Citrus Sinensis ID: 046721


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------107
MEQQPHKAHRARQSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQKPNVLSDATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDADVKKGEKFSALAFKKSFGQCTNLIQLVYGKSTPTSATLSKEVQDSSDSEESDDDEFFRPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDSDDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERAKDKQLTRKRQRGERQERYREQDKLKKKIRVH
cccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHHccccccccccEEEEcccEEEEEEEEccccHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccEEEEEEEEEccccccccEEEEcccccEEEcccccccccccccHHHHcccccccccccccccccccccEEccccEEEEccccccccccccccHHHHHHccccccccHHHHHccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEEEEccccHHHHHcccccccEEEEEcccccccccccccccccccEEEEEEEEEEEEEEEEEEEcccccEEEEcccccccEEEEEEEEEcccccccEEEEEEccccccccEEEEEEEEEcccccEEEEEEEEEEcccEEEEEcEEEEEEccccHHHHHcccccEEEEccccccHHHHccccccccccccccccccccEEEEEEccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccHHHHHHHHcccccccccccccEEHHccHHHHHHHHHHHHcHHHHccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEHHHHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccEccccccHHHHHHHHHHHHccccccEEcccccEEEEEcHHccccHHHHHcccccccEEEEEEEEEccccccccEEEEcccccEEEccccccccccccccHHHcccccHHccEEEccccccccEEEEccEEEEEcccccccccccccccHHHHHHHHcHHHHHHHHHHcccEEEEccccccccccccccccccccHccccccccccEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHccccccHHHHHcccccccccHHHHccccccccccHHcccccccccccccccHHccccccHHHHccccHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEccccccEEEEEEccccHHHHHcccccccEEEEcccccccccEEEEEEEccccEEEEEcccEcccEEEEEEEcccccccEEEccccccEEEEEEEccccccccEEEEEEEEccccccEEEEEEEEEEEccccHHHEEEEEEccccHHHHcccEHHcccccccEEEEEEcccEEEEccccHHHHHHHccccccccccccccccccccEEEcHHHHHHHHHHEEEEEcccccccccccccHHHcccccccccccEEHHHHHHHcccccccccccccccEEccccccccccccHHHHHHcccccccccccccccccHHccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcc
meqqphkahrarqsgssakkiskseinkqdkkkpnpkafgfaSSVKAKRSMMRTAEKEQRrlhiptidrsygepppyvvvvqgppqvgKSLLIKCLIKHYtklkvpevrgpvtvvsgkkrrlqfvecpndingmidcAKFADLALLLIDASHGFEMETFEFLNLmqnhglpnvMGVLThldkftdkkkLRKTKQHLKHRfgtelyhgaklfklsgliqgkytkkdiGNLAEFISVMkfhslswrtshpyilvdrfedvtppervhvnnkcdrnvAIYGYlrgcnlkkgtkvhiagagdyslagvtgladpcplpsaakkkglrdkeklfyapmsglgdllydkdavyidiNDHFVQFSEYQDVGVTLVKSLqntkypidkKLEKSIISLFsqkpnvlsdatnnakdmdddteyihgkqyqtregtsnglgekHVAEEMESLhedadvkkgeKFSALAFKKSFGQCTNLIQLvygkstptsatlskevqdssdseesdddeffrpkvegnKKLREVLDGrlfnmdecskfnsygdlksskgeeVYESIRDRfvtgdwskaaqrnqvskgnsegddsddavsgdfedLETVEKHqghikdnsgsnaiENEYESAVERRLKKISLRkeidekdgakfhcgqpneiglVDKMKEEIEFRKQMNIaelndldevtrlelegfrtgtylrlgihdvpfemveyfdpchpvlvggiglgeenvgymqvlktrdpiilsigwrrfqtipvyaiedrngwhrmLKYTPEHMHClamfwgplappqtgvVAIQNFsnnqasfrITATAVVLEFNHevkikkkiklvgypckifkkTALIKDMFTSDLEVAQCegkevrtvsgirGQVKKAAKEeignqpkrkggqpregiarctfedrilMSDVVFMRgwadveiprfynplttamqprDKIWQGMKTIAELRREhnlsipvnkdslykaigrrprkfnplvipkslqaalpfeskpkdipsrkrlflensravvmepqeRKVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERAKDKQLTRKRQRGERQERYREQDKLKKKIRVH
meqqphkahrarqsgssakkiskseinkqdkkkpnpkafgfassvkakrsmmrtaekeqrrlhiptidrsygepPPYVVVVQGPPQVGKSLLIKCLIKHytklkvpevrgpvtvvsgkkrrlQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKhrfgtelyhgaklfklsgliQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPErvhvnnkcdrnvAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSaakkkglrdkEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLfsqkpnvlsdATNNAKDMDDDTEYIHGkqyqtregtsngLGEKHVAEEMESLHEDADVKKGEKFSALAFKKSFGQCTNLIQLVYGKSTPTSATLskevqdssdseesdddeffrpkvegnkklrevldgrlfnmdecskfnsygdlksskgeEVYESIRDrfvtgdwskaaqrnqvskgnsegddsddaVSGDFEDLETVEKhqghikdnsgsnaieNEYESAVERRLKKISLrkeidekdgakfhcgqpneiglvDKMKEEIEFRKQMniaelndldevtRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFnhevkikkkiklvgypcKIFKKTALIKDMFTSDLEVAQCegkevrtvsgirgqvkkaakeeignqpkrkggqpregiARCTFEDRILMSDVVFMRGWADVEIPRfynplttamqprdKIWQGMKTIAELrrehnlsipvnkdslyKAIGRrprkfnplvipkslqaalpfeskpkdipsrkrLFLENSravvmepqerkvHALIQhlklirnekmkkrklkearkrneveaerakdkqltrkrqrgerqeryreqdklkkkirvh
MEQQPHKAHRARQSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSYGEpppyvvvvqgppqvgKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLdkftdkkklrktkqhlkhrFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQKPNVLSDATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDADVKKGEKFSALAFKKSFGQCTNLIQLVYGKSTPTSATLSKEVQdssdseesdddeFFRPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDSDDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLIrnekmkkrklkearkrneVEAERAKDKQLTrkrqrgerqeryreqDKLKKKIRVH
**********************************************************************YGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPL**********DKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLF**************************************************************FSALAFKKSFGQCTNLIQLVYG****************************************VLDGRLFNMDECSKFN*Y***********Y*SIRDRFVTG*******************************************************************************FHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVS****************************IARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPK************************************KVHALIQHLKLI*******************************************************
******K*****************************************************************EPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTH******************HRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADP********************APMSGLGDLLYDKDAVYIDIN***************************************************************************************ESLHEDADVKK*********************************************************************RLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFV******************************************************************************GAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELND*DEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAM**********************************************IPKSLQA****************************PQERKVHALIQHLKL********************************************************
**********************************NPKAFGFASS***************RRLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQKPNVLSDATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDADVKKGEKFSALAFKKSFGQCTNLIQLVYGKSTP**********************FFRPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSK*********************SGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRG**********************EGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMK*************************************************
*********************************PNPK*FGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFS*YQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQ******************************************************************KKSFGQCTNLIQLVYGKST*******************************************FNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSK********************VSGDFEDLET***************************************************NEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKE**************EGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDI**RKRLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERAKDKQLTRKRQRGERQERYREQD*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQQPHKAHRARQSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYSLAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQKPNVLSDATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDADVKKGEKFSALAFKKSFGQCTNLIQLVYGKSTPTSATLSKEVQDSSDSEESDDDEFFRPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDSDDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQVLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLTRKRQRGERQERYREQDKLKKKIRVH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1068 2.2.26 [Sep-21-2011]
O946531121 Ribosome biogenesis prote yes no 0.950 0.905 0.380 0.0
Q14692 1282 Ribosome biogenesis prote yes no 0.373 0.311 0.536 1e-123
Q089651183 Ribosome biogenesis prote yes no 0.389 0.351 0.441 1e-102
Q5VTM2703 Arf-GAP with GTPase, ANK no no 0.084 0.128 0.666 3e-29
A8MV67101 Putative BMS1-like protei no no 0.083 0.881 0.55 1e-27
A8MXU9101 Putative BMS1-like protei no no 0.083 0.881 0.54 3e-27
A8MTN0101 Putative BMS1-like protei no no 0.083 0.881 0.52 2e-25
Q5SWD9803 Pre-rRNA-processing prote no no 0.213 0.283 0.243 2e-16
Q5XGY1815 Pre-rRNA-processing prote N/A no 0.213 0.279 0.249 4e-15
Q2NL82804 Pre-rRNA-processing prote no no 0.167 0.222 0.251 3e-12
>sp|O94653|BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bms1 PE=1 SV=2 Back     alignment and function desciption
 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1139 (38%), Positives = 623/1139 (54%), Gaps = 124/1139 (10%)

Query: 7    KAHRARQSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPT 66
            K H A+ SG  A+K    +++       NPKAF  AS+ +  R  MRTA+  Q++LH+P 
Sbjct: 5    KGHYAKHSGPKAEKKKLKKVSDGSASN-NPKAFAVASAGRMARQAMRTADISQKKLHVPM 63

Query: 67   IDRSYGE-PPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFV 125
            +DR+  E PPP +V V GPP  GKS LIK L++ Y+K  + ++ GP+TVV+GKKRR+ F+
Sbjct: 64   VDRTPDEAPPPVIVAVMGPPGTGKSTLIKSLVRRYSKYTISQITGPITVVAGKKRRITFL 123

Query: 126  ECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTD 185
            ECPND++ MID AK ADL LLLIDA+ GFEMET EFLN++  HG+P +MGVLTHLD F  
Sbjct: 124  ECPNDLSSMIDVAKIADLVLLLIDANFGFEMETMEFLNILAPHGMPRIMGVLTHLDLFKK 183

Query: 186  KKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRT 245
               LR+ K+ LKHRF TELY GAKLF LSG++ G+Y  ++I NL+ FISVMKF  L WR 
Sbjct: 184  TSTLREAKKRLKHRFWTELYQGAKLFYLSGVLNGRYPDREILNLSRFISVMKFRPLRWRN 243

Query: 246  SHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNL-KKGTKVHIAGAGDYSLAGV 304
             HPY+L DR ED+T P  +  N K  R + +YGYL G NL K    VHI G GD+  + V
Sbjct: 244  QHPYLLADRMEDLTLPVDIEQNPKVGRKITLYGYLHGTNLPKHDASVHIPGVGDFVTSDV 303

Query: 305  TGLADPCPLPSAAK--KKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQD 362
            + L DPCP P A K  ++ L +K+KL Y PM+ +G +L+DKD VYI++        E  +
Sbjct: 304  SSLEDPCPPPDADKVRRRRLSEKQKLIYGPMADIGGILFDKDRVYIEVPTSNFSKDENSE 363

Query: 363  VGV--TLVKSLQNTKYP------------------------------IDKKLEKSIISLF 390
             G    +V  LQ  + P                              + +K  +    L 
Sbjct: 364  AGFGERMVMQLQEAQQPLGVDGNSGLQLFSNSDAIDTVDRESSEIDNVGRKTRRQPTGLI 423

Query: 391  SQK-----PNVLSDATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDA 445
            +Q+          D+  N+ D ++D ++          G    +  +  ++  E    D+
Sbjct: 424  NQELIKEDEGAFDDSDVNSADENEDVDFT---------GKIGAINNEDESDNEEVAFADS 474

Query: 446  DVKKGEKF----------------SALAFKKSFGQCTNLIQLVYGKSTPTSATLSKEVQD 489
            D   G +F                +ALA+ +S  +  N+ ++ Y +S       ++   +
Sbjct: 475  DSDLGGQFDDEDSNLRWKEGLASKAALAYSQSGKRRRNIQKIFYDESLSPKDAYAEYKGE 534

Query: 490  SSDSEESD----DDE--FFRPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEV 543
            S+ S ESD    DDE  FF+     N+ +         N ++  +  S    K  +  ++
Sbjct: 535  SAKSSESDLVVSDDEEDFFKVSKVANESISS-------NHEKLMESESDRLSKKWENPQL 587

Query: 544  YESIRDRFVTGDWSKAAQ-RNQVSKGNSEGDDSDDAVSGDFEDLETVEKHQGH-IKDNSG 601
               ++ RF+TG    + + + +VS+ + E         GDFEDLE  E    + ++++SG
Sbjct: 588  LAQLKSRFITGSLLDSIEGQEEVSQDDEE---------GDFEDLEDEENSSDNEMEESSG 638

Query: 602  SNAIENEYESAVERRLK----KISLRKEIDEKDGAKFHCGQPN--EIGLVDKMKEEIEFR 655
            S+      ESA E   +    + + +KE       +   G P   ++    + KE+I  +
Sbjct: 639  SSVTAENEESADEVDFQTEREENARKKEELRLRFEEEDRGDPEKKDVDWYTEEKEKIARQ 698

Query: 656  KQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEEN 715
              +N     D+D  +R E+EG+R GTY+R+ I+DVPFE VE+FD  +PV+VGG+   E+ 
Sbjct: 699  LVINREAFEDMDPESRAEIEGYRAGTYVRIVINDVPFEFVEHFDSRYPVVVGGLLPNEQR 758

Query: 716  VGYMQV-----------LKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHC 764
             G +QV           LKT DP+I S+GWRRFQ+IPVY+I D    +RMLKYTPEHMHC
Sbjct: 759  YGLVQVRIKRHRWHKKILKTNDPLIFSMGWRRFQSIPVYSISDSRTRNRMLKYTPEHMHC 818

Query: 765  LAMFWGPLAPPQTGVVAIQNFSNNQA---SFRITATAVVLEFNHEVKIKKKIKLVGYPCK 821
               F+GP   P +G  A+Q+ +N+ A   SFRI AT  VL  +    I KK+KL G P K
Sbjct: 819  FGTFYGPFVAPNSGFCAVQSVANSFAKAGSFRIAATGSVLNIDQSTDIVKKLKLTGVPYK 878

Query: 822  IFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIA 881
            IFK TA IK MF+S LEVA+ EG  +RTVSGIRGQVKKA  +E G+              
Sbjct: 879  IFKNTAFIKKMFSSPLEVAKFEGANIRTVSGIRGQVKKAVDQEHGH-------------F 925

Query: 882  RCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIP 941
            R TFED+ILMSD+VF+R W  V++ +F   +T  ++     W GM+   E+R E  L  P
Sbjct: 926  RATFEDKILMSDIVFLRAWYPVQVRKFCTMVTNLLETDKTEWNGMRLTGEVRHELGLKTP 985

Query: 942  VNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQER 1001
            +  +S Y+ I R  R FNPL +P SLQA LPF S+ K +  R +      R V++  +ER
Sbjct: 986  LRPNSQYQEIVRPSRHFNPLKVPASLQAQLPFNSRQKALRPRSKPTYMQKRTVLLNAEER 1045

Query: 1002 KVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERAKDKQLTRKRQRGERQERYREQDK 1060
            KV  L+Q +  +  +K  KRK K+A +         K++Q   +++R E+ E + +  K
Sbjct: 1046 KVRDLLQKVMTLHTDKEAKRKAKKAAEHERYHKRMQKEEQAYIEKKREEKAEWFAQHGK 1104




May act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 Back     alignment and function description
>sp|Q08965|BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMS1 PE=1 SV=1 Back     alignment and function description
>sp|Q5VTM2|AGAP9_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 OS=Homo sapiens GN=AGAP9 PE=2 SV=2 Back     alignment and function description
>sp|A8MV67|YO021_HUMAN Putative BMS1-like protein ENSP00000383088 OS=Homo sapiens PE=5 SV=1 Back     alignment and function description
>sp|A8MXU9|YO022_HUMAN Putative BMS1-like protein ENSP00000383048 OS=Homo sapiens PE=5 SV=1 Back     alignment and function description
>sp|A8MTN0|YI027_HUMAN Putative BMS1-like protein ENSP00000382360 OS=Homo sapiens PE=5 SV=1 Back     alignment and function description
>sp|Q5SWD9|TSR1_MOUSE Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus GN=Tsr1 PE=2 SV=1 Back     alignment and function description
>sp|Q5XGY1|TSR1_XENLA Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis GN=tsr1 PE=2 SV=1 Back     alignment and function description
>sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1068
152221761147 BMS1 and NUC121 domain-containing protei 0.967 0.900 0.571 0.0
75237071138 Putative membrane protein [Arabidopsis t 0.958 0.899 0.567 0.0
2226248721130 hypothetical protein OsJ_10724 [Oryza sa 0.982 0.928 0.548 0.0
2181927631130 hypothetical protein OsI_11428 [Oryza sa 0.982 0.928 0.547 0.0
1680412481095 predicted protein [Physcomitrella patens 0.948 0.925 0.535 0.0
255552531825 ribosome biogenesis protein bms1, putati 0.676 0.875 0.600 0.0
224133372 1181 predicted protein [Populus trichocarpa] 0.558 0.504 0.716 0.0
472102311017 unnamed protein product [Tetraodon nigro 0.908 0.953 0.437 0.0
2550702211120 predicted protein [Micromonas sp. RCC299 0.973 0.928 0.417 0.0
3594779191139 PREDICTED: ribosome biogenesis protein B 0.543 0.509 0.679 0.0
>gi|15222176|ref|NP_172157.1| BMS1 and NUC121 domain-containing protein [Arabidopsis thaliana] gi|332189907|gb|AEE28028.1| BMS1 and NUC121 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1162 (57%), Positives = 805/1162 (69%), Gaps = 129/1162 (11%)

Query: 6    HKAHRARQSGSSAKKISKSEINKQDK-----KKPNPKAFGFASSVKAKRSMMRTAEKEQR 60
            H++HR  +SG +A+K  KSE++K+ +     K+ N KAFG  S V AK++    AEKEQ+
Sbjct: 10   HRSHRTPKSGPTARK--KSELDKKKRGISVDKQKNLKAFGVKSVVHAKKAKHHAAEKEQK 67

Query: 61   RLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKR 120
            RLH+P IDR+YGE PP+VVVVQGPP VGKSL+IK L+K +TK  VPEVRGP+T+V GK+R
Sbjct: 68   RLHLPKIDRNYGEAPPFVVVVQGPPGVGKSLVIKSLVKEFTKQNVPEVRGPITIVQGKQR 127

Query: 121  RLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHL 180
            R QFVECPNDIN M+DCAK ADLALL++D S+GFEMETFEFLN+MQ HG P VMGVLTHL
Sbjct: 128  RFQFVECPNDINAMVDCAKVADLALLVVDGSYGFEMETFEFLNIMQVHGFPRVMGVLTHL 187

Query: 181  DKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHS 240
            DKF D KKLRKTK HLKHRF TE+YHGAKLF LSGLI GKYT +++ NLA F+ V+K   
Sbjct: 188  DKFNDVKKLRKTKHHLKHRFWTEIYHGAKLFYLSGLIHGKYTPREVHNLARFVIVIKPQP 247

Query: 241  LSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAGAGDYS 300
            L+WRT+HPY+LVDR EDVTPPE+V ++ KCDRN+ ++GYLRGCN KK  KVHIAG GD+ 
Sbjct: 248  LTWRTAHPYVLVDRLEDVTPPEKVQMDKKCDRNITVFGYLRGCNFKKRMKVHIAGVGDFI 307

Query: 301  LAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEY 360
            +AGVT L DPCPLPSA KKKGLRD++KLFYAPMSG+GDL+YDKDAVYI+IN H VQ+S+ 
Sbjct: 308  VAGVTALTDPCPLPSAGKKKGLRDRDKLFYAPMSGIGDLVYDKDAVYININSHQVQYSKT 367

Query: 361  -------------QDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQKPNVLS--------- 398
                         +DVG  LVKSLQNTKY +D+KL+K+ I+ F +K +  S         
Sbjct: 368  DDGKGEPTNKGKGRDVGEDLVKSLQNTKYSVDEKLDKTFINFFGKKTSASSETKLKAEDA 427

Query: 399  -------------------DATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAE--- 436
                               D   N  +M  +TE IHG + + +      L E    E   
Sbjct: 428  YHSLPEGSDSESQSGDDEEDIVGNESEMKQETE-IHGGRLRRKAIFKTDLNEDDFEEADD 486

Query: 437  -EMESLHED-------------------------ADVKKGEKFSALAFKKSFGQCT---- 466
             E++S   D                         +D   GE        K  G  +    
Sbjct: 487  LELDSYDPDTYDFEEADDAESDDNEVEDGGDDSASDSADGEPGDYQIDDKDSGNISQWKA 546

Query: 467  -----------NLIQLVYGKSTPTSATLSKEVQDSSDSEESDDDEFFRPKVEGNKKLREV 515
                       NL+Q+VYG S+  +  L  E  D SD +ESDD++FF+PK E +K L   
Sbjct: 547  PLKEIARKKNPNLMQIVYGASS-LATPLINENHDISDDDESDDEDFFKPKGEQHKNLGGG 605

Query: 516  LDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDS 575
            LD    N ++CSKF +YG LK+ K +EV ESIRDRF TGDWSKAA R++      EG+D 
Sbjct: 606  LDVGYVNSEDCSKFVNYGYLKNWKEKEVCESIRDRFTTGDWSKAALRDKNLGTGGEGED- 664

Query: 576  DDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFH 635
             D + GDFEDLET EKH+ H    SG+N  ENE E A            E+ E+DG    
Sbjct: 665  -DELYGDFEDLETGEKHKSHENLESGAN--ENEDEDA------------EVVERDGNNPR 709

Query: 636  CGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMV 695
              Q +E G  DK+KE  E  KQ N  E NDLDE TR+EL GFRTGTYLRL IH+VP+EMV
Sbjct: 710  S-QADEPGYADKLKEAQEITKQRNELEYNDLDEETRIELAGFRTGTYLRLEIHNVPYEMV 768

Query: 696  EYFDPCHPVLVGGIGLGEENVGYMQ-----------VLKTRDPIILSIGWRRFQTIPVYA 744
            E+FDPCHP+LVGGIG GE+NVGYMQ           VLKTRDPII+SIGWRR+QTIPV+A
Sbjct: 769  EFFDPCHPILVGGIGFGEDNVGYMQARLKKHRWHKKVLKTRDPIIVSIGWRRYQTIPVFA 828

Query: 745  IEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFN 804
            IEDRNG HRMLKYTPEHMHCLA FWGPL PP TG VA QN SNNQA FRITAT+VVLEFN
Sbjct: 829  IEDRNGRHRMLKYTPEHMHCLASFWGPLVPPNTGFVAFQNLSNNQAGFRITATSVVLEFN 888

Query: 805  HEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEE 864
            H+ +I KKIKLVG PCKI KKTA IKDMFTSDLE+A+ EG  VRTVSGIRGQVKKA K  
Sbjct: 889  HQARIVKKIKLVGTPCKIKKKTAFIKDMFTSDLEIARFEGSSVRTVSGIRGQVKKAGKNM 948

Query: 865  IGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQ 924
            + N+ +       EGIARCTFED+I MSD+VF+R W  VE+P+FYNPLTTA+QPRDK W 
Sbjct: 949  LDNKAE-------EGIARCTFEDQIHMSDMVFLRAWTTVEVPQFYNPLTTALQPRDKTWN 1001

Query: 925  GMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRK 984
            GMKT  ELRRE N+ IPVNKDSLYKAI R+ +KFNPL IPK L+  LPF SKPK+IP RK
Sbjct: 1002 GMKTFGELRRELNIPIPVNKDSLYKAIERKQKKFNPLQIPKRLEKDLPFMSKPKNIPKRK 1061

Query: 985  RLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERAKDKQLTR 1044
            R  LE+ RAV+MEP+ERK H +IQ  +L+++  MKK+K  + +KR E EAE+AK++++ +
Sbjct: 1062 RPSLEDKRAVIMEPKERKEHTIIQQFQLLQHHTMKKKKATDQKKRKEYEAEKAKNEEINK 1121

Query: 1045 KRQRGERQERYREQDKLKKKIR 1066
            KR+R ER++RYRE+DK KKK R
Sbjct: 1122 KRRREERRDRYREEDKQKKKTR 1143




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|7523707|gb|AAF63146.1|AC011001_16 Putative membrane protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222624872|gb|EEE59004.1| hypothetical protein OsJ_10724 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218192763|gb|EEC75190.1| hypothetical protein OsI_11428 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|168041248|ref|XP_001773104.1| predicted protein [Physcomitrella patens subsp. patens] gi|162675651|gb|EDQ62144.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|255552531|ref|XP_002517309.1| ribosome biogenesis protein bms1, putative [Ricinus communis] gi|223543572|gb|EEF45102.1| ribosome biogenesis protein bms1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224133372|ref|XP_002328026.1| predicted protein [Populus trichocarpa] gi|222837435|gb|EEE75814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|47210231|emb|CAF95218.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|255070221|ref|XP_002507192.1| predicted protein [Micromonas sp. RCC299] gi|226522467|gb|ACO68450.1| predicted protein, partial [Micromonas sp. RCC299] Back     alignment and taxonomy information
>gi|359477919|ref|XP_002270164.2| PREDICTED: ribosome biogenesis protein BMS1 homolog [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1068
TAIR|locus:20330501147 AT1G06720 [Arabidopsis thalian 0.538 0.501 0.582 4.7e-302
UNIPROTKB|E1BPP21290 BMS1 "Uncharacterized protein" 0.558 0.462 0.385 5.3e-209
UNIPROTKB|F1NH691304 BMS1 "Uncharacterized protein" 0.435 0.356 0.448 4.2e-207
UNIPROTKB|Q146921282 BMS1 "Ribosome biogenesis prot 0.557 0.464 0.392 1.3e-204
ZFIN|ZDB-GENE-060720-21221 bms1l "BMS1-like, ribosome ass 0.555 0.485 0.376 2.3e-196
UNIPROTKB|E9PTV4 1282 Bms1 "Protein Bms1" [Rattus no 0.414 0.345 0.450 2.7e-191
DICTYBASE|DDB_G0287891 1205 bms1l "BMS1-like ribosome biog 0.412 0.365 0.458 1.5e-190
FB|FBgn00366861159 CG7728 [Drosophila melanogaste 0.418 0.385 0.427 7.6e-189
POMBASE|SPBC31E1.061121 bms1 "GTP binding protein Bms1 0.552 0.526 0.362 9.2e-178
WB|WBGene000220211055 Y61A9LA.10 [Caenorhabditis ele 0.891 0.902 0.375 5.4e-173
TAIR|locus:2033050 AT1G06720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1691 (600.3 bits), Expect = 4.7e-302, Sum P(2) = 4.7e-302
 Identities = 356/611 (58%), Positives = 417/611 (68%)

Query:   467 NLIQLVYGKSTPTSATLSKEVQXXXXXXXXXXXXFFRPKVEGNKKLREVLDGRLFNMDEC 526
             NL+Q+VYG S+  +  L  E              FF+PK E +K L   LD    N ++C
Sbjct:   558 NLMQIVYGASS-LATPLINENHDISDDDESDDEDFFKPKGEQHKNLGGGLDVGYVNSEDC 616

Query:   527 SKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDSDDAVSGDFEDL 586
             SKF +YG LK+ K +EV ESIRDRF TGDWSKAA R++ + G   G+  DD + GDFEDL
Sbjct:   617 SKFVNYGYLKNWKEKEVCESIRDRFTTGDWSKAALRDK-NLGTG-GEGEDDELYGDFEDL 674

Query:   587 ETVEKHQGHIKDNSGSNAIENEYESAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVD 646
             ET EKH+ H    SG+N  ENE E A            E+ E+DG      Q +E G  D
Sbjct:   675 ETGEKHKSHENLESGAN--ENEDEDA------------EVVERDGNNPR-SQADEPGYAD 719

Query:   647 KMKEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLV 706
             K+KE  E  KQ N  E NDLDE TR+EL GFRTGTYLRL IH+VP+EMVE+FDPCHP+LV
Sbjct:   720 KLKEAQEITKQRNELEYNDLDEETRIELAGFRTGTYLRLEIHNVPYEMVEFFDPCHPILV 779

Query:   707 GGIGLGEENVGYMQ-----------VLKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRML 755
             GGIG GE+NVGYMQ           VLKTRDPII+SIGWRR+QTIPV+AIEDRNG HRML
Sbjct:   780 GGIGFGEDNVGYMQARLKKHRWHKKVLKTRDPIIVSIGWRRYQTIPVFAIEDRNGRHRML 839

Query:   756 KYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITATAVVLEFNHEVKIKKKIKL 815
             KYTPEHMHCLA FWGPL PP TG VA QN SNNQA FRITAT+VVLEFNH+ +I KKIKL
Sbjct:   840 KYTPEHMHCLASFWGPLVPPNTGFVAFQNLSNNQAGFRITATSVVLEFNHQARIVKKIKL 899

Query:   816 VGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQ 875
             VG PCKI KKTA IKDMFTSDLE+A+ EG  VRTVSGIRGQVKKA K  + N+ +     
Sbjct:   900 VGTPCKIKKKTAFIKDMFTSDLEIARFEGSSVRTVSGIRGQVKKAGKNMLDNKAE----- 954

Query:   876 PREGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRRE 935
               EGIARCTFED+I MSD+VF+R W  VE+P+FYNPLTTA+QPRDK W GMKT  ELRRE
Sbjct:   955 --EGIARCTFEDQIHMSDMVFLRAWTTVEVPQFYNPLTTALQPRDKTWNGMKTFGELRRE 1012

Query:   936 HNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVV 995
              N+ IPVNKDSLYKAI R+ +KFNPL IPK L+  LPF SKPK+IP RKR  LE+ RAV+
Sbjct:  1013 LNIPIPVNKDSLYKAIERKQKKFNPLQIPKRLEKDLPFMSKPKNIPKRKRPSLEDKRAVI 1072

Query:   996 MEPQERKVHALIQHLKLIXXXXXXXXXXXXXXXXXXVEAERAKDKQLTXXXXXXXXXXXX 1055
             MEP+ERK H +IQ  +L+                   EAE+AK++++             
Sbjct:  1073 MEPKERKEHTIIQQFQLLQHHTMKKKKATDQKKRKEYEAEKAKNEEINKKRRREERRDRY 1132

Query:  1056 XXXDKLKKKIR 1066
                DK KKK R
Sbjct:  1133 REEDKQKKKTR 1143


GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0042254 "ribosome biogenesis" evidence=IEA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
UNIPROTKB|E1BPP2 BMS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH69 BMS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q14692 BMS1 "Ribosome biogenesis protein BMS1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060720-2 bms1l "BMS1-like, ribosome assembly protein (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTV4 Bms1 "Protein Bms1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287891 bms1l "BMS1-like ribosome biogenesis protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0036686 CG7728 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPBC31E1.06 bms1 "GTP binding protein Bms1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
WB|WBGene00022021 Y61A9LA.10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O94653BMS1_SCHPONo assigned EC number0.38010.95030.9054yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00038815001
SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (1139 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00019376001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (1041 aa)
     0.939
GSVIVG00018638001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (452 aa)
     0.934
GSVIVG00034559001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (840 aa)
     0.929
GSVIVG00000661001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (701 aa)
     0.921
GSVIVG00018070001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (540 aa)
     0.917
GSVIVG00000597001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (926 aa)
     0.915
GSVIVG00037695001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (245 aa)
     0.900
GSVIVG00021349001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (905 aa)
     0.892
GSVIVG00007719001
SubName- Full=Chromosome chr3 scaffold_199, whole genome shotgun sequence; (387 aa)
     0.888
GSVIVG00038090001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (182 aa)
     0.883

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1068
COG51921077 COG5192, BMS1, GTP-binding protein required for 40 0.0
cd01882231 cd01882, BMS1, Bms1, an essential GTPase, promotes 1e-131
pfam04950293 pfam04950, DUF663, Protein of unknown function (DU 2e-65
smart0078583 smart00785, AARP2CN, AARP2CN (NUC121) domain 2e-32
pfam0814281 pfam08142, AARP2CN, AARP2CN (NUC121) domain 2e-31
cd00881183 cd00881, GTP_translation_factor, GTP translation f 8e-12
COG5177769 COG5177, COG5177, Uncharacterized conserved protei 2e-08
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 7e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-04
cd04163168 cd04163, Era, E 0.002
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 0.003
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 0.003
>gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  689 bits (1779), Expect = 0.0
 Identities = 353/1119 (31%), Positives = 567/1119 (50%), Gaps = 117/1119 (10%)

Query: 17   SAKKISKSEINKQDKKK-----PNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSY 71
               K SK+E  K  K        N KAF  A+  +  R  MRTA+ E+++LH+P +DR+ 
Sbjct: 4    KKAKHSKAEKKKLKKVMDGKVGNNAKAFAVAAIGQMARQAMRTADIEEKKLHVPMVDRTP 63

Query: 72   GE-PPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPND 130
             + PPP++V V GPP  GKS LI+ L++ +TK  + E+RGP+TVVSGK RR+ F+ECP+D
Sbjct: 64   KDLPPPFIVAVVGPPGTGKSTLIRSLVRRFTKQTIDEIRGPITVVSGKTRRITFLECPSD 123

Query: 131  INGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLR 190
            ++ MID AK ADL LLLID + GFEMET EFLN++ +HG+P V+GV+THLD F +   LR
Sbjct: 124  LHQMIDVAKIADLVLLLIDGNFGFEMETMEFLNILISHGMPRVLGVVTHLDLFKNPSTLR 183

Query: 191  KTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFHSLSWRTSHPYI 250
              K+ LKHRF TE+Y GAKLF LSG+  G+Y  ++I NL+ FISVMKF  L WR  HPY+
Sbjct: 184  SIKKRLKHRFWTEIYQGAKLFYLSGVENGRYPDREILNLSRFISVMKFRPLEWRNMHPYV 243

Query: 251  LVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNL-KKGTKVHIAGAGDYSLAGVTGLAD 309
            L DR +D+T P  +  N K  R + +YGYL G  L +K  +VHI G GD+ +A V  L D
Sbjct: 244  LADRVDDLTLPVDIEQNPKVGRKITVYGYLHGTGLPRKDMEVHIPGVGDFRMADVEVLID 303

Query: 310  PCPLPSAAK--KKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEYQDVGV-- 365
            PCP P A    ++ L  K KL Y+PMS +G +L DKD VYI++        E  + G   
Sbjct: 304  PCPPPDADHGRRRRLSLKSKLIYSPMSDIGGILKDKDRVYIEVPTSNFSKDENSEAGEGE 363

Query: 366  TLVKSLQNTKYPIDKKLEKSIISLFSQKPNV----------------------------- 396
             +   LQ  +      ++   + LFS    +                             
Sbjct: 364  KMKMQLQEIEQDP--GVDGVGLQLFSNSDAIDTVDRESSEIDNVGRKTRRQPTGKAIAEE 421

Query: 397  LSDATNNAKDM-----DDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDAD---VK 448
             S     + D       D+ E +     +      +    + VA + +S  ++++     
Sbjct: 422  TSREDELSFDDSDVSTSDENEDVDFTGKKGAINNEDESDNEEVAFDSDSQFDESEGNLRW 481

Query: 449  KGEKFSALAFKKSFGQCTNLIQLVYGKSTPTSATL------SKEVQDSSDSEESDDDEFF 502
            K    S LA+ +S  +  N+ ++ Y +S      +      S +  +S    + + ++FF
Sbjct: 482  KEGLASKLAYSQSGKRGRNIQKIFYDESLSPEECIEEYKGESAKSSESDLVVQDEPEDFF 541

Query: 503  RPKVEGNKKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQ- 561
                  N+ +    +  + +  E          +  K       ++ RF       + + 
Sbjct: 542  DVSKVANESISSNHEKLMESEFE----------ELKKKWSSLAQLKSRFQKDATLDSIEG 591

Query: 562  RNQVSKGNSEGDDSDDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVE---RRLK 618
              ++ + + +G+  D     +  D E  E     +   +  +A E +YE+  E   R+ +
Sbjct: 592  EEELIQDDEKGNFEDLEDEENSSDNEMEESRGSSVTAENEESADEVDYETEREENARKKE 651

Query: 619  KISLRKEIDEKDGAKFHCGQPNEIGLVDKMKEEIEFRKQMNIAELNDLDEVTRLELEGFR 678
            ++    E++E+        +  ++    + K +IE + ++N +E   +   +R+ +EG+R
Sbjct: 652  ELRGNFELEERGDP-----EKKDVDWYTEEKRKIEEQLKINRSEFETMVPESRVVIEGYR 706

Query: 679  TGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVG-----------YMQVLKTRDP 727
             G Y+R+ +  VP E V+ F+  +P+++GG+   E+ +G           + ++LKT DP
Sbjct: 707  AGRYVRIVLSHVPLEFVDEFNSRYPIVLGGLLPAEKEMGIVQGRIKRHRWHKKILKTNDP 766

Query: 728  IILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSN 787
            +I S+GWRRFQ+IPVY+++D    +RMLKYTPEHMHC   F+GP+ PP TG  A+Q+   
Sbjct: 767  LIFSVGWRRFQSIPVYSMKDSRTRNRMLKYTPEHMHCNVSFYGPVVPPNTGFCAVQSEKG 826

Query: 788  NQASFRITATAVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEV 847
            +   FR+ A   + + N + K+ KK+KLVGYP +I + T  ++DMFTSDLEV + EG  +
Sbjct: 827  D---FRVLALGTITDVNGDAKLVKKLKLVGYPKQIVQNTVFVRDMFTSDLEVLKFEGASL 883

Query: 848  RTVSGIRGQVKKAAKEEIGNQPKRKGGQPREGIARCTFEDRILMSDVVFMRGWADVEIPR 907
            + VSG+RGQVK                  + G  R  FE ++LMSD++ +R +  VE+ R
Sbjct: 884  KAVSGLRGQVKGP--------------HGKNGEYRAVFEGKMLMSDIITLRCFVPVEVHR 929

Query: 908  FYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRKFNPLVIPKSL 967
             + P+   +      W+G++ + E+R    L+      +   +            +P+ +
Sbjct: 930  IFIPVDNLLGK----WRGLRRLHEIRESLGLTHSYAPQNDSSSEEMGYGAEEDYSLPREI 985

Query: 968  QAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMKKRKLKEAR 1027
            ++ LP + +   + SR        R  +  P E +    I+   +    K ++ K +   
Sbjct: 986  ESKLPLDKRSIAVVSR--------RIELPVPPECREKHEIKDRIVKERIKDQEEKERMES 1037

Query: 1028 KRNEVEAERAKDKQLTRKRQRGERQERYREQDK--LKKK 1064
             +   E E  K ++   +R R    + Y+E  K  LKKK
Sbjct: 1038 LQRAKEEEIGKKEKEREQRIRKTIHDNYKEMAKKRLKKK 1076


Length = 1077

>gnl|CDD|206669 cd01882, BMS1, Bms1, an essential GTPase, promotes assembly of preribosomal RNA processing complexes Back     alignment and domain information
>gnl|CDD|218343 pfam04950, DUF663, Protein of unknown function (DUF663) Back     alignment and domain information
>gnl|CDD|129021 smart00785, AARP2CN, AARP2CN (NUC121) domain Back     alignment and domain information
>gnl|CDD|219725 pfam08142, AARP2CN, AARP2CN (NUC121) domain Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1068
COG51921077 BMS1 GTP-binding protein required for 40S ribosome 100.0
KOG1980754 consensus Uncharacterized conserved protein [Funct 100.0
COG5177769 Uncharacterized conserved protein [Function unknow 100.0
PF04950297 DUF663: Protein of unknown function (DUF663); Inte 100.0
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 100.0
COG1159298 Era GTPase [General function prediction only] 99.95
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.87
smart0078583 AARP2CN AARP2CN (NUC121) domain. This domain is th 99.87
PRK15494339 era GTPase Era; Provisional 99.86
PF0814285 AARP2CN: AARP2CN (NUC121) domain; InterPro: IPR012 99.86
PRK00089292 era GTPase Era; Reviewed 99.86
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.83
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.83
CHL00071409 tufA elongation factor Tu 99.82
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.82
PRK12735396 elongation factor Tu; Reviewed 99.81
PRK12736394 elongation factor Tu; Reviewed 99.81
PLN03126478 Elongation factor Tu; Provisional 99.8
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.8
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.8
PLN03127447 Elongation factor Tu; Provisional 99.8
PRK00049396 elongation factor Tu; Reviewed 99.79
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.78
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.77
PRK12317425 elongation factor 1-alpha; Reviewed 99.76
PTZ00141446 elongation factor 1- alpha; Provisional 99.75
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.74
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.73
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.71
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.71
COG1160444 Predicted GTPases [General function prediction onl 99.71
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.7
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.7
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.7
PLN00043447 elongation factor 1-alpha; Provisional 99.69
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.69
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.69
COG0050394 TufB GTPases - translation elongation factors [Tra 99.68
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.67
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.67
PRK10218607 GTP-binding protein; Provisional 99.64
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.64
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.64
COG3276447 SelB Selenocysteine-specific translation elongatio 99.64
COG1160444 Predicted GTPases [General function prediction onl 99.63
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.62
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.62
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.61
COG1217603 TypA Predicted membrane GTPase involved in stress 99.61
KOG0461522 consensus Selenocysteine-specific elongation facto 99.61
PRK04004586 translation initiation factor IF-2; Validated 99.61
PRK05433600 GTP-binding protein LepA; Provisional 99.6
PRK05306787 infB translation initiation factor IF-2; Validated 99.6
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.6
CHL00189742 infB translation initiation factor 2; Provisional 99.6
KOG0460449 consensus Mitochondrial translation elongation fac 99.58
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.58
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.58
PRK00093435 GTP-binding protein Der; Reviewed 99.57
cd00881189 GTP_translation_factor GTP translation factor fami 99.56
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.56
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.56
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.56
PRK12298390 obgE GTPase CgtA; Reviewed 99.55
KOG0462650 consensus Elongation factor-type GTP-binding prote 99.55
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.55
COG2262411 HflX GTPases [General function prediction only] 99.55
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.54
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.53
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.52
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.51
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.51
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.51
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.5
KOG1145683 consensus Mitochondrial translation initiation fac 99.5
PRK03003472 GTP-binding protein Der; Reviewed 99.5
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.5
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.49
COG0218200 Predicted GTPase [General function prediction only 99.47
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.47
KOG0466466 consensus Translation initiation factor 2, gamma s 99.47
KOG1951115 consensus GTP-binding protein AARP2 involved in 40 99.47
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.47
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.46
PRK12296500 obgE GTPase CgtA; Reviewed 99.45
PRK12299335 obgE GTPase CgtA; Reviewed 99.45
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.45
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.45
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.45
PRK03003472 GTP-binding protein Der; Reviewed 99.44
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.44
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.44
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.43
COG1084346 Predicted GTPase [General function prediction only 99.43
PRK13351687 elongation factor G; Reviewed 99.43
COG0486454 ThdF Predicted GTPase [General function prediction 99.43
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 99.42
PRK12739691 elongation factor G; Reviewed 99.42
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.41
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.4
PRK07560731 elongation factor EF-2; Reviewed 99.39
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.39
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.39
PRK11058426 GTPase HflX; Provisional 99.39
PRK04213201 GTP-binding protein; Provisional 99.39
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.38
PRK00093435 GTP-binding protein Der; Reviewed 99.38
PRK09866741 hypothetical protein; Provisional 99.38
PRK00007693 elongation factor G; Reviewed 99.38
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.38
PRK12297424 obgE GTPase CgtA; Reviewed 99.38
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.38
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.37
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.37
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.37
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.36
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.36
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.35
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.35
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.34
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.34
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.34
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.33
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.32
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.32
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.32
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.32
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.32
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.31
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.31
PRK12740668 elongation factor G; Reviewed 99.3
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.3
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.3
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.3
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.29
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.29
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.29
PRK09554772 feoB ferrous iron transport protein B; Reviewed 99.29
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.29
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.29
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.28
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.28
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.28
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.28
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.28
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.27
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.27
PRK148451049 translation initiation factor IF-2; Provisional 99.27
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.27
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.27
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.26
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.26
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.26
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.26
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.26
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.26
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.25
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.25
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.25
PLN00116843 translation elongation factor EF-2 subunit; Provis 99.25
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.25
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.24
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.24
PTZ00369189 Ras-like protein; Provisional 99.24
PTZ00416836 elongation factor 2; Provisional 99.24
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.24
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.23
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.23
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.23
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.23
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.22
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.22
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.22
PRK00741526 prfC peptide chain release factor 3; Provisional 99.22
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.21
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.21
COG5258527 GTPBP1 GTPase [General function prediction only] 99.2
TIGR00503527 prfC peptide chain release factor 3. This translat 99.2
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.2
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.2
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.2
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.2
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.2
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.19
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.19
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.19
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.19
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.19
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.19
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.18
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.17
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.17
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.16
PLN03118211 Rab family protein; Provisional 99.16
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.16
PTZ00133182 ADP-ribosylation factor; Provisional 99.16
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 99.15
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.15
PLN00223181 ADP-ribosylation factor; Provisional 99.15
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.15
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.15
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.14
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.14
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.13
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.13
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.13
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.13
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.12
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.1
COG1163365 DRG Predicted GTPase [General function prediction 99.1
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.1
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.1
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.1
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.09
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.09
PLN03110216 Rab GTPase; Provisional 99.09
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.09
COG0536369 Obg Predicted GTPase [General function prediction 99.09
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.08
KOG0410410 consensus Predicted GTP binding protein [General f 99.08
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.08
cd01896233 DRG The developmentally regulated GTP-binding prot 99.08
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.08
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.05
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.05
cd04105203 SR_beta Signal recognition particle receptor, beta 99.04
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.04
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.03
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.03
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.02
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.02
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.02
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.01
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.0
PLN03108210 Rab family protein; Provisional 99.0
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.98
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.96
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 98.92
COG3596296 Predicted GTPase [General function prediction only 98.91
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.91
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.91
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.91
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.9
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.87
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.87
KOG0467887 consensus Translation elongation factor 2/ribosome 98.86
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.85
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.83
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.82
PRK09602396 translation-associated GTPase; Reviewed 98.82
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.82
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.81
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.81
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.8
PRK09435332 membrane ATPase/protein kinase; Provisional 98.79
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.78
PTZ00258390 GTP-binding protein; Provisional 98.78
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.77
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.76
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.75
KOG0459501 consensus Polypeptide release factor 3 [Translatio 98.75
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.75
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.74
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.74
PRK09601364 GTP-binding protein YchF; Reviewed 98.73
PRK13768253 GTPase; Provisional 98.7
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 98.68
KOG0468971 consensus U5 snRNP-specific protein [Translation, 98.68
COG2229187 Predicted GTPase [General function prediction only 98.67
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.66
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.63
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.63
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.62
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.58
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.54
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 98.53
KOG1143591 consensus Predicted translation elongation factor 98.51
KOG0463641 consensus GTP-binding protein GP-1 [General functi 98.5
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.49
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 98.46
KOG0078207 consensus GTP-binding protein SEC4, small G protei 98.45
COG1100219 GTPase SAR1 and related small G proteins [General 98.44
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.43
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 98.43
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.42
PLN00023334 GTP-binding protein; Provisional 98.4
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.36
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.36
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 98.31
KOG0469842 consensus Elongation factor 2 [Translation, riboso 98.3
COG0012372 Predicted GTPase, probable translation factor [Tra 98.28
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.28
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.25
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 98.24
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.2
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.19
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.17
KOG0464753 consensus Elongation factor G [Translation, riboso 98.16
KOG2486320 consensus Predicted GTPase [General function predi 98.14
KOG0090238 consensus Signal recognition particle receptor, be 98.13
COG5019373 CDC3 Septin family protein [Cell division and chro 98.1
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.1
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 98.09
KOG0394210 consensus Ras-related GTPase [General function pre 98.08
KOG0465721 consensus Mitochondrial elongation factor [Transla 98.05
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 98.05
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.04
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.03
KOG0395196 consensus Ras-related GTPase [General function pre 98.02
KOG0098216 consensus GTPase Rab2, small G protein superfamily 98.01
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 98.01
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.97
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.97
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.96
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.94
KOG0095213 consensus GTPase Rab30, small G protein superfamil 97.92
PRK10416318 signal recognition particle-docking protein FtsY; 97.92
KOG0080209 consensus GTPase Rab18, small G protein superfamil 97.91
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.85
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 97.83
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 97.81
KOG0093193 consensus GTPase Rab3, small G protein superfamily 97.8
PTZ00099176 rab6; Provisional 97.79
TIGR00064272 ftsY signal recognition particle-docking protein F 97.79
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.77
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.77
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.77
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.74
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.73
COG1161322 Predicted GTPases [General function prediction onl 97.7
PRK09563287 rbgA GTPase YlqF; Reviewed 97.67
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.66
PRK14974336 cell division protein FtsY; Provisional 97.64
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.64
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.63
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.63
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.6
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 97.58
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.55
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.55
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 97.54
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.52
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.51
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.49
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 97.48
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 97.47
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.43
PRK00771437 signal recognition particle protein Srp54; Provisi 97.43
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 97.42
cd02036179 MinD Bacterial cell division requires the formatio 97.41
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.4
KOG0079198 consensus GTP-binding protein H-ray, small G prote 97.39
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.38
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.36
cd03111106 CpaE_like This protein family consists of proteins 97.34
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.33
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.32
KOG3883198 consensus Ras family small GTPase [Signal transduc 97.32
KOG1491391 consensus Predicted GTP-binding protein (ODN super 97.28
KOG0091213 consensus GTPase Rab39, small G protein superfamil 97.27
PRK13796365 GTPase YqeH; Provisional 97.27
KOG0086214 consensus GTPase Rab4, small G protein superfamily 97.27
cd03110179 Fer4_NifH_child This protein family's function is 97.26
cd03114148 ArgK-like The function of this protein family is u 97.26
PRK09563287 rbgA GTPase YlqF; Reviewed 97.19
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.18
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.17
PRK12289352 GTPase RsgA; Reviewed 97.16
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.16
PRK10867433 signal recognition particle protein; Provisional 97.13
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.11
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.08
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 97.05
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 97.03
cd03112158 CobW_like The function of this protein family is u 97.03
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.02
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.98
PRK12288347 GTPase RsgA; Reviewed 96.98
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 96.97
PRK12289352 GTPase RsgA; Reviewed 96.96
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.95
KOG2423572 consensus Nucleolar GTPase [General function predi 96.93
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.91
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.9
cd03115173 SRP The signal recognition particle (SRP) mediates 96.86
PRK00098298 GTPase RsgA; Reviewed 96.82
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.79
TIGR00959428 ffh signal recognition particle protein. This mode 96.73
KOG0088218 consensus GTPase Rab21, small G protein superfamil 96.71
KOG4252246 consensus GTP-binding protein [Signal transduction 96.7
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.69
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.65
PRK11537318 putative GTP-binding protein YjiA; Provisional 96.62
KOG2484435 consensus GTPase [General function prediction only 96.61
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.58
PRK01889356 GTPase RsgA; Reviewed 96.55
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 96.54
PRK00098298 GTPase RsgA; Reviewed 96.52
COG1162301 Predicted GTPases [General function prediction onl 96.51
KOG0097215 consensus GTPase Rab14, small G protein superfamil 96.47
PRK13796365 GTPase YqeH; Provisional 96.43
KOG3905473 consensus Dynein light intermediate chain [Cell mo 96.4
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 96.36
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.35
KOG1534273 consensus Putative transcription factor FET5 [Tran 96.3
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.24
KOG0081219 consensus GTPase Rab27, small G protein superfamil 96.2
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 96.2
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.14
PHA02518211 ParA-like protein; Provisional 96.1
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 96.08
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 96.04
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 95.94
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 95.91
KOG0780483 consensus Signal recognition particle, subunit Srp 95.89
PRK12288347 GTPase RsgA; Reviewed 95.85
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 95.77
COG0523323 Putative GTPases (G3E family) [General function pr 95.74
KOG1533290 consensus Predicted GTPase [General function predi 95.64
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 95.38
PRK13695174 putative NTPase; Provisional 95.38
KOG4181491 consensus Uncharacterized conserved protein [Funct 95.36
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 95.36
TIGR033481169 VI_IcmF type VI secretion protein IcmF. Members of 95.16
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.07
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 95.06
PF05729166 NACHT: NACHT domain 95.02
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 94.98
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.96
PRK08099399 bifunctional DNA-binding transcriptional repressor 94.89
KOG3886295 consensus GTP-binding protein [Signal transduction 94.74
PF00004132 AAA: ATPase family associated with various cellula 94.7
smart00382148 AAA ATPases associated with a variety of cellular 94.5
KOG0781587 consensus Signal recognition particle receptor, al 94.47
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.26
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.17
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.17
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.02
KOG1673205 consensus Ras GTPases [General function prediction 94.02
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 93.97
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 93.97
COG4987573 CydC ABC-type transport system involved in cytochr 93.81
cd02117212 NifH_like This family contains the NifH (iron prot 93.81
KOG2484435 consensus GTPase [General function prediction only 93.8
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.43
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.37
PRK13849231 putative crown gall tumor protein VirC1; Provision 93.35
COG35231188 IcmF Type VI protein secretion system component Va 93.22
PRK08727233 hypothetical protein; Validated 93.18
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.1
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.1
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 93.09
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 92.97
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 92.97
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 92.91
KOG2203772 consensus GTP-binding protein [General function pr 92.76
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 92.75
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.64
KOG0052391 consensus Translation elongation factor EF-1 alpha 92.6
PRK01889356 GTPase RsgA; Reviewed 92.57
PF00005137 ABC_tran: ABC transporter This structure is on hol 92.55
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.45
PRK05480209 uridine/cytidine kinase; Provisional 92.39
PRK14737186 gmk guanylate kinase; Provisional 92.36
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 92.28
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.24
COG1136226 SalX ABC-type antimicrobial peptide transport syst 92.24
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 92.22
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 92.16
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 92.16
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 92.11
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 92.09
PRK09270229 nucleoside triphosphate hydrolase domain-containin 92.08
COG1117253 PstB ABC-type phosphate transport system, ATPase c 92.07
TIGR03029274 EpsG chain length determinant protein tyrosine kin 92.02
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 92.0
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 91.82
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 91.63
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 91.62
COG1341398 Predicted GTPase or GTP-binding protein [General f 91.58
COG3638258 ABC-type phosphate/phosphonate transport system, A 91.58
PRK11519719 tyrosine kinase; Provisional 91.56
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 91.54
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.53
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 91.44
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 91.39
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.39
PF05879742 RHD3: Root hair defective 3 GTP-binding protein (R 91.32
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 91.26
PRK14495452 putative molybdopterin-guanine dinucleotide biosyn 91.1
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 91.06
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 91.05
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.04
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 91.03
COG4167267 SapF ABC-type antimicrobial peptide transport syst 91.02
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 90.95
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 90.88
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 90.88
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 90.88
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=6.4e-194  Score=1607.56  Aligned_cols=991  Identities=36%  Similarity=0.615  Sum_probs=836.0

Q ss_pred             CCCCCCCCCCCCCCCcchhhhccccccccccCCCCCccccccchHHHHHHHHHHHHHHHHhccCCcccccC-CCCCCeEE
Q 046721            1 MEQQPHKAHRARQSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTAEKEQRRLHIPTIDRSY-GEPPPYVV   79 (1068)
Q Consensus         1 m~~~~~K~Hr~~~~g~k~~kkk~~~~~~~~~~~~n~kaf~~~~~~~~~r~~rr~~~k~~kr~~v~~~~R~~-~~~pP~~V   79 (1068)
                      |+ ++|++|++      |++|+.+|.. .+..|+|+|||++++..+++|++.|..+..++++|+|.++|++ ..+||++|
T Consensus         1 md-e~~~kh~k------a~~k~~~k~~-dg~~g~naKafavAa~G~mar~~~rtadi~ekklhVPmvdrtp~d~PPPfIv   72 (1077)
T COG5192           1 MD-EKKAKHSK------AEKKKLKKVM-DGKVGNNAKAFAVAAIGQMARQAMRTADIEEKKLHVPMVDRTPKDLPPPFIV   72 (1077)
T ss_pred             Cc-chhhhhhh------HHHhhhhhhh-ccccccchhhhhhhchHHHHHHHhhccchhhhccccccccCCcccCCCCeEE
Confidence            54 66777763      3333322111 1236889999999999999999999999999999999999997 56788899


Q ss_pred             EEECCCCCChhHHHHHHHhccccCCCCceeccEEEEeCCCeeEEEEeCCCChhHHHHHHHhcCEEEEEEeCCCCCchhHH
Q 046721           80 VVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVVSGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETF  159 (1068)
Q Consensus        80 aVVG~pnvGKSTLIn~L~~~~~~~~~~tt~~~Iti~~~~k~rl~fIDtPGdl~smld~akvADlVLlVIDas~g~e~~t~  159 (1068)
                      ||||+||+||||||++|+..++..++...+||||+++++.++|+|+.||.|+++|+|.+++||+|||+||+++||++++.
T Consensus        73 avvGPpGtGKsTLirSlVrr~tk~ti~~i~GPiTvvsgK~RRiTflEcp~Dl~~miDvaKIaDLVlLlIdgnfGfEMETm  152 (1077)
T COG5192          73 AVVGPPGTGKSTLIRSLVRRFTKQTIDEIRGPITVVSGKTRRITFLECPSDLHQMIDVAKIADLVLLLIDGNFGFEMETM  152 (1077)
T ss_pred             EeecCCCCChhHHHHHHHHHHHHhhhhccCCceEEeecceeEEEEEeChHHHHHHHhHHHhhheeEEEeccccCceehHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCcEEEEEeCCCcCCcHHHHHHHHHHHHHHhcccccCCCeEEEEecccCCcCCchhhcchHHHHHHhhcc
Q 046721          160 EFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAEFISVMKFH  239 (1068)
Q Consensus       160 eiL~~L~~~GlP~vIvVLNKiDlvk~~k~l~~vkk~Lk~~~~~e~~~~~kVf~ISAl~g~~y~~~ei~nLlR~I~~~k~r  239 (1068)
                      +||++|..||+|+|++|++++|++++...++.+++.|+++||+++++++++||+|++.++.|+..++.||+|||+++++|
T Consensus       153 EFLnil~~HGmPrvlgV~ThlDlfk~~stLr~~KKrlkhRfWtEiyqGaKlFylsgV~nGRYpDreilnLsRfisVMKfR  232 (1077)
T COG5192         153 EFLNILISHGMPRVLGVVTHLDLFKNPSTLRSIKKRLKHRFWTEIYQGAKLFYLSGVENGRYPDREILNLSRFISVMKFR  232 (1077)
T ss_pred             HHHHHHhhcCCCceEEEEeecccccChHHHHHHHHHHhhhHHHHHcCCceEEEecccccCCCCCHHHHHHHHHHhhhccc
Confidence            99999999999999999999999998899999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCeEEEEeEEecCCCccccccCCCCceEEEEEEEEeeee-cCCcEEEEecCCCeeEEeeecCCCCCCCChh--
Q 046721          240 SLSWRTSHPYILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNL-KKGTKVHIAGAGDYSLAGVTGLADPCPLPSA--  316 (1068)
Q Consensus       240 ~l~wR~~rPylLadrved~~~~~~i~~~~~~~gtl~VtGyVRG~~L-~~nqlVhIpG~GdfqIk~I~~~~DP~pl~~~--  316 (1068)
                      |+.||+.|||+|++|++++|-|..++++++.++.++||||++|++| +....|||||+|||.+..|+.++||||.|.+  
T Consensus       233 Pl~Wrn~HPy~laDR~~Dlt~p~~ieq~~kv~rki~vYGYlhGt~Lp~~d~~vHIpGvGDf~~adve~L~DPcPp~~a~~  312 (1077)
T COG5192         233 PLEWRNMHPYVLADRVDDLTLPVDIEQNPKVGRKITVYGYLHGTGLPRKDMEVHIPGVGDFRMADVEVLIDPCPPPDADH  312 (1077)
T ss_pred             ccccccCCceeehhhhccccchhhhhhccccCceEEEEEEecCCCCCCCCceEeccCccccchhhhhhcCCCCCCCcccc
Confidence            9999999999999999999999999999999999999999999999 7788899999999999999999999997764  


Q ss_pred             hhcccccccccccccCCCCCCCccccCCceeeeccccccccccc----cccchhhhhccccCCchhhhhhhhcccccccC
Q 046721          317 AKKKGLRDKEKLFYAPMSGLGDLLYDKDAVYIDINDHFVQFSEY----QDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQ  392 (1068)
Q Consensus       317 ~kkr~l~~k~k~iyaPms~vg~~~~dkda~yi~~~~~~~~~~~~----~~~~~~~v~~lq~~~~~~~~~l~~~~~~lf~~  392 (1068)
                      .++|+|++|+++||+||||+|||++|||+|||+++.+  +|+..    .|+|+.|+..||.+...+.  ....+++||++
T Consensus       313 ~rrRrLs~k~KliY~PMsdiGGil~dKD~vyiev~~~--n~s~~~~~eaGegekm~~~lq~~eq~~g--~dgvglqlFsn  388 (1077)
T COG5192         313 GRRRRLSLKSKLIYSPMSDIGGILKDKDRVYIEVPTS--NFSKDENSEAGEGEKMKMQLQEIEQDPG--VDGVGLQLFSN  388 (1077)
T ss_pred             hhhcccchhhceeecccccccceeecccceeeecccc--CcCcCcccccchhhHHHHHHhhhccCCC--cCceeeEEecC
Confidence            3667899999999999999999999999999999988  45553    6999999999998876655  34578999999


Q ss_pred             CCCCCcccccCCCCCCchh---------------hh---hcccccccccC-CCC----------------CCCCcchhhh
Q 046721          393 KPNVLSDATNNAKDMDDDT---------------EY---IHGKQYQTREG-TSN----------------GLGEKHVAEE  437 (1068)
Q Consensus       393 ~~~~~~~~~~~~~~~d~~~---------------~~---~~~~~~~~~~~-~~~----------------~~~~~~~~ee  437 (1068)
                      +..++..+-+   .|+-|+               ++   ++.-.|.+++- .++                .++++.++.-
T Consensus       389 sd~~d~~d~e---~~eid~~gr~t~rqp~Gk~i~eE~~~~Del~~dd~~~~~~De~ed~d~~~~~~~~nn~~e~~~e~~a  465 (1077)
T COG5192         389 SDAIDTVDRE---SSEIDNVGRKTRRQPTGKAIAEETSREDELSFDDSDVSTSDENEDVDFTGKKGAINNEDESDNEEVA  465 (1077)
T ss_pred             Ccchhhcccc---cccccccccccccCCCCcchhhhhccccccCcccccccccccccccccccccccccCcccccchhhc
Confidence            7665432110   011000               00   00001111000 000                0111111111


Q ss_pred             hhccccccccccccchhhhhhhhhcc----------cCCcccccccCCCC-chhcccccccCCCCCC-----CccCCCCc
Q 046721          438 MESLHEDADVKKGEKFSALAFKKSFG----------QCTNLIQLVYGKST-PTSATLSKEVQDSSDS-----EESDDDEF  501 (1068)
Q Consensus       438 ~~~~~~~~~~~~~~~~~~~~~k~~~~----------~~~~l~~~vyg~~~-~~~~~~~w~~d~~~~~-----~~~~~~~~  501 (1068)
                      .+.+..+     ++..+...|++.++          +..|+.+++|..+. |.+.++.|..++++..     .++++++|
T Consensus       466 ~dsDSqf-----dese~~~~w~~~~a~kl~~sqs~kr~~ni~ki~y~e~lspeeci~e~kge~~~s~e~~~v~~D~~edf  540 (1077)
T COG5192         466 FDSDSQF-----DESEGNLRWKEGLASKLAYSQSGKRGRNIQKIFYDESLSPEECIEEYKGESAKSSESDLVVQDEPEDF  540 (1077)
T ss_pred             ccccccc-----ccccccchhhhhhhhhhhhhhcccccccccceeccccCCHHHHHHHhccccccccccccccccCchhh
Confidence            1111111     11135678998766          56799999999987 7788889965433222     24667889


Q ss_pred             cccccccccchhhcccccccCccccccccCC---CcCCCCCchhhHHHHHhhhccCCchhhhhhccccCCCCCCCCCCCc
Q 046721          502 FRPKVEGNKKLREVLDGRLFNMDECSKFNSY---GDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGNSEGDDSDDA  578 (1068)
Q Consensus       502 f~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~---~~~~~w~~~~~~~~i~~~fvtg~~~~~~~~~~~~~~~~~~~~~~~e  578 (1068)
                      |++.+...++..          .+-.++.+.   .-...|..   +..|+.+|.++...+..+       ..++.. .|.
T Consensus       541 f~vsk~~n~~~s----------~~~ek~~~~~fe~L~kkw~s---~~~lk~RF~~~~~lds~e-------g~EEl~-qd~  599 (1077)
T COG5192         541 FDVSKVANESIS----------SNHEKLMESEFEELKKKWSS---LAQLKSRFQKDATLDSIE-------GEEELI-QDD  599 (1077)
T ss_pred             hhhhhhcccccc----------cchhhhchhHHHHHHHHHhh---HHHHHHHhhccccccccc-------chhhhh-hch
Confidence            997644332220          011111110   01245644   567899999975432100       111111 233


Q ss_pred             ccCCcccchhhhhhcCccCCCC-C--------CCccchhhH-HHHHHHHHHHHhhhhhhhhcCcccCCCCCCCCCcchHH
Q 046721          579 VSGDFEDLETVEKHQGHIKDNS-G--------SNAIENEYE-SAVERRLKKISLRKEIDEKDGAKFHCGQPNEIGLVDKM  648 (1068)
Q Consensus       579 ~~~dfedle~~e~~~~~~~~~~-~--------~~~~~~e~~-~~~~~~~~k~~lk~~f~~~y~~~~~~~~~~~~~~~~~~  648 (1068)
                      +.|+|||++..|.......++. +        +..++-.++ +++.++.+|+.||.+|..+-+|   +.+...-+||..+
T Consensus       600 E~gn~ed~~d~e~~~d~e~ees~G~s~t~~~~e~~~e~~~e~ErE~na~kKE~lr~~Fe~eer~---d~e~~d~dwy~~e  676 (1077)
T COG5192         600 EKGNFEDLEDEENSSDNEMEESRGSSVTAENEESADEVDYETEREENARKKEELRGNFELEERG---DPEKKDVDWYTEE  676 (1077)
T ss_pred             hccCcccccccccccccchhhccCCcccccchhhccccchHHHhhhhhhhhhhhhcceeehhcc---CccccccchHHHH
Confidence            4588999987664332211111 1        111222244 6777899999999999988876   2334677899999


Q ss_pred             hhhhHHHHHHhHHHhcCChhhhHhhhcCCCCCcEEEEEEecCchhhhhccCCCCceeeeeccccccceeEEEE-------
Q 046721          649 KEEIEFRKQMNIAELNDLDEVTRLELEGFRTGTYLRLGIHDVPFEMVEYFDPCHPVLVGGIGLGEENVGYMQV-------  721 (1068)
Q Consensus       649 ke~~~~~~~~~~~ef~~~d~~~r~~~eG~~~G~yvri~i~~vp~e~~~~fdp~~pli~~gLl~~E~~~~~~~~-------  721 (1068)
                      |+.+.+|..+|..+|+.|+++.|+.+|||++|+||||.|+.||.+||++|||.||||+|||||.|.+||+||.       
T Consensus       677 K~ki~~ql~inr~e~e~M~Pe~r~~Ieg~raG~YVriv~~~vP~efv~~fn~r~piV~GGlLp~E~~~giVq~rikrhrW  756 (1077)
T COG5192         677 KRKIEEQLKINRSEFETMVPESRVVIEGYRAGRYVRIVLSHVPLEFVDEFNSRYPIVLGGLLPAEKEMGIVQGRIKRHRW  756 (1077)
T ss_pred             HHHHHHHHhhhhhhhhhcCCcceeEeecccccceEEEEeccCCHHHHhhcCCCCcEEeccccchhhhhhhhhhHHHHhHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999       


Q ss_pred             ----eccCCcEEEEeeeeeeeeeeeeeeecCCCceeEEeecCCCcEEEEEEEeecCCCCceEEEEEecCCCCCceEEEEE
Q 046721          722 ----LKTRDPIILSIGWRRFQTIPVYAIEDRNGWHRMLKYTPEHMHCLAMFWGPLAPPQTGVVAIQNFSNNQASFRITAT  797 (1068)
Q Consensus       722 ----lkskdpli~s~GwRRfq~~Piys~~~~n~r~r~lky~p~~~~c~atf~gPi~~~~t~~l~~~~~~~~~~~fri~at  797 (1068)
                          |||+||||||+|||||||+||||+.|+.+|+|||||||+||||.++||||+++||||||++|+.   .+.|||+|+
T Consensus       757 hKKILKTNdPlifS~GWRRFQsiPvys~~DsrTRnRMlKYTPEhmhCn~sFYGP~v~pntgFc~Vqse---~g~frv~a~  833 (1077)
T COG5192         757 HKKILKTNDPLIFSVGWRRFQSIPVYSMKDSRTRNRMLKYTPEHMHCNVSFYGPVVPPNTGFCAVQSE---KGDFRVLAL  833 (1077)
T ss_pred             HHHHhccCCCeEEEechhhhcccceeeecchhhhhhhhhcCccceeeeeeeecCccCCCCCceeEEec---CCceEEEEe
Confidence                9999999999999999999999999999999999999999999999999999999999999984   456999999


Q ss_pred             EEEecccccceeeeeEEEecceeeEeeceEEEeccCCChhhhccccCCeeeecccccceeeccccccccCCCCCCCCCCC
Q 046721          798 AVVLEFNHEVKIKKKIKLVGYPCKIFKKTALIKDMFTSDLEVAQCEGKEVRTVSGIRGQVKKAAKEEIGNQPKRKGGQPR  877 (1068)
Q Consensus       798 G~vl~~d~~~~i~KklkL~G~P~Ki~k~ta~ik~MF~s~~eV~~F~~~~l~T~sGirG~IK~~l~~~~~~~~~~~~~~~p  877 (1068)
                      |+|.++|.+..|||||||+|||++|++||||||+||+|.+||++|+||+|+||||+||+||.|+|+              
T Consensus       834 g~i~dv~~~~~lvkklklvg~p~qi~qnt~fvrdmfts~lev~kfega~lk~vsglrgqvk~~~~k--------------  899 (1077)
T COG5192         834 GTITDVNGDAKLVKKLKLVGYPKQIVQNTVFVRDMFTSDLEVLKFEGASLKAVSGLRGQVKGPHGK--------------  899 (1077)
T ss_pred             eeeEeccccHHHHhhhhhccCcHHHhhhhHhHHHhhhhhhHHHhhcccceeeeccccccccCccCC--------------
Confidence            999999999999999999999999999999999999999999999999999999999999999998              


Q ss_pred             CceEEEeecccccccCEEEEecccccccCcccccccccCCCCCccccccccHHHHHHHcCCCCCCCCCCCCccccCCCCC
Q 046721          878 EGIARCTFEDRILMSDVVFMRGWADVEIPRFYNPLTTAMQPRDKIWQGMKTIAELRREHNLSIPVNKDSLYKAIGRRPRK  957 (1068)
Q Consensus       878 ~G~fra~Fe~ki~~~D~V~l~~~~~v~~~~fynpv~~~l~~~~~~w~~mrt~~~lr~e~~~~~~~~~ds~Y~~i~r~~r~  957 (1068)
                      +|++||.||++|+|||||.||+|+||.+++||+||+|||+    .|+|+|.++|+|...|+..|.++||.|-.+||-.++
T Consensus       900 ~g~yra~fe~kmlmsdii~lr~~~pv~v~r~~~pv~~ll~----~wrglr~~~eir~sl~l~~~~~p~~~~~~~e~~~~~  975 (1077)
T COG5192         900 NGEYRAVFEGKMLMSDIITLRCFVPVEVHRIFIPVDNLLG----KWRGLRRLHEIRESLGLTHSYAPQNDSSSEEMGYGA  975 (1077)
T ss_pred             CccchheeccchhhhheeeEEeeeeeEEEEeeccHHHHHH----HHhhhHHHHHHHHHhCCCCCCCCCccchhhhhhccc
Confidence            9999999999999999999999999999999999999996    599999999999999999999999999999999999


Q ss_pred             CCCCCCCHhhHhhCCCCCCCCCCcccccccccccccccCChhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 046721          958 FNPLVIPKSLQAALPFESKPKDIPSRKRLFLENSRAVVMEPQERKVHALIQHLKLIRNEKMKKRKLKEARKRNEVEAERA 1037 (1068)
Q Consensus       958 f~~l~ipk~l~~~LPf~~kpk~~~~~~~~~~~~~ravv~~~~ekk~~~l~~~l~ti~~~k~~k~~~~~~~~~~~~~~~~~ 1037 (1068)
                      |+.+.+|+.+|+.|||+        +++.+++.+|+||+-|.|++....+|..-++-+-|..++|++++-.++++.++.+
T Consensus       976 ~~~~~~pr~ie~~lp~~--------kr~~~~~srr~~~~~~~e~r~k~~ik~~i~~~r~kd~~~ke~~~s~~r~k~~~i~ 1047 (1077)
T COG5192         976 EEDYSLPREIESKLPLD--------KRSIAVVSRRIELPVPPECREKHEIKDRIVKERIKDQEEKERMESLQRAKEEEIG 1047 (1077)
T ss_pred             cccccCcHhHHhhCCcc--------hhhhhheeeeeeccCChhhhHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHh
Confidence            99999999999999998        4556789999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 046721         1038 KDKQLTRKRQRGERQERYREQDKLKKK 1064 (1068)
Q Consensus      1038 ~~e~~~~~~~k~~~k~~~~~~~~~~~~ 1064 (1068)
                      |.|++|.+|.|+.+++.|++.+|++-+
T Consensus      1048 k~e~er~qr~r~~~~d~~~e~~kkr~k 1074 (1077)
T COG5192        1048 KKEKEREQRIRKTIHDNYKEMAKKRLK 1074 (1077)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhh
Confidence            999999999999999999999999744



>KOG1980 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5177 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04950 DUF663: Protein of unknown function (DUF663); InterPro: IPR007034 This domain is found at the C terminus of the ribosome biogenesis protein BMS1 and TSR1 families, which may act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>smart00785 AARP2CN AARP2CN (NUC121) domain Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PF08142 AARP2CN: AARP2CN (NUC121) domain; InterPro: IPR012948 This domain is the central domain of AARP2 (asparagine and aspartate rich protein 2) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1951 consensus GTP-binding protein AARP2 involved in 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1068
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 66.4 bits (161), Expect = 4e-11
 Identities = 85/651 (13%), Positives = 171/651 (26%), Gaps = 191/651 (29%)

Query: 3   QQPHKAHRAR-------QSGSSAKKISKSEINKQDKKKPNPKAFGFASSVKAKRSMMRTA 55
                                   +    E+ + +        + F  S         + 
Sbjct: 56  MSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRIN--------YKFLMSPIKTEQRQPSM 107

Query: 56  EKEQRRLHIPTIDRSYGEPPPYVVVVQGPPQVGKSLLIKCLIKHYTKLKVPEVRGPVTVV 115
                R++I   DR Y +   +         V +      L +   +L+      P   V
Sbjct: 108 M---TRMYIEQRDRLYNDNQVFA-----KYNVSRLQPYLKLRQALLELR------PAKNV 153

Query: 116 SGKKRRLQFVECPNDINGMIDCAKFADLALLLIDASHGFEMETFEF----LNLMQNHGLP 171
                          I+G++   K   +AL +   S+  +    +F    LNL   +   
Sbjct: 154 L--------------IDGVLGSGKTW-VALDVC-LSYKVQ-CKMDFKIFWLNLKNCNSPE 196

Query: 172 NVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTELYHGAKLFKLSGLIQGKYTKKDIGNLAE 231
            V+ +L  L    D     ++      +            +L  L++ K  +        
Sbjct: 197 TVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQA----ELRRLLKSKPYE-------- 244

Query: 232 FISVMKFHSLSWRTSHPYILVDRFEDVTPPERV-HVNNKCD-----RNVAIYGYLRGCNL 285
                  + L        +++    +V   +     N  C      R   +  +L     
Sbjct: 245 -------NCL--------LVLL---NVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATT 286

Query: 286 KKGTKVHIAGA--GDYS---LAGVTGLADPCPLPSAAKKKGLRDKEKLFYAPM--SGLGD 338
              +  H +     D     L           LP                 P   S + +
Sbjct: 287 THISLDHHSMTLTPDEVKSLLLKYLDCRPQD-LPREVLTT----------NPRRLSIIAE 335

Query: 339 LLYDKDAVYIDINDHFVQFSEYQDVGVTLVKSLQNTKYPIDKKLEKSIISLFSQ----KP 394
            + D     +   D++        +   +  SL   +    +K+   + S+F        
Sbjct: 336 SIRD----GLATWDNWKHV-NCDKLTTIIESSLNVLEPAEYRKMFDRL-SVFPPSAHIPT 389

Query: 395 NVLS----DATNNAKDMDDDTEYIHGKQYQTREGTSNGLGEKHVAEEMESLHEDADVKKG 450
            +LS    D   +  D+      +H             L EK   E   S+         
Sbjct: 390 ILLSLIWFDVIKS--DVMVVVNKLHKY----------SLVEKQPKESTISIPS------- 430

Query: 451 EKFSALAFKKSFGQCTNLIQLVYGKSTPTSATLSKEVQDS-SDSEESDDDEFFRPKVEGN 509
                             I L           L + + D  +  +  D D+   P     
Sbjct: 431 ------------------IYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPY---- 468

Query: 510 KKLREVLDGRLFNMDECSKFNSYGDLKSSKGEEVYESIRDRFVTGDWSKAAQRNQVSKGN 569
                 LD   ++         +  LK+ +  E     R  F+   + +   R+  +  N
Sbjct: 469 ------LDQYFYS------HIGH-HLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWN 515

Query: 570 SEGDDSDDAVSGDFEDLETVEKHQGHIKDNSGSNAIENEYESAVERRLKKI 620
           + G   +         L+ ++ ++ +I DN      + +Y    ER +  I
Sbjct: 516 ASGSILNT--------LQQLKFYKPYICDN------DPKY----ERLVNAI 548


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1068
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.82
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.82
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.81
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.8
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.78
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.78
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.78
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.77
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.76
3avx_A1289 Elongation factor TS, elongation factor TU, linke 99.75
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.73
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.72
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.72
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.72
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.71
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.7
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.68
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.68
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.62
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.6
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.59
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.58
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.58
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.57
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.56
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.55
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.51
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.51
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.5
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.49
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.48
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.48
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.47
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.47
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.47
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.47
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.47
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.46
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.46
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.46
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.45
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.45
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.45
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.44
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.44
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.43
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.43
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.42
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.42
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.42
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.42
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.42
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.41
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.41
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.41
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.41
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.41
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.41
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.41
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.41
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.41
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.4
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.4
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.4
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.39
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.39
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.39
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.39
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.39
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.38
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.38
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.38
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.38
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.38
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.38
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.38
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.37
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.37
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.37
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.37
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.37
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.37
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.37
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.36
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.36
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.36
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.36
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.36
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.35
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.35
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.35
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.35
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.35
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.35
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.35
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.35
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.35
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.35
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.35
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.35
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.35
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.35
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.34
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.34
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.34
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.34
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.34
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.34
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.34
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.34
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.34
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.34
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.34
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.33
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.33
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.32
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.32
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.32
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.31
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.31
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.31
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.31
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.3
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.3
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.3
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.3
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.29
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.29
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.29
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.29
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.29
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.29
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.29
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.28
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.28
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.28
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.28
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.28
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.27
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.27
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.27
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.26
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.26
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.26
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.26
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.26
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.25
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.25
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.25
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.25
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.25
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.24
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.24
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.24
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.23
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.23
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.23
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.23
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.22
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.22
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.22
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.21
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.18
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.18
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.17
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.17
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.76
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.14
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.13
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.12
2ged_A193 SR-beta, signal recognition particle receptor beta 99.11
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.11
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.09
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.09
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.09
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.08
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.08
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.07
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.05
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.04
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.04
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.01
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.01
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.0
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.98
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.92
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.92
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.89
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.84
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.82
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.79
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.79
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.79
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.73
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.69
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.69
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.63
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.62
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.46
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.45
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.44
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.41
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.39
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.35
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.34
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.21
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.19
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.15
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 98.11
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.97
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.93
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.68
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.61
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.54
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.43
2xxa_A433 Signal recognition particle protein; protein trans 97.39
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.33
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.3
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.23
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.14
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.13
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.06
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.99
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.92
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.89
2og2_A359 Putative signal recognition particle receptor; nuc 96.85
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.82
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.81
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.79
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.72
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.63
3cnl_A262 YLQF, putative uncharacterized protein; circular p 96.63
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 96.53
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 96.48
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 96.46
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.23
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 96.22
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 96.2
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.15
3cwq_A209 Para family chromosome partitioning protein; alpha 96.13
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 96.08
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.02
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 95.86
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 95.82
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 95.55
3end_A307 Light-independent protochlorophyllide reductase ir 95.34
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.31
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 94.37
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.17
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 94.17
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 94.11
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.03
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.89
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 93.83
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.76
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.74
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.72
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.71
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.64
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 93.48
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.46
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.41
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.32
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.23
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 93.17
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.04
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.0
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.97
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.85
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.84
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.62
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.53
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.44
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 92.39
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 92.37
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.28
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.18
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 92.14
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.11
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.01
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 91.91
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.86
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 91.86
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.82
1g6h_A257 High-affinity branched-chain amino acid transport 91.79
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.72
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 91.71
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 91.66
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.65
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 91.6
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.6
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 91.54
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 91.46
1ji0_A240 ABC transporter; ATP binding protein, structural g 91.44
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.4
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.4
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 91.39
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.36
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 91.36
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 91.31
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 91.3
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 91.26
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 91.24
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 91.22
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.18
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.16
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.08
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 91.0
2ghi_A260 Transport protein; multidrug resistance protein, M 90.99
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.92
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.92
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.91
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.9
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.77
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 90.71
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 90.71
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 90.71
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 90.66
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.66
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.64
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.63
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.55
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 90.52
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.48
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 90.48
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 90.48
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.35
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.31
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.24
2chg_A226 Replication factor C small subunit; DNA-binding pr 90.22
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 90.17
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.16
3bos_A242 Putative DNA replication factor; P-loop containing 90.16
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.12
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.12
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.06
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.05
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 90.04
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 89.92
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.79
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 89.78
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.73
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 89.71
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.6
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.57
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.55
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 89.55
3vaa_A199 Shikimate kinase, SK; structural genomics, center 89.55
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.47
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 89.25
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 89.24
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.2
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.18
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 89.16
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 89.1
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 89.1
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 89.04
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.01
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 88.88
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 88.87
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 88.82
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 88.77
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 88.64
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 88.55
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 88.48
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 88.46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 88.44
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 88.17
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.16
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.1
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 88.08
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 87.98
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 87.86
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 87.72
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 87.69
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.65
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 87.59
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 87.54
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.52
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 87.52
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 87.51
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 87.47
3kta_A182 Chromosome segregation protein SMC; structural mai 87.42
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 87.4
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 87.4
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 87.39
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.37
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.35
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 87.35
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.32
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.27
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.14
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.1
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 87.04
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.98
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 86.98
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 86.98
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 86.91
3tlx_A243 Adenylate kinase 2; structural genomics, structura 86.89
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 86.86
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 86.74
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 86.72
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 86.7
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.67
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 86.64
2vli_A183 Antibiotic resistance protein; transferase, tunica 86.64
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 86.57
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 86.41
2kjq_A149 DNAA-related protein; solution structure, NESG, st 86.4
1xjc_A169 MOBB protein homolog; structural genomics, midwest 86.34
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.32
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.31
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 86.28
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.24
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 86.15
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 85.89
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 85.89
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 85.82
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.8
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.77
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 85.72
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 85.43
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.32
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 85.3
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 85.18
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 85.16
1p9r_A418 General secretion pathway protein E; bacterial typ 85.16
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 85.06
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.93
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 84.89
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 84.79
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.71
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 84.65
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 84.43
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 84.27
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.21
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 84.15
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 84.02
3r20_A233 Cytidylate kinase; structural genomics, seattle st 84.02
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 83.98
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 83.97
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 83.97
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 83.88
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 83.88
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 83.83
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 83.81
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 83.71
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 83.7
2oap_1511 GSPE-2, type II secretion system protein; hexameri 83.53
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 83.51
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.44
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 83.4
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 83.38
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 83.36
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 83.31
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 83.26
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 83.03
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 83.0
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 82.95
1via_A175 Shikimate kinase; structural genomics, transferase 82.92
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 82.73
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 82.71
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 82.48
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 82.31
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 82.28
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 82.25
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 82.21
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 82.19
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 82.15
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 82.14
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 81.86
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 81.85
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 81.72
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 81.7
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 81.68
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 81.68
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 81.48
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 81.43
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 81.26
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 80.88
2z43_A324 DNA repair and recombination protein RADA; archaea 80.74
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 80.59
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 80.31
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 80.26
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
Probab=100.00  E-value=8.2e-34  Score=335.64  Aligned_cols=203  Identities=17%  Similarity=0.259  Sum_probs=141.7

Q ss_pred             CCeEEEEECCCCCChhHHHHHHHhcc----ccCCCCceeccEEE------EeCCCeeEEEEeCCC--Chh-HHHHHHHhc
Q 046721           75 PPYVVVVQGPPQVGKSLLIKCLIKHY----TKLKVPEVRGPVTV------VSGKKRRLQFVECPN--DIN-GMIDCAKFA  141 (1068)
Q Consensus        75 pP~~VaVVG~pnvGKSTLIn~L~~~~----~~~~~~tt~~~Iti------~~~~k~rl~fIDtPG--dl~-smld~akvA  141 (1068)
                      ++..|+|+|++|+|||||+++|++..    ......+...++|+      ....+..++|+||||  ++. .|+..+..|
T Consensus        18 ~~~~I~iiG~~d~GKSTLi~~L~~~~~~~~~d~~~~e~~~GiTi~~~~~~~~~~~~~i~iiDtPGh~~~~~~~~~~~~~a   97 (482)
T 1wb1_A           18 KNINLGIFGHIDHGKTTLSKVLTEIASTSAHDKLPESQKRGITIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADII   97 (482)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHTTC--------------------CCCEEEETTEEEEECCCSSHHHHHHHHHHHTTSC
T ss_pred             CCCEEEEECCCCChHHHHHHHHHCCCcccccccccccccCccEEecceEEEEECCEEEEEEECCChHHHHHHHHHHHhhC
Confidence            45789999999999999999999865    11111122223442      122467999999999  443 488889999


Q ss_pred             CEEEEEEeCCCCCchhHHHHHHHHHhCCCCcEEEEEeCCCcCCcHHHHHHHHHHHHHHhccc-ccCCCeEEEEecccCCc
Q 046721          142 DLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTE-LYHGAKLFKLSGLIQGK  220 (1068)
Q Consensus       142 DlVLlVIDas~g~e~~t~eiL~~L~~~GlP~vIvVLNKiDlvk~~k~l~~vkk~Lk~~~~~e-~~~~~kVf~ISAl~g~~  220 (1068)
                      |++|||+|++.++..++.+++.++...|+|. |+|+||+|+.. ...+..+.+.+...+... .+...+++++||++|  
T Consensus        98 D~~ilVvda~~g~~~qt~e~l~~~~~~~ip~-IvviNK~Dl~~-~~~~~~~~~~l~~~l~~~~~~~~~~ii~vSA~~g--  173 (482)
T 1wb1_A           98 DLALIVVDAKEGPKTQTGEHMLILDHFNIPI-IVVITKSDNAG-TEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTG--  173 (482)
T ss_dssp             CEEEEEEETTTCSCHHHHHHHHHHHHTTCCB-CEEEECTTSSC-HHHHHHHHHHHHHHHHHSSSGGGCCEEECCTTTC--
T ss_pred             CEEEEEEecCCCccHHHHHHHHHHHHcCCCE-EEEEECCCccc-chhHHHHHHHHHHHHhhhcccccceEEEEECcCC--
Confidence            9999999999999999999999999999995 89999999986 344555666666655443 344678999999965  


Q ss_pred             CCchhhcchHHHHHHhhccc-ccccccCCe-EEEEeEEecCCCccccccCCCCceEEEEEEEEeeeecCCcEEEEec
Q 046721          221 YTKKDIGNLAEFISVMKFHS-LSWRTSHPY-ILVDRFEDVTPPERVHVNNKCDRNVAIYGYLRGCNLKKGTKVHIAG  295 (1068)
Q Consensus       221 y~~~ei~nLlR~I~~~k~r~-l~wR~~rPy-lLadrved~~~~~~i~~~~~~~gtl~VtGyVRG~~L~~nqlVhIpG  295 (1068)
                         ..+..|...|....+.+ +......|+ +.++++..+.          ..|+ +++|.|.++.+++|+.|.+..
T Consensus       174 ---~gI~~L~~~L~~~i~~~~~~~~~~~~~~~~v~~v~~~~----------g~G~-v~~g~v~~G~l~~gd~v~~~p  236 (482)
T 1wb1_A          174 ---FGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIK----------GAGT-VVTGTINKGIVKVGDELKVLP  236 (482)
T ss_dssp             ---TTHHHHHHHHHHHHHHSCCCCCSSSCCBCBCSCEECCS----------SCCC-EECCCCCBSCCCSSEEECCTT
T ss_pred             ---CCHHHHHHHHHHhhcCccccccccccccccceeEEEec----------CCce-EEEEEEEEeEEeeCCEEEECC
Confidence               56777777776655433 121222343 4445554442          2455 478999988899999987643



>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1068
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 8e-08
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 0.002
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]
 Score = 51.5 bits (123), Expect = 8e-08
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 115 VSGKKRRLQFVECP---NDINGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLP 171
               KR    V+CP   + I  MI  A   D A+L++ A+ G   +T E + L +  G+P
Sbjct: 62  YETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVP 121

Query: 172 NVMGVLTHLDKFTDKKKLRKTKQHLKHRFG 201
            ++  +  +D   D + L   +  ++    
Sbjct: 122 YIVVFMNKVDMVDDPELLDLVEMEVRDLLN 151


>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1068
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.8
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.78
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.78
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.75
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.73
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.71
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.69
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.67
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.66
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.63
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.62
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.62
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.61
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.59
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.56
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.53
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.53
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.47
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.47
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.47
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.42
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.41
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.4
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.3
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.3
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.3
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.25
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.21
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.21
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.2
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.19
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.19
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.18
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.17
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.15
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.14
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.11
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.1
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.1
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.1
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.08
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.08
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.07
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.05
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.02
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.01
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.99
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.97
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.97
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.96
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.86
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.82
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.81
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.79
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.55
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.53
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.49
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.44
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.38
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.38
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.36
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.32
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.12
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.07
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.06
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.03
d2qy9a2211 GTPase domain of the signal recognition particle r 98.01
d1vmaa2213 GTPase domain of the signal recognition particle r 97.94
d1okkd2207 GTPase domain of the signal recognition particle r 97.87
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.86
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.53
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.3
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.16
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.96
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 96.87
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.59
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.49
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.24
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.93
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 95.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.91
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.6
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.11
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.08
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.81
d1wb1a279 Elongation factor SelB, domains 2 and 4 {Methanoco 94.64
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.32
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.88
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.68
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.59
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.22
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.96
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.76
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.47
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.44
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.34
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.33
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.11
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.1
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.08
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.89
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.82
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.73
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.66
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.57
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.46
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.38
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.34
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 91.32
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.26
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.26
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.25
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.24
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.18
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.16
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.16
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.07
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.01
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.84
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.65
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.61
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.51
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.47
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.46
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.25
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.15
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.12
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.1
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.1
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.07
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.9
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.78
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.72
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.29
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.29
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 89.08
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.88
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.79
d2hyda1255 Putative multidrug export ATP-binding/permease pro 88.75
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.59
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.04
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.0
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.99
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 87.61
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 87.31
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.29
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.23
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.88
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.82
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.51
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 86.38
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 86.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 86.27
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.82
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 85.76
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 85.35
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.9
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 84.73
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 84.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 83.58
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 82.49
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.93
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.29
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 80.92
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 80.73
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 80.65
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 80.47
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 80.15
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Cow (Bos taurus), mitochondrial [TaxId: 9913]
Probab=99.80  E-value=1.9e-19  Score=186.41  Aligned_cols=144  Identities=21%  Similarity=0.214  Sum_probs=113.0

Q ss_pred             CCeEEEEECCCCCChhHHHHHHHhcc-------------ccCCCCceeccEEEE------eCCCeeEEEEeCCC--Chh-
Q 046721           75 PPYVVVVQGPPQVGKSLLIKCLIKHY-------------TKLKVPEVRGPVTVV------SGKKRRLQFVECPN--DIN-  132 (1068)
Q Consensus        75 pP~~VaVVG~pnvGKSTLIn~L~~~~-------------~~~~~~tt~~~Iti~------~~~k~rl~fIDtPG--dl~-  132 (1068)
                      |..+|||+||+|+|||||+++|++..             ......+...+||+.      ...++.++|+||||  +|. 
T Consensus         2 p~ini~iiGHvd~GKSTL~~~l~~~~~~~~~~~~~~~~~~~~~~~Er~rgiTi~~~~~~~~~~~~~~~~iDtPGh~~f~~   81 (196)
T d1d2ea3           2 PHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVK   81 (196)
T ss_dssp             CEEEEEEESSTTSSHHHHHHHHHHHHHHTTSBCCCCHHHHHSCCEEEETTEEEECEEEEEECSSCEEEEEECSSHHHHHH
T ss_pred             CCcEEEEEeCCCCcHHHHHHHHHHHHHHcCcchhhhhhhcccchhhcCCCccCCcceEEEEeceeeEEeecCcchHHHHH
Confidence            34779999999999999999998631             111222233456642      25688999999999  444 


Q ss_pred             HHHHHHHhcCEEEEEEeCCCCCchhHHHHHHHHHhCCCCcEEEEEeCCCcCCcHHHHHHHHHHHHHHhccc--ccCCCeE
Q 046721          133 GMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMGVLTHLDKFTDKKKLRKTKQHLKHRFGTE--LYHGAKL  210 (1068)
Q Consensus       133 smld~akvADlVLlVIDas~g~e~~t~eiL~~L~~~GlP~vIvVLNKiDlvk~~k~l~~vkk~Lk~~~~~e--~~~~~kV  210 (1068)
                      .|+.++..||++||||||..|+..|+.+++.++...|++++|+|+||+|++.+.+.+..+.+.++.++...  .+...++
T Consensus        82 ~~~~~~~~aD~allVVda~~G~~~QT~~~~~~a~~~~~~~iIv~iNK~D~~~~~~~~~~i~~~i~~~l~~~~~~~~~~pi  161 (196)
T d1d2ea3          82 NMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPI  161 (196)
T ss_dssp             HHHHTSSCCSEEEEEEETTTCSCHHHHHHHHHHHHTTCCCEEEEEECGGGCSCHHHHHHHHHHHHHHHHHTTSCTTTSCE
T ss_pred             HHHHHHhhcCeEEEEEEcCCCCchhHHHHHHHHHHhcCCcEEEEEecccccccHHHHHHHHHHHHHHHHHhCCCcccCEE
Confidence            48899999999999999999999999999999999999889999999999876555666776777766432  2346789


Q ss_pred             EEEecccC
Q 046721          211 FKLSGLIQ  218 (1068)
Q Consensus       211 f~ISAl~g  218 (1068)
                      +++||+.|
T Consensus       162 i~iSa~~g  169 (196)
T d1d2ea3         162 IVGSALCA  169 (196)
T ss_dssp             EECCHHHH
T ss_pred             EEEEcccc
Confidence            99999876



>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb1a2 b.43.3.1 (A:390-468) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure