Citrus Sinensis ID: 045527

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
RVQVRLNTQPDPHVSGFEKMLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQAVEDVGQERELESKPTEGAKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEccccccccccEEEEEEEccEEEEEEEEcccccccccHHHHHHHccccccccccEEEEccccccccccEEEEEEEEEEcEEEEEEEEEEccccccEEEcHHHHHHcccEEEEEcccEEEEEEccEEEEEEEc
ccEEEEccccccccccHHHcccccEEEEEccccccccccccccccccccccccccHHHHHHHHcccEEccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccEEEHHHHcccccccEEEEEEEEccEEEEEEEEcccccccccHHHHHHcccccccccccEEEEccccEEEEcEEccccEEEEEcEEccccEEEEccccccEEEEHHHHHHcccEEEEccEEEEEEEEcccEEEEEEc
rvqvrlntqpdphvsgfekmlpgsvflctwggfnsdrivqvypahegrgfrkLTEAELQsnqecglcykcdekfspghrcrkqELQVVLLQEYEAEAQAVEDvgqereleskptegaknQVVEVSLNsvvgltspktlKLASEINNKKVVVLTdsgashnfiSNEVVLVLKlpitntepygvilrtgsatkaqgICRGVGLILQGVeivedflpldlgitdIIMGIHWLKTLGathinwkthsmkfntrntigknqff
rvqvrlntqpdphvsgfekmLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQAVEDVGqereleskptegaknqvveVSLNsvvgltspktlklaseinNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWkthsmkfntrntigknqff
RVQVRLNTQPDPHVSGFEKMLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQAVEDVGQERELESKPTEGAKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
****************FEKMLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYE***************************VEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFN***********
******************************************************************CYKCDEKFSPGHRCRKQELQVVLLQEYEAEA*************************EVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
********QPDPHVSGFEKMLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQAV***************GAKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
RVQVRLNTQPDPHVSGFEKMLPGSVFLCTWGGF*********************E*ELQ*NQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYE*************************QVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RVQVRLNTQPDPHVSGFEKMLPGSVFLCTWGGFNSDRIVQVYPAHEGRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLxxxxxxxxxxxxxxxxxxxxxSKPTEGAKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNTIGKNQFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
387965727 1631 Ty3/gypsy retrotransposon protein [Beta 0.771 0.122 0.471 3e-45
147854459 2232 hypothetical protein VITISV_043911 [Viti 0.736 0.085 0.512 9e-45
261865347 1583 hypothetical protein [Beta vulgaris] 0.751 0.122 0.441 2e-42
449472371 764 PREDICTED: uncharacterized protein LOC10 0.759 0.256 0.427 2e-40
449465222 2712 PREDICTED: uncharacterized protein LOC10 0.759 0.072 0.427 3e-40
449457325 718 PREDICTED: uncharacterized protein LOC10 0.748 0.268 0.435 3e-40
307136175 1185 ty3-gypsy retrotransposon protein [Cucum 0.751 0.163 0.393 2e-39
449470598 1049 PREDICTED: enzymatic polyprotein-like, p 0.763 0.187 0.376 4e-35
449473450 564 PREDICTED: enzymatic polyprotein-like, p 0.767 0.351 0.375 6e-35
449523988307 PREDICTED: uncharacterized protein LOC10 0.720 0.605 0.395 2e-34
>gi|387965727|gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris] Back     alignment and taxonomy information
 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 135/208 (64%), Gaps = 9/208 (4%)

Query: 43  PAHEGRGF---RKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQA 99
           P    RGF   R+LTE ELQ  +  GLC+KCDEK+  GH+CR++EL V+ +++ E +   
Sbjct: 390 PPLSSRGFGEMRRLTEKELQEKRAKGLCFKCDEKWGVGHQCRRKELSVLFMEDNEEDE-- 447

Query: 100 VEDVGQERELESKPTEGAKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASH 159
           +E      E    PTE       EVSLNSV+GL++PKT+KL+  I+N +VVV+ D GA+H
Sbjct: 448 LEGALSGSEAPPSPTEEIPP---EVSLNSVIGLSNPKTMKLSGLIDNHEVVVMIDPGATH 504

Query: 160 NFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQ-GVEIVEDFLPLDLG 218
           NF+S + +  L +P+T +E +GV L  G A +  GICR V L L  G+ +VEDFLPL LG
Sbjct: 505 NFLSLKAIDKLGIPVTESEEFGVSLGDGQAVRGTGICRAVALYLDGGLVVVEDFLPLGLG 564

Query: 219 ITDIIMGIHWLKTLGATHINWKTHSMKF 246
            +D+I+G+ WL+TLG    NWKT  M F
Sbjct: 565 NSDVILGVQWLETLGTVVSNWKTQKMSF 592

Source: Beta vulgaris subsp. vulgaris

Species: Beta vulgaris

Genus: Beta

Family: Amaranthaceae

Order: Caryophyllales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147854459|emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|261865347|gb|ACY01928.1| hypothetical protein [Beta vulgaris] Back     alignment and taxonomy information
>gi|449472371|ref|XP_004153573.1| PREDICTED: uncharacterized protein LOC101213561, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465222|ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216833 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457325|ref|XP_004146399.1| PREDICTED: uncharacterized protein LOC101219499 [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136175|gb|ADN34016.1| ty3-gypsy retrotransposon protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449470598|ref|XP_004153003.1| PREDICTED: enzymatic polyprotein-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449473450|ref|XP_004153884.1| PREDICTED: enzymatic polyprotein-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449523988|ref|XP_004169005.1| PREDICTED: uncharacterized protein LOC101225033 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
TAIR|locus:2091793 421 AT3G29750 [Arabidopsis thalian 0.759 0.465 0.318 1.3e-17
TAIR|locus:2089696 603 AT3G30770 [Arabidopsis thalian 0.480 0.205 0.380 2.1e-14
TAIR|locus:504955786 818 AT3G42723 [Arabidopsis thalian 0.224 0.070 0.35 0.00074
TAIR|locus:2091793 AT3G29750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 220 (82.5 bits), Expect = 1.3e-17, P = 1.3e-17
 Identities = 65/204 (31%), Positives = 100/204 (49%)

Query:    47 GRGFRKLTEAELQSNQECGLCYKCDEKFSPGHRCRKQELQVVLLQEYEAEAQAVEDVGQE 106
             G+GF ++    LQ + +  +  +        ++ R+ EL  + L + + +    +  G  
Sbjct:    37 GQGFEEMFLQGLQPSLQTAV-RELKPNGINSYQSRQAELMSLTLVQAKLDV-VKKKKGVI 94

Query:   107 RELESKPTEG-AKNQVVEVSLNSVVGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNE 165
              ELE    +     Q +E     V+ LT  K ++    I + KVVV  DSGA+ NFI  E
Sbjct:    95 NELEELEQDSYTLRQGME---QLVIDLTRNKGMRFYGFILDHKVVVAIDSGATDNFILVE 151

Query:   166 VVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPLDLGITDI--I 223
             +   LKLP + T    V+L      ++ G C G+ L +Q VEI E+FL LDL  TD+  I
Sbjct:   152 LAFSLKLPTSITNQASVLLGQRQCIQSVGTCLGIRLWVQEVEITENFLLLDLAKTDVDVI 211

Query:   224 MGIHWLKTLGATHINWKTHSMKFN 247
             +G  WL  LG T +NW+     F+
Sbjct:   212 LGYEWLSKLGETMVNWQNQDFSFS 235
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA
TAIR|locus:2089696 AT3G30770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955786 AT3G42723 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029562001
SubName- Full=Chromosome chr9 scaffold_49, whole genome shotgun sequence; (219 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 3e-16
pfam08284135 pfam08284, RVP_2, Retroviral aspartyl protease 4e-08
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 1e-04
pfam12384177 pfam12384, Peptidase_A2B, Ty3 transposon peptidase 0.002
cd0548396 cd05483, retropepsin_like_bacteria, Bacterial aspa 0.003
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information 
 Score = 71.6 bits (176), Expect = 3e-16
 Identities = 34/89 (38%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 143 EINNKKVVVLTDSGASHNFISNEVVLVLKLP-ITNTEPYGVILRTGSATKAQGICRGVGL 201
           +IN   V  L DSGAS NFIS  +   L LP      P  V    GS+ K  G+   V +
Sbjct: 4   KINGVPVRALVDSGASVNFISESLAKKLGLPPRLLPTPLKVKGANGSSVKTLGVILPVTI 63

