDRAFT_325028 [ 0.983 0.555 0.621 3e-84
140052430 470 Three-deoxy-D-manno-octulosonic-acid tra 0.899 0.474 0.665 3e-83
7340662 481 3-deoxy-D-manno-octulosonic acid transfe 0.955 0.492 0.611 1e-79
>gi|224138782|ref|XP_002322900.1| predicted protein [Populus trichocarpa] gi|222867530|gb|EEF04661.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 214/248 (86%)

Query: 1   STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHR 60
           S++QAI FQLL+A PF INF+GDLKYV EYD S+ +  SI+DLK  L HR+VWMASSIHR
Sbjct: 196 SSMQAIHFQLLQAPPFIINFAGDLKYVVEYDASKEEFRSIDDLKVQLGHRKVWMASSIHR 255

Query: 61  GEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTN 120
           GEE+VML VHKVL Q  P+LVTIIVPR+PQHGK+IAQKLQKEG+ VALRS+H++++P  N
Sbjct: 256 GEEEVMLGVHKVLKQVYPDLVTIIVPRYPQHGKDIAQKLQKEGQHVALRSQHQRIVPGRN 315

Query: 121 VYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMVSA 180
           +YVVDTLGELR LY+LTPIAVIGGSF PGLAGHNISEAAAAGCAVLTG H+GH+S+M+  
Sbjct: 316 IYVVDTLGELRHLYRLTPIAVIGGSFFPGLAGHNISEAAAAGCAVLTGYHVGHFSHMLRE 375

Query: 181 MQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLNF 240
           MQRLNP SVLQV+GK ELEEA+ + FSD +VLEA+Q A+KQAF ALS+GI+AN WN+L F
Sbjct: 376 MQRLNPLSVLQVAGKLELEEAILKFFSDGKVLEARQTASKQAFHALSNGIIANAWNVLYF 435

Query: 241 HVFRRALC 248
           HV ++AL 
Sbjct: 436 HVLKQALL 443

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441034|ref|XP_002277784.1| PREDICTED: 3-deoxy-D-manno-octulosonic-acid transferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575481|ref|XP_002528642.1| 3-deoxy-d-manno-octulosonic-acid transferase, putative [Ricinus communis] gi|223531931|gb|EEF33745.1| 3-deoxy-d-manno-octulosonic-acid transferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357440223|ref|XP_003590389.1| 3-deoxy-D-manno-octulosonic-acid transferase [Medicago truncatula] gi|355479437|gb|AES60640.1| 3-deoxy-D-manno-octulosonic-acid transferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356533455|ref|XP_003535279.1| PREDICTED: 3-deoxy-D-manno-octulosonic-acid transferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449451094|ref|XP_004143297.1| PREDICTED: 3-deoxy-D-manno-octulosonic acid transferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22326592|ref|NP_195997.2| 3-deoxy-D-manno-octulosonic-acid transferase [Arabidopsis thaliana] gi|17473669|gb|AAL38291.1| 3-deoxy-D-manno-octulosonic acid transferase-like protein [Arabidopsis thaliana] gi|22136160|gb|AAM91158.1| 3-deoxy-D-manno-octulosonic acid transferase-like protein [Arabidopsis thaliana] gi|332003269|gb|AED90652.1| 3-deoxy-D-manno-octulosonic-acid transferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806347|ref|XP_002871057.1| hypothetical protein ARALYDRAFT_325028 [Arabidopsis lyrata subsp. lyrata] gi|297316894|gb|EFH47316.1| hypothetical protein ARALYDRAFT_325028 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|140052430|gb|ABE80128.2| Three-deoxy-D-manno-octulosonic-acid transferase, N-terminal [Medicago truncatula] Back     alignment and taxonomy information
>gi|7340662|emb|CAB82942.1| 3-deoxy-D-manno-octulosonic acid transferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2144643447 KDTA "KDO transferase A" [Arab 0.983 0.545 0.626 9.7e-80
TIGR_CMR|SPO_2800432 SPO_2800 "3-deoxy-D-manno-octu 0.774 0.444 0.317 1.6e-25
UNIPROTKB|P0AC75425 waaA [Escherichia coli K-12 (t 0.798 0.465 0.338 1.2e-24
UNIPROTKB|Q9KVB3439 VC_0233 "3-deoxy-D-manno-octul 0.919 0.519 0.295 8.7e-23
TIGR_CMR|VC_0233439 VC_0233 "3-deoxy-D-manno-octul 0.919 0.519 0.295 8.7e-23
TIGR_CMR|CBU_0063435 CBU_0063 "3-deoxy-D-manno-octu 0.883 0.503 0.284 3.2e-19
UNIPROTKB|Q74AU1434 kdtA "CMP-3-deoxy-D-manno-octu 0.608 0.347 0.352 4.1e-19
TIGR_CMR|GSU_2259434 GSU_2259 "3-deoxy-D-manno-octu 0.608 0.347 0.352 4.1e-19
TIGR_CMR|CPS_0118451 CPS_0118 "3-deoxy-D-manno-octu 0.790 0.434 0.264 2.2e-18
TIGR_CMR|SO_4676424 SO_4676 "3-deoxy-D-manno-octul 0.685 0.400 0.359 2.9e-18
TAIR|locus:2144643 KDTA "KDO transferase A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 801 (287.0 bits), Expect = 9.7e-80, P = 9.7e-80
 Identities = 154/246 (62%), Positives = 195/246 (79%)

Query:     1 STLQAIRFQLLEASPFTINFSGDLKYV-HEYDESEGDIGSIEDLKASLAHRQVWMASSIH 59
             STLQ IRFQLL A PF IN+SGDLKYV +++  S G   SI DLK  LA  +VW+ASS+H
Sbjct:   192 STLQGIRFQLLHAPPFVINYSGDLKYVVNKFHVSSGTSESIRDLKVELAEMKVWIASSLH 251

Query:    60 RGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPR- 118
             RGEE+V+L VH +L++ +P+ V IIVPRHP HG++IA KL+K+G+ VALRS++EKL PR 
Sbjct:   252 RGEEEVILGVHNMLLESHPDSVVIIVPRHPHHGQQIAHKLRKDGQSVALRSQNEKLTPRK 311

Query:   119 TNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNMV 178
             TN+YVVDTLGELR+LY + PIAVIGGSF+PGL GHN+SEAAAAGCAV+TG H+GH+S+MV
Sbjct:   312 TNIYVVDTLGELRELYSVAPIAVIGGSFIPGLTGHNLSEAAAAGCAVITGCHVGHFSHMV 371

Query:   179 SAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLL 238
              AMQ+ NP SV QVS K EL+EA+  L S+  +LE  Q A+K  + +LSS I+ N+W LL
Sbjct:   372 KAMQQANPLSVTQVSTKLELKEAVDLLLSNPEILETHQRASKDVYESLSSCIITNIWKLL 431

Query:   239 NFHVFR 244
             N H+FR
Sbjct:   432 NLHIFR 437
GO:0005886 "plasma membrane" evidence=ISM
GO:0009058 "biosynthetic process" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
TIGR_CMR|SPO_2800 SPO_2800 "3-deoxy-D-manno-octulosonic acid transferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P0AC75 waaA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVB3 VC_0233 "3-deoxy-D-manno-octulosonic-acid transferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0233 VC_0233 "3-deoxy-D-manno-octulosonic-acid transferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0063 CBU_0063 "3-deoxy-D-manno-octulosonic-acid transferase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AU1 kdtA "CMP-3-deoxy-D-manno-octulosonate--lipid A tetraacyldisaccharide 3-deoxy-D-manno-octulosonate transferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2259 GSU_2259 "3-deoxy-D-manno-octulosonic-acid transferase, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0118 CPS_0118 "3-deoxy-D-manno-octulosonic-acid transferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4676 SO_4676 "3-deoxy-D-manno-octulosonic-acid (KDO) transferase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00160899
hypothetical protein (446 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VI0968
hypothetical protein (365 aa)
• •   • 0.911
gw1.IV.2364.1
hypothetical protein (234 aa)
• •   • 0.898
gw1.XIII.2878.1
hypothetical protein (392 aa)
• •  •• 0.892
eugene3.01070060
CMP-KDO synthetase (288 aa)
• •  •• 0.889
fgenesh4_pg.C_LG_XI000980
CMP-KDO synthetase (293 aa)
• •  •• 0.885
gw1.X.6418.1
hypothetical protein (277 aa)
• •   • 0.885
estExt_fgenesh4_pg.C_LG_II0575
SubName- Full=Putative uncharacterized protein; (291 aa)
• •   • 0.818
estExt_fgenesh4_pg.C_LG_V1151
3-deoxy-D-manno-oct-2-ulosonate-8-phosphate synthase (EC-2.5.1.55) (290 aa)
• •   • 0.817
estExt_Genewise1_v1.C_LG_V1283
hypothetical protein (341 aa)
• •   • 0.791
estExt_fgenesh4_pg.C_LG_II0344
SubName- Full=Putative uncharacterized protein; (341 aa)
• •   • 0.784

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
COG1519419 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid tr 6e-52
PRK05749425 PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-ac 5e-50
>gnl|CDD|224436 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  173 bits (441), Expect = 6e-52
 Identities = 83/246 (33%), Positives = 125/246 (50%), Gaps = 15/246 (6%)

Query: 1   STLQAIRFQLLEASPFTINFSGDLKY---VHEYDESEGDIGSIEDLKASLAHRQVWMASS 57
           S   A RF+ L A P  +  +G+LK+         +E      + L     HR VW+A+S
Sbjct: 185 SEEDAQRFRSLGAKPVVV--TGNLKFDIEPPPQLAAELAALRRQ-LGG---HRPVWVAAS 238

Query: 58  IHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMP 117
            H GEE+++L  H+ L ++ PNL+ I+VPRHP+  K +   L+++G  V  RS+ +    
Sbjct: 239 THEGEEEIILDAHQALKKQFPNLLLILVPRHPERFKAVENLLKRKGLSVTRRSQGDPPFS 298

Query: 118 RTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGHYSNM 177
            T+V + DT+GEL  LY +  IA +GGS +P + GHN  E AA G  V+ GP+     N 
Sbjct: 299 DTDVLLGDTMGELGLLYGIADIAFVGGSLVP-IGGHNPLEPAAFGTPVIFGPYT---FNF 354

Query: 178 VSAMQRL-NPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWN 236
               +RL    + LQV     L +A+  L +D    EA   A    F A + G +A    
Sbjct: 355 SDIAERLLQAGAGLQVEDADLLAKAVELLLADEDKREAYGRAGL-EFLAQNRGALARTLE 413

Query: 237 LLNFHV 242
            L  ++
Sbjct: 414 ALKPYL 419

Length = 419
>gnl|CDD|235589 PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 100.0
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 100.0
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.95
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.95
PRK10307412 putative glycosyl transferase; Provisional 99.94
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.94
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.94
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.94
cd03813475 GT1_like_3 This family is most closely related to 99.94
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.93
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.93
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.93
cd04962371 GT1_like_5 This family is most closely related to 99.93
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.92
cd03796398 GT1_PIG-A_like This family is most closely related 99.92
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.92
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.92
cd04951360 GT1_WbdM_like This family is most closely related 99.92
cd03807365 GT1_WbnK_like This family is most closely related 99.92
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.92
cd03816415 GT1_ALG1_like This family is most closely related 99.92
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.91
PLN02949463 transferase, transferring glycosyl groups 99.91
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.91
PRK14099485 glycogen synthase; Provisional 99.9
cd03819355 GT1_WavL_like This family is most closely related 99.9
PRK00654466 glgA glycogen synthase; Provisional 99.9
cd03818396 GT1_ExpC_like This family is most closely related 99.9
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.9
cd03812358 GT1_CapH_like This family is most closely related 99.9
cd03820348 GT1_amsD_like This family is most closely related 99.9
PLN02939977 transferase, transferring glycosyl groups 99.89
PHA01630331 putative group 1 glycosyl transferase 99.89
PLN023161036 synthase/transferase 99.89
cd04949372 GT1_gtfA_like This family is most closely related 99.89
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.89
cd04946407 GT1_AmsK_like This family is most closely related 99.88
cd03822366 GT1_ecORF704_like This family is most closely rela 99.88
PLN02605382 monogalactosyldiacylglycerol synthase 99.88
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.88
cd03805392 GT1_ALG2_like This family is most closely related 99.88
PRK14098489 glycogen synthase; Provisional 99.88
cd03809365 GT1_mtfB_like This family is most closely related 99.87
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 99.87
cd03825365 GT1_wcfI_like This family is most closely related 99.87
PHA01633335 putative glycosyl transferase group 1 99.87
PLN00142815 sucrose synthase 99.87
cd03821375 GT1_Bme6_like This family is most closely related 99.86
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.86
cd03823359 GT1_ExpE7_like This family is most closely related 99.86
cd03814364 GT1_like_2 This family is most closely related to 99.86
cd03808359 GT1_cap1E_like This family is most closely related 99.86
cd03817374 GT1_UGDG_like This family is most closely related 99.86
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.86
cd03801374 GT1_YqgM_like This family is most closely related 99.86
cd03806419 GT1_ALG11_like This family is most closely related 99.85
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.85
cd03795357 GT1_like_4 This family is most closely related to 99.85
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.84
cd03798377 GT1_wlbH_like This family is most closely related 99.84
cd03811353 GT1_WabH_like This family is most closely related 99.84
cd03794394 GT1_wbuB_like This family is most closely related 99.84
PLN02846462 digalactosyldiacylglycerol synthase 99.83
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 99.83
cd04955363 GT1_like_6 This family is most closely related to 99.83
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 99.82
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.82
PRK10125405 putative glycosyl transferase; Provisional 99.81
PLN02501794 digalactosyldiacylglycerol synthase 99.81
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 99.8
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 99.8
PLN02275371 transferase, transferring glycosyl groups 99.8
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 99.8
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 99.76
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.76
cd03804351 GT1_wbaZ_like This family is most closely related 99.75
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.75
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.72
cd03802335 GT1_AviGT4_like This family is most closely relate 99.7
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 99.69
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 99.68
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.68
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 99.65
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 99.62
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 99.51
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 99.51
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 99.51
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 99.5
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.44
TIGR03492396 conserved hypothetical protein. This protein famil 99.42
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 99.39
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.38
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 99.25
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 99.25
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 99.24
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 99.24
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 99.15
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 99.14
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 99.13
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 99.05
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 99.03
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 99.0
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 98.96
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.96
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 98.91
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 98.82
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 98.76
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 98.76
PRK10117474 trehalose-6-phosphate synthase; Provisional 98.62
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 98.54
PF04464369 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate 98.48
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 98.43
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 98.33
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 98.29
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.25
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 98.24
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 98.22
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 98.16
PRK14089347 ipid-A-disaccharide synthase; Provisional 98.08
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 97.92
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 97.9
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 97.87
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 97.83
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 97.76
PLN00164480 glucosyltransferase; Provisional 97.63
PRK10017426 colanic acid biosynthesis protein; Provisional 97.58
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 97.55
TIGR00661321 MJ1255 conserved hypothetical protein. This model 97.54
PLN02764453 glycosyltransferase family protein 97.52
PLN02448459 UDP-glycosyltransferase family protein 97.52
PLN02670472 transferase, transferring glycosyl groups 97.39
PLN02562448 UDP-glycosyltransferase 97.37
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 97.35
PLN03007482 UDP-glucosyltransferase family protein 97.22
COG4370412 Uncharacterized protein conserved in bacteria [Fun 97.21
PLN00414446 glycosyltransferase family protein 97.19
PLN02208442 glycosyltransferase family protein 97.19
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.11
PLN02210456 UDP-glucosyl transferase 97.07
COG4641373 Uncharacterized protein conserved in bacteria [Fun 97.06
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.04
PLN02173449 UDP-glucosyl transferase family protein 96.96
PLN02992481 coniferyl-alcohol glucosyltransferase 96.95
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 96.9
PLN03004451 UDP-glycosyltransferase 96.88
COG1887388 TagB Putative glycosyl/glycerophosphate transferas 96.88
PLN02167475 UDP-glycosyltransferase family protein 96.77
PLN02152455 indole-3-acetate beta-glucosyltransferase 96.68
PLN02554481 UDP-glycosyltransferase family protein 96.57
COG4671400 Predicted glycosyl transferase [General function p 96.48
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 96.48
PLN02207468 UDP-glycosyltransferase 96.33
PLN02555480 limonoid glucosyltransferase 96.22
KOG4626966 consensus O-linked N-acetylglucosamine transferase 96.09
PLN02534491 UDP-glycosyltransferase 95.57
PLN03015470 UDP-glucosyl transferase 95.42
KOG3349170 consensus Predicted glycosyltransferase [General f 95.34
PF1008797 DUF2325: Uncharacterized protein conserved in bact 94.97
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 94.78
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 94.38
COG1817346 Uncharacterized protein conserved in archaea [Func 93.52
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase Cs 93.33
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 92.18
KOG2884259 consensus 26S proteasome regulatory complex, subun 91.98
KOG3742692 consensus Glycogen synthase [Carbohydrate transpor 91.58
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 91.01
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 88.92
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 88.32
PF1068671 DUF2493: Protein of unknown function (DUF2493); In 87.51
COG1618179 Predicted nucleotide kinase [Nucleotide transport 87.49
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 87.4
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 86.91
PF15024559 Glyco_transf_18: Glycosyltransferase family 18 86.13
PF04230286 PS_pyruv_trans: Polysaccharide pyruvyl transferase 84.43
TIGR02193319 heptsyl_trn_I lipopolysaccharide heptosyltransfera 84.1
PF03016302 Exostosin: Exostosin family; InterPro: IPR004263 H 83.79
COG2204 464 AtoC Response regulator containing CheY-like recei 83.54
TIGR01012196 Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archa 82.87
PF00072112 Response_reg: Response regulator receiver domain; 81.84
smart00672256 CAP10 Putative lipopolysaccharide-modifying enzyme 81.79
PTZ00254249 40S ribosomal protein SA; Provisional 81.14
TIGR02195334 heptsyl_trn_II lipopolysaccharide heptosyltransfer 81.12
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 80.91
PF09949100 DUF2183: Uncharacterized conserved protein (DUF218 80.9
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 80.49
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 80.35
TIGR00725159 conserved hypothetical protein, DprA/Smf-related, 80.08
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-39  Score=277.96  Aligned_cols=234  Identities=34%  Similarity=0.517  Sum_probs=213.8

Q ss_pred             CHHHHHHHHHcCCCCCCeEEcCCcccccccCCCCCCcccHHHHHHhcCC-CeEEEEeCCCcchHHHHHHHHHHHHHhCCC
Q 043830            1 STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAH-RQVWMASSIHRGEEKVMLAVHKVLMQKNPN   79 (248)
Q Consensus         1 s~~~~~~l~~~gv~~~kI~v~gn~~~d~~~~~~~~~~~~~~~~r~~~~~-~~v~l~~~~~~~~~~~ll~a~~~l~~~~~~   79 (248)
                      |+..++++.++|+++  |.++||.+||...++  .+......+|..++. +++|+++|+|+++.+.++++++.+++++||
T Consensus       185 se~D~~Rf~~LGa~~--v~v~GNlKfd~~~~~--~~~~~~~~~r~~l~~~r~v~iaaSTH~GEeei~l~~~~~l~~~~~~  260 (419)
T COG1519         185 SEEDAQRFRSLGAKP--VVVTGNLKFDIEPPP--QLAAELAALRRQLGGHRPVWVAASTHEGEEEIILDAHQALKKQFPN  260 (419)
T ss_pred             CHHHHHHHHhcCCcc--eEEecceeecCCCCh--hhHHHHHHHHHhcCCCCceEEEecCCCchHHHHHHHHHHHHhhCCC
Confidence            678899999999987  999999999987643  244556778888875 999999999999989999999999999999


Q ss_pred             eEEEEecCCCCCHHHHHHHHHhcCCceEEecccCCCCCCccEEEEcChhHHHHHHhhCCEEEEcCccCCCCCCCCHHHHH
Q 043830           80 LVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAA  159 (248)
Q Consensus        80 ~~lvivG~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~l~~~y~~ad~~~v~~s~~e~~gg~~~lEA~  159 (248)
                      ..+++||+||++.+.+++++++.|++...++.+..+..+++|++.|++|+|..+|..||++|||+|+.+ .||||++||+
T Consensus       261 ~llIlVPRHpERf~~v~~l~~~~gl~~~~rS~~~~~~~~tdV~l~DtmGEL~l~y~~adiAFVGGSlv~-~GGHN~LEpa  339 (419)
T COG1519         261 LLLILVPRHPERFKAVENLLKRKGLSVTRRSQGDPPFSDTDVLLGDTMGELGLLYGIADIAFVGGSLVP-IGGHNPLEPA  339 (419)
T ss_pred             ceEEEecCChhhHHHHHHHHHHcCCeEEeecCCCCCCCCCcEEEEecHhHHHHHHhhccEEEECCcccC-CCCCChhhHH
Confidence            999999999999999999999999999999998777778899999999999999999999999999997 5899999999


Q ss_pred             hhCCcEEECCCCCChHHHHHHHHhcCCceEEEcCCHHHHHHHHHHhhhCHHHHHHHHHHHHHHHHHhchhHHHHHHHHHH
Q 043830          160 AAGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNLLN  239 (248)
Q Consensus       160 a~G~Pvi~~~~~~~~~~~~~~~~~~g~g~~~~~~~~~~l~~~i~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  239 (248)
                      ++|+|||.|+.+.|+.++++.+..+|  .++.++|.+.|++.+..+++|++.+++|++++...+.+ ..++.+++++.++
T Consensus       340 ~~~~pvi~Gp~~~Nf~ei~~~l~~~g--a~~~v~~~~~l~~~v~~l~~~~~~r~~~~~~~~~~v~~-~~gal~r~l~~l~  416 (419)
T COG1519         340 AFGTPVIFGPYTFNFSDIAERLLQAG--AGLQVEDADLLAKAVELLLADEDKREAYGRAGLEFLAQ-NRGALARTLEALK  416 (419)
T ss_pred             HcCCCEEeCCccccHHHHHHHHHhcC--CeEEECCHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHH-hhHHHHHHHHHhh
Confidence            99999999999999999999998877  67888899999999999999999999999999999876 6779999999998


Q ss_pred             HHh
Q 043830          240 FHV  242 (248)
Q Consensus       240 ~~~  242 (248)
                      +++
T Consensus       417 ~~~  419 (419)
T COG1519         417 PYL  419 (419)
T ss_pred             hcC
Confidence            764

>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>KOG3349 consensus Predicted glycosyltransferase [General function prediction only] Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3742 consensus Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>PF15024 Glyco_transf_18: Glycosyltransferase family 18 Back     alignment and domain information
>PF04230 PS_pyruv_trans: Polysaccharide pyruvyl transferase; InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis Back     alignment and domain information
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I Back     alignment and domain information
>PF03016 Exostosin: Exostosin family; InterPro: IPR004263 Hereditary multiple exostoses (EXT) is an autosomal dominant disorder that is characterised by the appearance of multiple outgrowths of the long bones (exostoses) at their epiphyses [] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01012 Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archaeal) Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>smart00672 CAP10 Putative lipopolysaccharide-modifying enzyme Back     alignment and domain information
>PTZ00254 40S ribosomal protein SA; Provisional Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>TIGR00725 conserved hypothetical protein, DprA/Smf-related, family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2xci_A374 Membrane-Embedded Monofunctional Glycosyltransferas 7e-14
>pdb|2XCI|A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form Length = 374 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 91/175 (52%), Gaps = 8/175 (4%)
Query: 54  MASSIHRGEEKVMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHE 113
           +A SIH GE +++L   K + +   +L  I+VPRH ++ K   +K +  G   +     E
Sbjct: 200 VAGSIHTGEVEIILKAFKEIKKTYSSLKLILVPRHIENAKIFEKKARDFGFKTSFFENLE 259
Query: 114 KLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAAAGCAVLTGPHIGH 173
                 +V +VD  G L++LY +  IA++GG+F+  + GHN+ E    G  V+ GP+   
Sbjct: 260 -----GDVILVDRFGILKELYPVGKIAIVGGTFV-NIGGHNLLEPTCWGIPVIYGPYTHK 313
Query: 174 YSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSS 228
            +++   +++    +  +V  ++EL   L++L S  + ++ ++ + +   C L  
Sbjct: 314 VNDLKEFLEKEG--AGFEVKNETELVTKLTELLSVKKEIKVEEKSREIKGCYLEK 366

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 1e-55
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Length = 374 Back     alignment and structure
 Score =  181 bits (461), Expect = 1e-55
 Identities = 51/217 (23%), Positives = 102/217 (47%), Gaps = 24/217 (11%)

Query: 5   AIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEK 64
             +F+   A    +   G+LK+              +  K      +  +A SIH GE +
Sbjct: 165 VEKFKTFGAKR--VFSCGNLKF------------ICQKGKGIKLKGEFIVAGSIHTGEVE 210

Query: 65  VMLAVHKVLMQKNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVV 124
           ++L   K + +   +L  I+VPRH ++ K   +K +  G   +     E      +V +V
Sbjct: 211 IILKAFKEIKKTYSSLKLILVPRHIENAKIFEKKARDFGFKTSFFENLE-----GDVILV 265

Query: 125 DTLGELRQLYKLTPIAVIGGSFLP-GLAGHNISEAAAAGCAVLTGPHIGHYSNMVSAMQR 183
           D  G L++LY +  IA++GG+F+  G  GHN+ E    G  V+ GP+    +++   +++
Sbjct: 266 DRFGILKELYPVGKIAIVGGTFVNIG--GHNLLEPTCWGIPVIYGPYTHKVNDLKEFLEK 323

Query: 184 LNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAK 220
               +  +V  ++EL   L++L S  + ++ ++ + +
Sbjct: 324 EG--AGFEVKNETELVTKLTELLSVKKEIKVEEKSRE 358
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 100.0
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.96
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 99.95
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 99.95
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.95
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.95
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.94
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.94
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.93
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.91
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.91
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.91
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.9
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 99.9
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.89
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 99.88
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.88
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 99.88
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 99.88
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 99.87
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.87
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.86
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.86
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.84
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.84
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 99.83
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.82
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 99.81
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 99.8
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 99.76
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 99.75
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.6
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.57
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 99.53
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.49
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.47
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.39
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.39
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.33
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.3
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 99.28
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.26
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.24
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.22
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.15
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 98.94
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 98.88
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 98.79
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 98.64
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.62
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 98.28
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 98.23
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 98.16
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 98.02
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 98.01
3l7i_A729 Teichoic acid biosynthesis protein F; GT-B fold, m 97.96
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 97.83
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 97.75
1l5w_A796 Maltodextrin phosphorylase; enzymatic catalysis, s 95.01
2gj4_A824 Glycogen phosphorylase, muscle form; transferase; 94.91
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 94.4
2c4m_A796 Glycogen phosphorylase; allosteric control, phosph 94.3
3jte_A143 Response regulator receiver protein; structural ge 94.04
3tov_A349 Glycosyl transferase family 9; structural genomics 93.9
2zay_A147 Response regulator receiver protein; structural ge 93.89
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 93.58
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 93.08
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 92.95
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 92.83
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 92.5
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 92.21
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 92.14
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 92.14
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 91.7
2rjn_A154 Response regulator receiver:metal-dependent phosph 91.68
2qsj_A154 DNA-binding response regulator, LUXR family; struc 91.67
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 91.63
3heb_A152 Response regulator receiver domain protein (CHEY); 91.62
3gt7_A154 Sensor protein; structural genomics, signal receiv 91.55
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 91.5
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 91.16
3cnb_A143 DNA-binding response regulator, MERR family; signa 91.1
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 90.97
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 90.92
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 90.85
2qxy_A142 Response regulator; regulation of transcription, N 90.58
3hdv_A136 Response regulator; PSI-II, structural genomics, P 90.55
3hdg_A137 Uncharacterized protein; two-component sensor acti 90.19
2pln_A137 HP1043, response regulator; signaling protein; 1.8 90.11
3cfy_A137 Putative LUXO repressor protein; structural genomi 89.99
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 89.96
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 89.88
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 89.76
2qr3_A140 Two-component system response regulator; structura 89.67
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 89.43
3rqi_A184 Response regulator protein; structural genomics, s 89.42
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 89.35
1zgz_A122 Torcad operon transcriptional regulatory protein; 89.05
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 88.65
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 88.55
3lua_A140 Response regulator receiver protein; two-component 88.49
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 88.34
3crn_A132 Response regulator receiver domain protein, CHEY-; 87.98
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 87.72
1rcu_A195 Conserved hypothetical protein VT76; structural ge 87.61
3cg0_A140 Response regulator receiver modulated diguanylate 87.35
1srr_A124 SPO0F, sporulation response regulatory protein; as 87.25
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 87.19
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 86.9
3eul_A152 Possible nitrate/nitrite response transcriptional 86.88
1mb3_A124 Cell division response regulator DIVK; signal tran 86.84
3r0j_A250 Possible two component system response transcript 86.61
2rdm_A132 Response regulator receiver protein; structural ge 86.15
3cz5_A153 Two-component response regulator, LUXR family; str 86.12
3snk_A135 Response regulator CHEY-like protein; P-loop conta 85.92
3grc_A140 Sensor protein, kinase; protein structure initiati 85.92
1mvo_A136 PHOP response regulator; phosphate regulon, transc 85.89
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 85.7
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 85.55
4dad_A146 Putative pilus assembly-related protein; response 85.49
2gkg_A127 Response regulator homolog; social motility, recei 85.48
3c3m_A138 Response regulator receiver protein; structural ge 84.95
3h5i_A140 Response regulator/sensory box protein/ggdef domai 84.59
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 84.39
1xhf_A123 DYE resistance, aerobic respiration control protei 84.31
1s8n_A205 Putative antiterminator; RV1626, structural genomi 83.04
3i42_A127 Response regulator receiver domain protein (CHEY- 82.57
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 82.32
4b4t_W268 RPN10, 26S proteasome regulatory subunit RPN10; hy 82.18
3kto_A136 Response regulator receiver protein; PSI-II,struct 81.92
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 81.62
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 81.5
3cg4_A142 Response regulator receiver domain protein (CHEY-; 81.27
3f6c_A134 Positive transcription regulator EVGA; structural 81.25
3nhm_A133 Response regulator; protein structure initiative I 80.95
2gwr_A238 DNA-binding response regulator MTRA; two-component 80.1
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-32  Score=240.78  Aligned_cols=213  Identities=23%  Similarity=0.366  Sum_probs=176.7

Q ss_pred             CHHHHHHHHHcCCCCCCeEEcCCcccccccCCCCCCcccHHHHHHhcCCCeEEEEeCCCcchHHHHHHHHHHHHHhCCCe
Q 043830            1 STLQAIRFQLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLAHRQVWMASSIHRGEEKVMLAVHKVLMQKNPNL   80 (248)
Q Consensus         1 s~~~~~~l~~~gv~~~kI~v~gn~~~d~~~~~~~~~~~~~~~~r~~~~~~~v~l~~~~~~~~~~~ll~a~~~l~~~~~~~   80 (248)
                      |+.+++.+.++|++  ||.|+||++|+....+.       .    .+ ..++++++++++|+++.+++|++.+.+++|++
T Consensus       161 S~~~~~~l~~~g~~--ki~vi~n~~f~~~~~~~-------~----~l-~~~vi~~~~~~~k~~~~ll~A~~~l~~~~p~~  226 (374)
T 2xci_A          161 TQEDVEKFKTFGAK--RVFSCGNLKFICQKGKG-------I----KL-KGEFIVAGSIHTGEVEIILKAFKEIKKTYSSL  226 (374)
T ss_dssp             CHHHHHHHHTTTCC--SEEECCCGGGCCCCCSC-------C----CC-SSCEEEEEEECGGGHHHHHHHHHHHHTTCTTC
T ss_pred             CHHHHHHHHHcCCC--eEEEcCCCccCCCcChh-------h----hh-cCCEEEEEeCCCchHHHHHHHHHHHHhhCCCc
Confidence            67889999999997  89999998776532110       0    11 12677787788888899999999998888999


Q ss_pred             EEEEecCCCCCHHHHHHHHHhcCCceEEecccCCCCCCccEEEEcChhHHHHHHhhCCEEEEcCccCCCCCCCCHHHHHh
Q 043830           81 VTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNISEAAA  160 (248)
Q Consensus        81 ~lvivG~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~l~~~y~~ad~~~v~~s~~e~~gg~~~lEA~a  160 (248)
                      +|+|+|+|+++.++++++++++|+....++.+.     .+|++.|+.++++.+|+.||++|+++|+.|+ ||++++||||
T Consensus       227 ~lvivG~g~~~~~~l~~~~~~~gl~~~~~~~~~-----~~v~~~~~~~dl~~~y~~aDv~vl~ss~~e~-gg~~~lEAmA  300 (374)
T 2xci_A          227 KLILVPRHIENAKIFEKKARDFGFKTSFFENLE-----GDVILVDRFGILKELYPVGKIAIVGGTFVNI-GGHNLLEPTC  300 (374)
T ss_dssp             EEEEEESSGGGHHHHHHHHHHTTCCEEETTCCC-----SSEEECCSSSCHHHHGGGEEEEEECSSSSSS-CCCCCHHHHT
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCceEEecCCC-----CcEEEECCHHHHHHHHHhCCEEEECCcccCC-CCcCHHHHHH
Confidence            999999999875689999999998755444321     3688888889999999999998888888775 5899999999


Q ss_pred             hCCcEEECCCCCChHHHHHHHHhcCCceEEEcCCHHHHHHHHHHhhhCHHHHHHHHHHHHHHHHHhchhHHHHHHHH
Q 043830          161 AGCAVLTGPHIGHYSNMVSAMQRLNPKSVLQVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCALSSGIVANVWNL  237 (248)
Q Consensus       161 ~G~Pvi~~~~~~~~~~~~~~~~~~g~g~~~~~~~~~~l~~~i~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  237 (248)
                      ||+|||+|++.++++++++.+.++|  +++.++|+++|+++|.++++| +++++|+++|++++.+ ..++++++++.
T Consensus       301 ~G~PVI~~~~~~~~~e~~~~~~~~G--~l~~~~d~~~La~ai~~ll~d-~~r~~mg~~ar~~~~~-~~ga~~~~~~~  373 (374)
T 2xci_A          301 WGIPVIYGPYTHKVNDLKEFLEKEG--AGFEVKNETELVTKLTELLSV-KKEIKVEEKSREIKGC-YLEKLREFLRG  373 (374)
T ss_dssp             TTCCEEECSCCTTSHHHHHHHHHTT--CEEECCSHHHHHHHHHHHHHS-CCCCCHHHHHHHHHHH-HHHHHHHHHHC
T ss_pred             hCCCEEECCCccChHHHHHHHHHCC--CEEEeCCHHHHHHHHHHHHhH-HHHHHHHHHHHHHHHh-cccHHHHHHhh
Confidence            9999999888889999887765555  788899999999999999999 9999999999999876 56778887764
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.95
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.9
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.87
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.86
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 99.75
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.71
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 98.91
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 98.85
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 98.71
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 98.64
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 98.63
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 98.57
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 98.53
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 97.97
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 97.82
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.76
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 97.6
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 93.08
d1rcua_170 Hypothetical protein TM1055 {Thermotoga maritima [ 90.66
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 90.34
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 90.21
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 89.06
d1i3ca_144 Response regulator for cyanobacterial phytochrome 88.27
d1k68a_140 Response regulator for cyanobacterial phytochrome 86.02
d1k66a_149 Response regulator for cyanobacterial phytochrome 85.71
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 85.31
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 85.27
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 85.23
d1qkka_140 Transcriptional regulatory protein DctD, receiver 84.21
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 83.68
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 83.13
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 83.1
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 82.85
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 82.59
d1s8na_190 Probable two-component system transcriptional regu 81.65
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 81.08
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Lipopolysaccharide core biosynthesis protein RfaG
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=4.7e-27  Score=199.36  Aligned_cols=217  Identities=14%  Similarity=0.129  Sum_probs=160.6

Q ss_pred             HHHHHHH-HHcCCCCCCeEEcCCcccccccCCCCCCcccHHHHHHhcC---CCeEEEEeCCC--cchHHHHHHHHHHHHH
Q 043830            2 TLQAIRF-QLLEASPFTINFSGDLKYVHEYDESEGDIGSIEDLKASLA---HRQVWMASSIH--RGEEKVMLAVHKVLMQ   75 (248)
Q Consensus         2 ~~~~~~l-~~~gv~~~kI~v~gn~~~d~~~~~~~~~~~~~~~~r~~~~---~~~v~l~~~~~--~~~~~~ll~a~~~l~~   75 (248)
                      +..++.+ ...+++++++.+++|+ +|.+.......+...+.+|..++   +++++++.++.  .|+++.+++|+..+.+
T Consensus       144 ~~~~~~~~~~~~~~~~~i~vi~~g-v~~~~~~~~~~~~~~~~~r~~~~~~~~~~~i~~~gr~~~~Kg~~~li~a~~~l~~  222 (370)
T d2iw1a1         144 DKQIADFQKHYQTEPERFQILPPG-IYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPE  222 (370)
T ss_dssp             HHHHHHHHHHHCCCGGGEEECCCC-CCGGGSGGGSCTTHHHHHHHHTTCCTTCEEEEEECSCTTTTTHHHHHHHHHTSCH
T ss_pred             HHHHHHHHHhcCCCcceEEEEEee-cccccccccCchhhhhhhhhccCCCccceEEEEEeccccccchhhhccccccccc
Confidence            3444555 4578999999999985 44432101112234566777664   56777776653  4788999999999887


Q ss_pred             hCCCeEEEEecCCCCCHHHHHHHHHhcCCceEEecccCCCCCCccEEEEcChhHHHHHHhhCCEEEEcCccCCCCCCCCH
Q 043830           76 KNPNLVTIIVPRHPQHGKEIAQKLQKEGEVVALRSRHEKLMPRTNVYVVDTLGELRQLYKLTPIAVIGGSFLPGLAGHNI  155 (248)
Q Consensus        76 ~~~~~~lvivG~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~l~~~y~~ad~~~v~~s~~e~~gg~~~  155 (248)
                      +.++..++++|.++.. ++++++++++++..             ++.+.++..++.++|+.||+ ++.||..|++ |+++
T Consensus       223 ~~~~~~~~ii~g~~~~-~~~~~~~~~~~~~~-------------~v~~~g~~~~~~~~~~~adv-~v~ps~~E~~-~~~~  286 (370)
T d2iw1a1         223 SLRHNTLLFVVGQDKP-RKFEALAEKLGVRS-------------NVHFFSGRNDVSELMAAADL-LLHPAYQEAA-GIVL  286 (370)
T ss_dssp             HHHHTEEEEEESSSCC-HHHHHHHHHHTCGG-------------GEEEESCCSCHHHHHHHCSE-EEECCSCCSS-CHHH
T ss_pred             ccccceeeeccccccc-cccccccccccccc-------------cccccccccccccccccccc-cccccccccc-ccee
Confidence            7777777777665555 67888888887753             56667777799999999999 5678888986 8999


Q ss_pred             HHHHhhCCcEEECCCCCChHHHHHHHHhcCCceEE-EcCCHHHHHHHHHHhhhCHHHHHHHHHHHHHHHHHh-chhHHHH
Q 043830          156 SEAAAAGCAVLTGPHIGHYSNMVSAMQRLNPKSVL-QVSGKSELEEALSQLFSDARVLEAQQMAAKQAFCAL-SSGIVAN  233 (248)
Q Consensus       156 lEA~a~G~Pvi~~~~~~~~~~~~~~~~~~g~g~~~-~~~~~~~l~~~i~~ll~~~~~~~~~~~~~~~~~~~~-~~~~~~~  233 (248)
                      +|||+||+|||+++.+ +.+|.+.   +..+|.++ .+.|+++|+++|.+|++|++++++|+++|+++++.+ +....++
T Consensus       287 ~EAma~G~PvI~s~~~-g~~e~i~---~~~~G~l~~~~~d~~~la~~i~~ll~d~~~~~~~~~~ar~~~~~~~~~~~~~~  362 (370)
T d2iw1a1         287 LEAITAGLPVLTTAVC-GYAHYIA---DANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARHYADTQDLYSLPEK  362 (370)
T ss_dssp             HHHHHHTCCEEEETTS-TTTHHHH---HHTCEEEECSSCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSCCSCHHHH
T ss_pred             eecccCCeeEEEeCCC-ChHHHhc---CCCceEEEcCCCCHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHhChhHHHHH
Confidence            9999999999998654 6666554   34455555 458999999999999999999999999999999876 4455555


Q ss_pred             HHHHHH
Q 043830          234 VWNLLN  239 (248)
Q Consensus       234 ~l~~~~  239 (248)
                      +.++|.
T Consensus       363 ~~~ii~  368 (370)
T d2iw1a1         363 AADIIT  368 (370)
T ss_dssp             HHHHHH
T ss_pred             HHHHHh
Confidence            555553
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure