Citrus Sinensis ID: 046111
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 520 | ||||||
| 255566821 | 998 | conserved hypothetical protein [Ricinus | 0.998 | 0.520 | 0.782 | 0.0 | |
| 359472709 | 1003 | PREDICTED: protein CHUP1, chloroplastic- | 0.996 | 0.516 | 0.774 | 0.0 | |
| 449434670 | 987 | PREDICTED: protein CHUP1, chloroplastic- | 0.967 | 0.509 | 0.768 | 0.0 | |
| 449493474 | 987 | PREDICTED: protein CHUP1, chloroplastic- | 0.967 | 0.509 | 0.768 | 0.0 | |
| 147860149 | 955 | hypothetical protein VITISV_020008 [Viti | 0.976 | 0.531 | 0.771 | 0.0 | |
| 297737876 | 969 | unnamed protein product [Vitis vinifera] | 0.940 | 0.504 | 0.739 | 0.0 | |
| 356502487 | 964 | PREDICTED: protein CHUP1, chloroplastic- | 0.95 | 0.512 | 0.758 | 0.0 | |
| 224111748 | 955 | predicted protein [Populus trichocarpa] | 0.969 | 0.527 | 0.755 | 0.0 | |
| 297814774 | 1002 | hypothetical protein ARALYDRAFT_484330 [ | 0.971 | 0.503 | 0.735 | 0.0 | |
| 42565189 | 1004 | protein CHUP1 [Arabidopsis thaliana] gi| | 0.971 | 0.502 | 0.736 | 0.0 |
| >gi|255566821|ref|XP_002524394.1| conserved hypothetical protein [Ricinus communis] gi|223536355|gb|EEF38005.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 763 bits (1970), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 406/519 (78%), Positives = 459/519 (88%)
Query: 1 MIVRAGFLVAASIAAYAVKQLNLKASNSSAPLTKPSGNGEARFEQQQSQGKEKQQFTCPD 60
MI + FLVAASIAAYAVKQLN+K S PS NG+ +Q++ +G++++QF D
Sbjct: 1 MIGKFSFLVAASIAAYAVKQLNIKTERSPTSHVGPSENGQGSIDQRRGKGRDEEQFIYSD 60
Query: 61 GGLREKKREEEEEEEEVKLISSIFDRARGSSSNTDDEDILPEFEDLLSGEIEYQLPIDKF 120
L+EK EEEEEEEEVKLISS+FDRA G+++ T+D+DI PEFEDLLSGEI+Y LP D+
Sbjct: 61 DILKEKDGEEEEEEEEVKLISSVFDRAHGTAAGTEDDDIYPEFEDLLSGEIDYPLPGDRV 120
Query: 121 DEAEKNKVYETEMADNARELERLRSLVLELQEREVKLEGELLEYYGLKEQESDIVELQRQ 180
D+AEK+KVYE EMA+NA ELERLR+LV EL+EREVKLEGELLEYYGLKEQESD+ E+ RQ
Sbjct: 121 DKAEKDKVYENEMANNASELERLRNLVRELEEREVKLEGELLEYYGLKEQESDVAEIHRQ 180
Query: 181 LKIKTVEIDMLNITINSLQAERKKLQEQIAQSSYVKKELEVARNKIKELQRQIQLDANQT 240
LKIKTVEIDMLNITINSLQAERKKLQE++AQ + KKELE AR KIKELQRQIQLDANQT
Sbjct: 181 LKIKTVEIDMLNITINSLQAERKKLQEEVAQGASAKKELEAARTKIKELQRQIQLDANQT 240
Query: 241 KGQLLLLKQQVSGLQAKEEEAIKKDVELEKKLKSVKDLEVEVVELKRKNKELQIEKRELL 300
KGQLLLLKQQVSGLQAKEEEAIKKD ELE+KLK+VKDLEVEVVEL+RKNKELQ EKREL
Sbjct: 241 KGQLLLLKQQVSGLQAKEEEAIKKDAELERKLKAVKDLEVEVVELRRKNKELQHEKRELT 300
Query: 301 VKLDAAESKIASLSNMTESEKVAKAREEVNNLRHANDDLLKQVEGLQMNRFGEVEELVYL 360
+KLDAA++KI SLSNMTESE VAKAR++VNNLRHAN+DLLKQVEGLQMNRF EVEELVYL
Sbjct: 301 IKLDAAQAKIVSLSNMTESEMVAKARDDVNNLRHANEDLLKQVEGLQMNRFSEVEELVYL 360
Query: 361 RWVNACLRYELRNYQAPAGKTSARDLNKSLSPKSQERAKQLMLEYAGSERGQVDTDLESN 420
RWVNACLRYELRNYQAP G+ SARDL+K+LSPKSQE+AK LMLEYAGSERGQ DTDL+SN
Sbjct: 361 RWVNACLRYELRNYQAPPGRVSARDLSKNLSPKSQEKAKHLMLEYAGSERGQGDTDLDSN 420
Query: 421 FSHPSSPGSEDFDNASIDSSTSKYSNLSKKPSLIQKLKKWGKSKDDTSALSSPARSISGC 480
FSHPSSPGSEDFDN SIDSSTS+YS+LSKKPSLIQK+KKWGKSKDD+SALSSP+RS S
Sbjct: 421 FSHPSSPGSEDFDNTSIDSSTSRYSSLSKKPSLIQKIKKWGKSKDDSSALSSPSRSFSAD 480
Query: 481 SPSRMSMSHRPRGPLESLMLRNTSDSVAITTFGKMDQEL 519
SPSR SMS R RGPLE+LMLRN DSVAITTFGK +Q++
Sbjct: 481 SPSRTSMSLRSRGPLEALMLRNVGDSVAITTFGKSEQDV 519
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359472709|ref|XP_002281154.2| PREDICTED: protein CHUP1, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449434670|ref|XP_004135119.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449493474|ref|XP_004159306.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147860149|emb|CAN78725.1| hypothetical protein VITISV_020008 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737876|emb|CBI27077.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356502487|ref|XP_003520050.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224111748|ref|XP_002315963.1| predicted protein [Populus trichocarpa] gi|222865003|gb|EEF02134.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297814774|ref|XP_002875270.1| hypothetical protein ARALYDRAFT_484330 [Arabidopsis lyrata subsp. lyrata] gi|297321108|gb|EFH51529.1| hypothetical protein ARALYDRAFT_484330 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42565189|ref|NP_189197.2| protein CHUP1 [Arabidopsis thaliana] gi|334185625|ref|NP_001189974.1| protein CHUP1 [Arabidopsis thaliana] gi|75273319|sp|Q9LI74.1|CHUP1_ARATH RecName: Full=Protein CHUP1, chloroplastic; AltName: Full=Protein CHLOROPLAST UNUSUAL POSITIONING 1 gi|11994760|dbj|BAB03089.1| unnamed protein product [Arabidopsis thaliana] gi|28071265|dbj|BAC55960.1| actin binding protein [Arabidopsis thaliana] gi|332643530|gb|AEE77051.1| protein CHUP1 [Arabidopsis thaliana] gi|332643531|gb|AEE77052.1| protein CHUP1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 520 | ||||||
| TAIR|locus:2102385 | 1004 | CHUP1 "CHLOROPLAST UNUSUAL POS | 0.975 | 0.504 | 0.583 | 3.5e-139 | |
| TAIR|locus:2034091 | 573 | AR791 "AT1G52080" [Arabidopsis | 0.590 | 0.535 | 0.337 | 1.8e-39 |
| TAIR|locus:2102385 CHUP1 "CHLOROPLAST UNUSUAL POSITIONING 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1362 (484.5 bits), Expect = 3.5e-139, P = 3.5e-139
Identities = 304/521 (58%), Positives = 347/521 (66%)
Query: 1 MIVRAGFLVAASIAAYAVKQLNLKASNSSAPLTKPSGNGEARFXXXXXXXXXXXXFTCPD 60
M VR GF+VAASIAA VK+LN+K S S KPS NGE + D
Sbjct: 1 MFVRIGFVVAASIAAVTVKRLNVKPSKPS----KPSDNGEG----GDKEQSVDPDYNLND 52
Query: 61 GGLXXXXXXXXXXXXXVKLISSIFDRARGSSSNTDDEDILPEFEDLLSGEIEYQLPID-- 118
L VKLI+S+ ++ RGS S+ D+DILPEFEDLLSGEIEY LP D
Sbjct: 53 KNLQEEEEEEEEE---VKLINSVINQTRGSFSDYLDDDILPEFEDLLSGEIEYPLPDDDN 109
Query: 119 KFDEAEKNKVYETEMADNAXXXXXXXXXXXXXXXXXVXXXXXXXXXXXXXXQESDIVELQ 178
++AEK + YE EMA N V QESDIVELQ
Sbjct: 110 NLEKAEKERKYEVEMAYNDGELERLKQLVKELEEREVKLEGELLEYYGLKEQESDIVELQ 169
Query: 179 RQLKIKTVEIDMLNITINSLQAERKKLQEQIAQSSYVKKELEVARNKIKELQRQIQLDAN 238
RQLKIKTVEIDMLNITINSLQAERKKLQE+++Q+ V+KELEVARNKIKELQRQIQLDAN
Sbjct: 170 RQLKIKTVEIDMLNITINSLQAERKKLQEELSQNGIVRKELEVARNKIKELQRQIQLDAN 229
Query: 239 XXXXXXXXXXXXXXXXXAKEEEAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIEKRE 298
KEEEA+ Q EKRE
Sbjct: 230 QTKGQLLLLKQHVSSLQMKEEEAMNKDTEVERKLKAVQDLEVQVMELKRKNRELQHEKRE 289
Query: 299 LLVKLDAAESKIASLSNMTESEKVAKAREEVNNLRHANDDLLKQVEGLQMNRFGEVEELV 358
L +KLD+AE++IA+LSNMTES+KVAK REEVNNL+H N+DLLKQVEGLQMNRF EVEELV
Sbjct: 290 LSIKLDSAEARIATLSNMTESDKVAKVREEVNNLKHNNEDLLKQVEGLQMNRFSEVEELV 349
Query: 359 YLRWVNACLRYELRNYQAPAGKTSARDLNKSLSPKSQERAKQLMLEYAGSERGQVDTDLE 418
YLRWVNACLRYELRNYQ PAGK SARDL+K+LSPKSQ +AK+LMLEYAGSERGQ DTDLE
Sbjct: 350 YLRWVNACLRYELRNYQTPAGKISARDLSKNLSPKSQAKAKRLMLEYAGSERGQGDTDLE 409
Query: 419 SNFSHPSSPGSEDFDNASIDSSTSKYSNLSKKPSLIQKLKKWGKSKDDTSALSSPARSI- 477
SN+S PSSPGS+DFDNAS+DSSTS++S+ SKKP LIQKLKKWGKSKDD+S SSP+RS
Sbjct: 410 SNYSQPSSPGSDDFDNASMDSSTSRFSSFSKKPGLIQKLKKWGKSKDDSSVQSSPSRSFY 469
Query: 478 SGCXXXXXXXXXXXXGPLESLMLRNTSDSVAITTFGKMDQE 518
G GPLESLM+RN +SVAITTFG++DQE
Sbjct: 470 GGSPGRLSSSMNKQRGPLESLMIRNAGESVAITTFGQVDQE 510
|
|
| TAIR|locus:2034091 AR791 "AT1G52080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00030273001 | SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (959 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00002921001 | • | • | 0.413 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 520 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-05 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 6e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.003 | |
| PLN02939 | 977 | PLN02939, PLN02939, transferase, transferring glyc | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.004 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 56.3 bits (136), Expect = 3e-08
Identities = 71/268 (26%), Positives = 133/268 (49%), Gaps = 12/268 (4%)
Query: 67 KREEEEEEEEVKLISSIFDRARGSSSNTDDEDILPEFEDLLSGEIEYQLPIDKFDEAEKN 126
KRE +E EEE+ + + ++ + +E L EDLL E+ QL + E
Sbjct: 666 KRELKELEEELAELEAQLEKLEEELKSLKNE--LRSLEDLLE-ELRRQLEELERQLEELK 722
Query: 127 KVYETEMADNARELERLRSLVLELQEREVKLEGELLEYYG-LKEQESDIVELQRQLKIKT 185
+ ELE+L+S + EL+E +LE EL E L+E E ++ L+ L
Sbjct: 723 RELAAL----EEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLK 778
Query: 186 VEIDMLNITINSLQAERKKLQEQIAQSSYVKKELEVARNKIKELQRQIQLDANQTKGQLL 245
EI+ L +LQ E ++L+E++ ++ LE +++ + +++ + + + ++
Sbjct: 779 EEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIE 838
Query: 246 LLKQQVSGLQAKEEEAIKKDVELEKKL----KSVKDLEVEVVELKRKNKELQIEKRELLV 301
L++++ L+ + EE K+ EL+++L ++LE E+ EL+ + +EL+ E REL
Sbjct: 839 ELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELES 898
Query: 302 KLDAAESKIASLSNMTESEKVAKAREEV 329
+L + +I L E + R EV
Sbjct: 899 ELAELKEEIEKLRERLEELEAKLERLEV 926
|
Length = 1163 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 520 | |||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.64 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.64 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.62 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.53 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.52 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.42 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.39 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.38 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.37 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.36 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.33 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.33 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.31 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.29 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.27 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.19 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 97.19 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.1 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.07 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.05 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.02 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.0 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.97 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.91 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.85 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.79 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.76 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.71 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.69 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.67 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.66 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.65 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.58 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.58 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.53 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.42 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.4 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.39 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.36 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.13 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.12 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.1 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.06 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.06 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.93 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.92 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.89 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.82 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.79 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.79 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.76 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.76 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.67 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.66 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.65 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 95.65 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 95.56 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.5 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 95.49 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.41 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.29 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.27 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.27 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.22 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.21 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.13 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.02 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.0 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.95 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 94.94 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 94.84 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 94.83 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.82 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.81 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 94.72 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 94.61 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 94.59 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 94.59 | |
| PF11365 | 96 | DUF3166: Protein of unknown function (DUF3166); In | 94.55 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.41 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.18 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.09 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.09 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.07 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.84 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.8 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 93.55 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.43 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 93.35 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.24 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.2 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 93.16 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 93.04 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.0 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 92.84 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 92.81 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.75 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 92.7 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 92.62 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 92.56 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.51 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.49 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 92.44 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 92.43 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.36 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 92.36 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.1 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 92.07 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.01 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 91.95 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.85 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 91.48 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 91.39 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 91.31 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 91.28 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.27 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 91.09 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 91.02 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 90.99 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 90.83 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 90.77 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 90.69 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 90.68 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 90.62 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 90.56 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 90.48 | |
| PF01486 | 100 | K-box: K-box region; InterPro: IPR002487 MADS gene | 90.48 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.44 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.27 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 90.25 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 90.11 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 90.11 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 90.07 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 89.86 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 89.42 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 89.4 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 89.3 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.05 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 89.04 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 88.79 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 88.61 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 88.4 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 88.36 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.33 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 88.25 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 88.05 | |
| PF06632 | 342 | XRCC4: DNA double-strand break repair and V(D)J re | 88.04 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 87.93 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 87.87 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 87.77 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 87.52 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 87.51 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 87.25 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 87.03 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 86.73 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 86.57 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 86.31 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 86.17 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 86.13 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 86.0 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 85.73 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 85.46 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 84.89 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 84.7 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 84.66 | |
| KOG4001 | 259 | consensus Axonemal dynein light chain [Cytoskeleto | 84.31 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 84.02 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 83.99 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 83.82 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 83.66 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 83.58 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.41 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 82.94 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 82.92 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 82.83 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 82.77 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 82.52 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 82.51 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 82.3 | |
| PF04859 | 131 | DUF641: Plant protein of unknown function (DUF641) | 82.2 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 82.19 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 82.18 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 81.49 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 81.49 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 80.88 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 80.85 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 80.84 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 80.83 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 80.82 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 80.65 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 80.31 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 80.17 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 80.12 |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Probab=97.64 E-value=0.054 Score=62.23 Aligned_cols=12 Identities=25% Similarity=0.291 Sum_probs=6.1
Q ss_pred hHHHHHHHHHHhh
Q 046111 394 SQERAKQLMLEYA 406 (520)
Q Consensus 394 SqekAKqLmleya 406 (520)
+.+.|+.+| +|.
T Consensus 556 ~~~~a~~~i-~~l 567 (1164)
T TIGR02169 556 DDAVAKEAI-ELL 567 (1164)
T ss_pred CHHHHHHHH-HHH
Confidence 445566554 444
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. |
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF01486 K-box: K-box region; InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4001 consensus Axonemal dynein light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 520 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-09 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 4e-07 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 7e-07 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 8e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 5e-06 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 5e-05 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 68.0 bits (165), Expect = 4e-12
Identities = 70/496 (14%), Positives = 136/496 (27%), Gaps = 136/496 (27%)
Query: 1 MIVRAGF----LVAASIAAYAVKQ--------LNLKASNSSAPLTKPSGNGEARFEQQQS 48
+ G + +Y V+ LNLK NS + + + + +
Sbjct: 158 V---LGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWT 214
Query: 49 QGKEKQQFTCPDGGLREKKREEEEEEEEVKLISS--------IFDRARGSSSNTDDEDIL 100
D K R + E +L+ S + N +
Sbjct: 215 SR--------SDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLL-------NVQNAKAW 259
Query: 101 PEFE---------------DLLSGEIEYQLPIDKFDEAEKNKVYETEMADNARELERLRS 145
F D LS + +D T E++ L
Sbjct: 260 NAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTL------TP-----DEVKSLLL 308
Query: 146 LVLELQEREVKLEGELLEYYGLKEQESDIVELQRQLKIKTVEIDMLNITINSLQAERKKL 205
L+ + ++ L + + + I D L N KL
Sbjct: 309 KYLDCRPQD------------LPREVLTTNPRRLSI-IAESIRDGLATWDNWKHVNCDKL 355
Query: 206 QEQIAQSSYVKKELEVARNKIKELQRQ------IQLDANQTKGQLLLLKQQVSGLQAKEE 259
I +SS LE A E ++ A+ L L+ V +
Sbjct: 356 TTII-ESSL--NVLEPA-----EYRKMFDRLSVFPPSAHIPTILLSLIWFDV-----IKS 402
Query: 260 EAIKKDVELEKKLKSVKDLEVEVVELKRKNKELQIEKRELLVKLDAAESKIASL-SNMTE 318
+ + +L K S+ ++++ KE I + ++L +L ++ +
Sbjct: 403 DVMVVVNKLHKY--SL---------VEKQPKESTISIPSIYLELKVKLENEYALHRSIVD 451
Query: 319 SEKVAKAREEVNNLRHANDDL---------LKQVEGLQMNRFGEVEELVYL--RWVNACL 367
+ K + ++L D LK +E R + +L R++ +
Sbjct: 452 HYNIPKTFDS-DDLIPPYLDQYFYSHIGHHLKNIE--HPERMTLFRMV-FLDFRFLEQKI 507
Query: 368 RYELRNYQAPAGKTSA-RDLNKSLS------PKSQERAKQLM--LEYAGSE--RGQVDTD 416
R++ + A + + L PK + ++ L + TD
Sbjct: 508 RHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSK-YTD 566
Query: 417 L-ESNFSHPSSPGSED 431
L E+
Sbjct: 567 LLRIALMAEDEAIFEE 582
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 520 | |||
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.17 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.02 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.93 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.76 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.57 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.5 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.34 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.23 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.19 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.51 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.36 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.85 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.42 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 91.94 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 90.69 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 90.46 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 90.28 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 89.59 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 89.38 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 87.01 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 86.79 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 86.62 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 86.02 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 85.3 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 84.53 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.35 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 84.28 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 82.97 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 82.1 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 81.39 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 80.97 |
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
Probab=97.17 E-value=0.099 Score=50.57 Aligned_cols=30 Identities=13% Similarity=0.150 Sum_probs=11.9
Q ss_pred HHhHHHHHHHHHHHhHHHHHHHHHHHHhHH
Q 046111 275 VKDLEVEVVELKRKNKELQIEKRELLVKLD 304 (520)
Q Consensus 275 l~~LE~Ev~ELRr~Nk~LQ~EK~eL~~kL~ 304 (520)
+..||.++.++-.....++.+..++..++.
T Consensus 106 i~~lE~eile~~e~ie~~~~~l~~~~~~l~ 135 (256)
T 3na7_A 106 SNQANREIENLQNEIKRKSEKQEDLKKEML 135 (256)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 344444444444444333333333333333
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00