Query: 202 ILQGVEIVEDFLPLDLGITDIIMGIHWLK 230
            + G     DF  LDL   D+I+G  WL+
Sbjct: 64  GIGGKTFTVDFYVLDLLSYDVILGRPWLE 92

The family includes pepsin-like aspartate proteases from retroviruses, retrotransposons and retroelements, as well as eukaryotic dna-damage-inducible proteins (DDIs), and bacterial aspartate peptidases. While fungal and mammalian pepsins are bilobal proteins with structurally related N and C-terminals, retropepsins are half as long as their fungal and mammalian counterparts. The monomers are structurally related to one lobe of the pepsin molecule and retropepsins function as homodimers. The active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Retroviral aspartyl protease is synthesized as part of the POL polyprotein that contains an aspartyl protease, a reverse transcriptase, RNase H, and an integrase. The POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. In aspartate peptidases, Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A. Length = 92
>gnl|CDD|116868 pfam08284, RVP_2, Retroviral aspartyl protease Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|152819 pfam12384, Peptidase_A2B, Ty3 transposon peptidase Back     alignment and domain information
>gnl|CDD|133150 cd05483, retropepsin_like_bacteria, Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 99.96
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.91
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 99.78
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 99.74
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 99.63
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.59
PF1365090 Asp_protease_2: Aspartyl protease 99.58
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 99.56
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 99.52
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 99.5
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 99.46
KOG0012380 consensus DNA damage inducible protein [Replicatio 99.44
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 99.43
PF02160201 Peptidase_A3: Cauliflower mosaic virus peptidase ( 99.4
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 99.4
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 99.36
COG3577215 Predicted aspartyl protease [General function pred 99.09
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 99.07
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 98.93
COG5550125 Predicted aspartyl protease [Posttranslational mod 98.61
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 98.48
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 98.18
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 97.95
PF12382137 Peptidase_A2E: Retrotransposon peptidase; InterPro 97.46
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 96.34
PF1369632 zf-CCHC_2: Zinc knuckle 95.8
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 95.73
COG4067162 Uncharacterized protein conserved in archaea [Post 95.63
cd05477318 gastricsin Gastricsins, asparate proteases produce 94.93
PF1391742 zf-CCHC_3: Zinc knuckle 94.91
smart0034326 ZnF_C2HC zinc finger. 94.9
cd06098317 phytepsin Phytepsin, a plant homolog of mammalian 94.87
PF00026317 Asp: Eukaryotic aspartyl protease The Prosite entr 94.8
cd05485329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 94.74
PF05618138 Zn_protease: Putative ATP-dependant zinc protease; 94.63
cd05478317 pepsin_A Pepsin A, aspartic protease produced in g 94.54
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 94.42
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 94.28
cd05474295 SAP_like SAPs, pepsin-like proteinases secreted fr 93.96
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 93.86
cd05472299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 93.76
cd05486316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 93.5
COG5082190 AIR1 Arginine methyltransferase-interacting protei 92.7
PTZ00147453 plasmepsin-1; Provisional 92.55
PTZ00368148 universal minicircle sequence binding protein (UMS 92.27
cd05488320 Proteinase_A_fungi Fungal Proteinase A , aspartic 91.89
cd05490325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 91.16
cd05487326 renin_like Renin stimulates production of angioten 90.89
cd05475273 nucellin_like Nucellins, plant aspartic proteases 90.44
PTZ00013450 plasmepsin 4 (PM4); Provisional 90.0
COG5082190 AIR1 Arginine methyltransferase-interacting protei 89.97
PLN03146431 aspartyl protease family protein; Provisional 89.78
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 88.85
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 88.46
PF1439249 zf-CCHC_4: Zinc knuckle 87.99
COG5222427 Uncharacterized conserved protein, contains RING Z 87.53
PTZ00165482 aspartyl protease; Provisional 87.11
PTZ00147 453 plasmepsin-1; Provisional 86.98
PTZ00013 450 plasmepsin 4 (PM4); Provisional 86.55
cd05473364 beta_secretase_like Beta-secretase, aspartic-acid 85.9
PTZ00368148 universal minicircle sequence binding protein (UMS 85.41
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 83.51
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 82.43
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information 
Probab=99.96  E-value=3.6e-29  Score=199.29  Aligned_cols=119  Identities=38%  Similarity=0.615  Sum_probs=107.6

Q ss_pred             cCccCCCeEEEEEEECCEEEEEEEcCCCCccccCHHHHHHcCCCcccCC-CceEeecccccccccceEeeeeEeeeceeE
Q 045527          130 VGLTSPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTE-PYGVILRTGSATKAQGICRGVGLILQGVEI  208 (258)
Q Consensus       130 ~g~~~~~~i~i~~~I~g~~v~aLIDSGAt~sfIs~~~a~~l~l~~~~~~-~~~V~~a~G~~~~~~~~~~~v~i~i~g~~~  208 (258)
                      +....+.+|...+.|++.++.+||||||||||||.++|.+++++..+++ +..|. ++|+.+.+...|..+++.++|+.|
T Consensus        14 ~~~~~~~vi~g~~~I~~~~~~vLiDSGAThsFIs~~~a~~~~l~~~~l~~~~~V~-~~g~~~~~~~~~~~~~~~i~g~~~   92 (135)
T PF08284_consen   14 EAEESPDVITGTFLINSIPASVLIDSGATHSFISSSFAKKLGLPLEPLPRPIVVS-APGGSINCEGVCPDVPLSIQGHEF   92 (135)
T ss_pred             cccCCCCeEEEEEEeccEEEEEEEecCCCcEEccHHHHHhcCCEEEEccCeeEEe-cccccccccceeeeEEEEECCeEE
Confidence            3445688999999999999999999999999999999999999999875 55555 567777888889999999999999


Q ss_pred             EeeccccCCCCccEEecchHHHhcCCeEEEeeCCEEEEeeCC
Q 045527          209 VEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRN  250 (258)
Q Consensus       209 ~~~f~Vl~~~~~dvILG~dwL~~~~~i~ID~~~~~v~f~~~~  250 (258)
                      ..+|.|+++.++|+|||||||.+|+| .|||.+++|+|....
T Consensus        93 ~~dl~vl~l~~~DvILGm~WL~~~~~-~IDw~~k~v~f~~p~  133 (135)
T PF08284_consen   93 VVDLLVLDLGGYDVILGMDWLKKHNP-VIDWATKTVTFNSPS  133 (135)
T ss_pred             EeeeEEecccceeeEeccchHHhCCC-EEEccCCEEEEeCCC
Confidence            99999999999999999999999999 999999999998653

These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases.
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
 Score = 63.2 bits (153), Expect = 9e-13
 Identities = 17/109 (15%), Positives = 39/109 (35%), Gaps = 1/109 (0%)

Query: 143 EINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLI 202
           ++N   +    DSGA    +S        +       +  + +     +  G      + 
Sbjct: 30  KVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQ 89

Query: 203 LQGVEIVEDFLPLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRNT 251
           ++G  +   F  L+    D+++G+  L+      I+ K + +   T  T
Sbjct: 90  IEGDFLQCSFSILEDQPMDMLLGLDMLRRHQ-CSIDLKKNVLVIGTTGT 137
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 99.88
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 99.79
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 99.15
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 99.12
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 98.87
2hs1_A99 HIV-1 protease; ultra-high resolution active site 98.79
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.51
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 98.51
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 98.14
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.02
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 97.88
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 97.81
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 97.73
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 97.67
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 97.52
2pma_A146 Uncharacterized protein; APC86035.2, protein LPG00 97.21
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 97.13
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 96.88
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 96.48
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 96.37
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 96.3
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 96.29
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 96.26
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 96.23
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 96.19
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 96.15
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 96.15
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 96.11
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 96.06
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 96.01
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 95.58
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 95.53
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 95.39
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 95.34
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 95.22
3qvc_A451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 94.68
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 94.59
4aa9_A320 Chymosin; hydrolase, aspartic peptidase, rennet; H 94.35
2apr_A325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 94.02
1wkr_A340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 93.9
1am5_A324 Pepsin, acid proteinase; aspartyl protease, hydrol 93.84
1miq_A375 Plasmepsin; aspartic proteinase zymogen, domain op 93.74
1dpj_A329 Proteinase A; proteinase A, hydrolase-hydrolase in 93.71
1tzs_A351 Cathepsin E; hydrolase, aspartic protease, activat 93.55
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 93.51
3k1w_A341 Renin; protease, alternative splicing, aspartyl pr 93.48
1yg9_A330 Aspartic protease BLA G 2; allegren, hydrolase, al 93.4
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 93.36
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 93.33
1bxo_A323 Protein (penicillopepsin); hydrolase, phosphonate 93.32
3fv3_A339 SAPP1P-secreted aspartic protease 1; secreted aspa 93.29
1oew_A329 Endothiapepsin; hydrolase, aspartic proteinase mec 93.27
2bju_A453 Plasmepsin II; aspartic proteinase, drug design, m 92.86
1izd_A323 Aspartic proteinase; sugar binding, acid protease, 92.79
3pvk_A342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 92.69
1ibq_A325 Aspergillopepsin; aspartic proteinase, hydrolase; 92.56
2jys_A107 Protease/reverse transcriptase; retroviral proteas 92.52
3cms_A323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 92.51
3c9x_A329 Trichoderma reesei aspartic protease; aspartic pro 92.46
3aup_A403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 92.31
1lya_B241 Cathepsin D; lysosomal aspartic protease; HET: NAG 92.21
2qzx_A342 Candidapepsin-5; aspartic proteinase, aspartyl pro 92.17
3psg_A370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 91.81
1j71_A334 Candidapepsin, aspartic proteinase; candida tropic 91.78
1mpp_A361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 91.73
1htr_B329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 91.39
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 90.71
1t6e_X381 Xylanase inhibitor; two beta-barrel domain structu 90.66
2x0b_A383 Renin; hydrolase-hormone complex, hydrolase hormon 90.62
3lpj_A455 Beta-secretase 1; alzheimer'S, aspartyl protease, 90.08
3vf3_A402 Beta-secretase 1; structure-based drug design, hyd 89.81
2ewy_A383 Beta-secretase 2; BACE2, aspartic protease, hydrol 88.44
2qp8_A395 Beta-secretase 1; BACE1, protease, alternative spl 86.62
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 84.69
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 84.46
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 82.67
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 81.48
3vla_A413 EDGP; extracellular, inhibitor, plant protein; HET 81.43
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 80.82
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=1.9e-22  Score=161.94  Aligned_cols=116  Identities=15%  Similarity=0.203  Sum_probs=95.2

Q ss_pred             CCCeEEEEEEECCEEEEEEEcCCCCccccCHHHHHHcCCCcccCCCceEeecccccccccceEeeeeEeeeceeEEeecc
Q 045527          134 SPKTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFL  213 (258)
Q Consensus       134 ~~~~i~i~~~I~g~~v~aLIDSGAt~sfIs~~~a~~l~l~~~~~~~~~V~~a~G~~~~~~~~~~~v~i~i~g~~~~~~f~  213 (258)
                      ....+++.+.|||+++++||||||++||||.++|+++|+.......+.......+.....+.+..++|++++..+..+|.
T Consensus        21 ~~~~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig~~~~~~~~~  100 (148)
T 3s8i_A           21 QVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFS  100 (148)
T ss_dssp             -CCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEETTEEEEEEEE
T ss_pred             ccCEEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEECCEEEEEEEE
Confidence            35678999999999999999999999999999999999976432223333322223455567777899999999999999


Q ss_pred             ccCCCCccEEecchHHHhcCCeEEEeeCCEEEEeeCC
Q 045527          214 PLDLGITDIIMGIHWLKTLGATHINWKTHSMKFNTRN  250 (258)
Q Consensus       214 Vl~~~~~dvILG~dwL~~~~~i~ID~~~~~v~f~~~~  250 (258)
                      |++...+|+|||||||.+++. .|||++++|+|...+
T Consensus       101 Vle~~~~d~LLGmD~L~~~~~-~ID~~~~~L~l~~~~  136 (148)
T 3s8i_A          101 ILEDQPMDMLLGLDMLRRHQC-SIDLKKNVLVIGTTG  136 (148)
T ss_dssp             EETTCSSSEEECHHHHHHTTC-EEETTTTEEECTTTC
T ss_pred             EeCCCCcCeeccHHHHHhCCE-EEEcCCCEEEEccCC
Confidence            999999999999999999996 999999999997543
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 98.97
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 98.41
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 98.34
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 98.24
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 98.23
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 98.14
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 97.89
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 97.33
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 97.22
d2pmaa1141 Uncharacterized protein LPG0085 {Legionella pneumo 96.88
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 96.68
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 96.66
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 96.38
d1bxoa_323 Acid protease {Fungus (Penicillium janthinellum), 95.96
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 95.76
d1wkra_340 Acid protease {Irpex lacteus (Polyporus tulipifera 95.66
d1izea_323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 95.6
d1oewa_330 Endothiapepsin {Chestnut blight fungus (Endothia p 95.41
d2bjua1329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 94.92
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 94.91
d3cmsa_323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 94.67
d1j71a_334 Acid protease {Yeast (Candida tropicalis) [TaxId: 94.53
d1eaga_342 Acid protease {Yeast (Candida albicans) [TaxId: 54 94.45
d1am5a_324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 94.32
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 94.06
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 93.74
d1dpja_329 Acid protease {Baker's yeast (Saccharomyces cerevi 93.72
d1qdma2337 Plant acid proteinase, phytepsin {Barley (Hordeum 93.26
d1smra_335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 93.26
d1hrna_337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 92.86
d2apra_325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 92.84
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 92.68
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 88.77
g1b5f.1326 Plant acid proteinase, phytepsin {Cynara carduncul 88.76
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 88.46
g1lya.1338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 88.01
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 87.05
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 84.92
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Retroviral protease (retropepsin)
domain: EIAV protease
species: Equine infectious anemia virus [TaxId: 11665]

Probab=98.97  E-value=1.7e-09  Score=79.30  Aligned_cols=94  Identities=24%  Similarity=0.243  Sum_probs=68.7

Q ss_pred             CeEEEEEEECCEEEEEEEcCCCCccccCHHHHHHcCCCcccCCCceEeecccccccccceEeeeeEeeeceeEEeecccc
Q 045527          136 KTLKLASEINNKKVVVLTDSGASHNFISNEVVLVLKLPITNTEPYGVILRTGSATKAQGICRGVGLILQGVEIVEDFLPL  215 (258)
Q Consensus       136 ~~i~i~~~I~g~~v~aLIDSGAt~sfIs~~~a~~l~l~~~~~~~~~V~~a~G~~~~~~~~~~~v~i~i~g~~~~~~f~Vl  215 (258)
                      +...+.++|+|+++.+|+||||.+|+|+..-............+ ....+.|..+...  ...+.+.+.|+.....++|.
T Consensus         7 ~RP~~~i~I~Gq~v~~LLDTGAD~TVI~~~~~p~~~~~~~~~~~-~~igg~g~~~~~~--~~~v~i~~~g~~~~~~~lV~   83 (104)
T d2fmba_           7 KRPTTIVLINDTPLNVLLDTGADTSVLTTAHYNRLKYRGRKYQG-TGIGGVGGNVETF--STPVTIKKKGRHIKTRMLVA   83 (104)
T ss_dssp             SCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHCSSCCCCEEC-CCEEETTEEECCE--EEEEEEEETTEEEEEEEEEE
T ss_pred             cCeEEEEEECCEEEEEEEeCCCCeEEEcccccCccCCCCCCcce-eEEEEecceEEEE--EEEEEEEECCeEEEEEEEEC
Confidence            34567899999999999999999999999988876443322222 2333445444432  24578888898888888888


Q ss_pred             CCCCccEEecchHHHhcCC
Q 045527          216 DLGITDIIMGIHWLKTLGA  234 (258)
Q Consensus       216 ~~~~~dvILG~dwL~~~~~  234 (258)
                      +.. .+ |||.|+|.+++.
T Consensus        84 p~P-vn-LlGRdlL~qlG~  100 (104)
T d2fmba_          84 DIP-VT-ILGRDILQDLGA  100 (104)
T ss_dssp             SCS-SC-EECHHHHHHHTC
T ss_pred             CCC-cc-eecHHHHHHhCC
Confidence            842 33 999999999985
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure