Citrus Sinensis ID: 048771


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810----
MAMSCKDGKTGSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQHTQSTTLATKDTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKETSSPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
ccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHcccccccccEEEEEcccccccEEEEEEEEEEEccccEEEEEEEccccccccccccccccccEEEcccccEEEEcccccEEEEEEEEEEcccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEccccccccEEEEEEccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHcccccccccccHHccccccccccccccccccccccEEEEEcccccccccEEEEEEEEccccccccccccccHHHHHHHccccccccccccEEEEccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccEEEEcccccccEEEcccHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEccccccEEEccEEEEEEEcccccEEEEEEEEEccEEc
cccccccccccccccccEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEccccccHHHHHcccccccHHHHHHHHcccccccEEEEEccccccHHHEEEEEEEEEcccccEEEEEEEccccccccccccccccHHEccccccEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccEEcccccccEEEEEEcccccccccccccccccccccccEEEHHHHHHHccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccccccccEHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHcccccccccccccEEEEEEcccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHccccEEEEEccccccHHHHHcHHHHHHHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHccccEccccEEEccccccccHHHEEEEEEEccccccEEEEEEEEEEEcc
mamsckdgktgsldngkyvrytPEQVEALERLyhecpkpssiRRQQLIrecpilsniepkqIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYEngyfrqhtqsttlatkdtscesvvtsgqhhltpqhpprdaspagLLSIAEETLTEFLSKATGTAVEwvqmpgmkpgpdsvGIVAISHGCSGVAARacglvgleptRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLkniqngptmppvqhfvraemlpsgylirpcegggsiihivdhmdlepwsvpevlrplyesSTVLAQKTTMAALRQLRQMAQEVTQSsvngwgrrPAALRALSQRLSRGFNeavngftdegwtvmgndgmdDVTVLVNsspdklmglnlsfangfpaVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAikvgpcslpgsrvgtfgsqvilplahtiehEEFMEVIKlegvghspedaimprDMFLLQLCSgmdenavgTCAElifapidasfaddapllpsgfriipldsgketsspnrtldlasaleigpagnratnnystnstcMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALAlspsnissqaglrtplgtpeALTLARWICHSYRCYLGvdllksssegsESILKNLWHHTDavmccslkalpvftfanqAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFAclqggiclssmgrpvsYERAVAWKVLNEEETAHCICFmfinwsfv
mamsckdgktgsldngkyvRYTPEQVEALERLYHecpkpssirrQQLIRECpilsniepkqikvwfQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQhtqsttlatkdtSCESVVTSGqhhltpqhpprDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSlkniqngptmppvQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVtqssvngwgrrPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPldsgketsspnRTLDLASaleigpagnratnnystnstCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSpsnissqaglrtplGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
MAMSCKDGKTGSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQHTQSTTLATKDTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKETSSPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
*****************YVRYTPEQVEALERLYHECPK**SIRRQQLIRECPILSNIEPKQIKVWFQNRRC***********************************VSQLVYENGYFRQ***************************************LSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQL*************GWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIP********************************YSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSP*******GLRTPLGTPEALTLARWICHSYRCYLGVDLLKS*****ESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSF*
***********************EQVEALERLYHE***************CPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRL**********************************************************AEETLTEFLSKATGTAVEWVQ***********************AARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNI************VRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQ***************ALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPD***********GFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFM*VI**************PRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPL*****************************************VMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALAL****************TPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDI****************EFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
*********TGSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRR***********LQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQHTQSTTLATK************************SPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKETSSPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
***************GKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQHTQ*******************************SPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDS***********************************CMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSPS***********LGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMSCKDGKTGSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGYFRQHTQSTTLATKDTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRPRGSAILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKETSSPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query814 2.2.26 [Sep-21-2011]
Q9ZU11836 Homeobox-leucine zipper p yes no 0.995 0.968 0.853 0.0
Q39123833 Homeobox-leucine zipper p no no 0.988 0.966 0.758 0.0
Q6AST1859 Homeobox-leucine zipper p yes no 0.988 0.937 0.676 0.0
A2XK30859 Homeobox-leucine zipper p N/A no 0.988 0.937 0.676 0.0
Q2QM96855 Homeobox-leucine zipper p no no 0.982 0.935 0.655 0.0
A2ZMN9855 Homeobox-leucine zipper p N/A no 0.982 0.935 0.655 0.0
A2WLR5861 Homeobox-leucine zipper p N/A no 0.980 0.926 0.645 0.0
Q5QMZ9868 Homeobox-leucine zipper p no no 0.982 0.921 0.640 0.0
O04291852 Homeobox-leucine zipper p no no 0.990 0.946 0.641 0.0
A2XBL9839 Homeobox-leucine zipper p N/A no 0.986 0.957 0.627 0.0
>sp|Q9ZU11|ATB15_ARATH Homeobox-leucine zipper protein ATHB-15 OS=Arabidopsis thaliana GN=ATHB-15 PE=1 SV=1 Back     alignment and function desciption
 Score = 1469 bits (3802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/840 (85%), Positives = 759/840 (90%), Gaps = 30/840 (3%)

Query: 1   MAMSCKDGKTGSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPK 60
           MAMSCKDGK G LDNGKYVRYTPEQVEALERLYH+CPKPSSIRRQQLIRECPILSNIEPK
Sbjct: 1   MAMSCKDGKLGCLDNGKYVRYTPEQVEALERLYHDCPKPSSIRRQQLIRECPILSNIEPK 60

Query: 61  QIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQH 120
           QIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLV+EN YFRQH
Sbjct: 61  QIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVHENSYFRQH 120

Query: 121 TQSTTLATKDTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEW 180
           T + +L  KDTSCESVVTSGQH L  Q+P RDASPAGLLSIAEETL EFLSKATGTAVEW
Sbjct: 121 TPNPSLPAKDTSCESVVTSGQHQLASQNPQRDASPAGLLSIAEETLAEFLSKATGTAVEW 180

Query: 181 VQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRP------------ 228
           VQMPGMKPGPDS+GI+AISHGC+GVAARACGLVGLEPTRVAEI+KDRP            
Sbjct: 181 VQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPTRVAEIVKDRPSWFRECRAVEVM 240

Query: 229 ------RGSAI------LYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTM 276
                  G  +      LYA TTLAP RDFWLLRYTSVLEDGSLVVCERSLK+ QNGP+M
Sbjct: 241 NVLPTANGGTVELLYMQLYAPTTLAPPRDFWLLRYTSVLEDGSLVVCERSLKSTQNGPSM 300

Query: 277 PPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTT 336
           P VQ+FVRAEML SGYLIRPC+GGGSIIHIVDHMDLE  SVPEVLRPLYES  VLAQKTT
Sbjct: 301 PLVQNFVRAEMLSSGYLIRPCDGGGSIIHIVDHMDLEACSVPEVLRPLYESPKVLAQKTT 360

Query: 337 MAALRQLRQMAQEVTQ--SSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGND 394
           MAALRQL+Q+AQEVTQ  SSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGW+V+G D
Sbjct: 361 MAALRQLKQIAQEVTQTNSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWSVIG-D 419

Query: 395 GMDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRS 454
            MDDVT+ VNSSPDKLMGLNL+FANGF  VSN VLCAKASMLLQNVPPAILLRFLREHRS
Sbjct: 420 SMDDVTITVNSSPDKLMGLNLTFANGFAPVSNVVLCAKASMLLQNVPPAILLRFLREHRS 479

Query: 455 EWADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSP 514
           EWADNNID Y AAA+KVGPCS   +RVG FG QVILPLAHTIEHEEFMEVIKLEG+GHSP
Sbjct: 480 EWADNNIDAYLAAAVKVGPCS---ARVGGFGGQVILPLAHTIEHEEFMEVIKLEGLGHSP 536

Query: 515 EDAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKET 574
           EDAI+PRD+FLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDS KE 
Sbjct: 537 EDAIVPRDIFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSAKEV 596

Query: 575 SSPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQY 634
           SSPNRTLDLASALEIG AG +A+ + S NSTC RSVMTIAFEF  ESHMQEHVA+MARQY
Sbjct: 597 SSPNRTLDLASALEIGSAGTKASTDQSGNSTCARSVMTIAFEFGIESHMQEHVASMARQY 656

Query: 635 VRSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSE 694
           VR IISSVQRVALALSPS+ISSQ GLRTPLGTPEA TLARWIC SYR Y+GV+LLKS+S+
Sbjct: 657 VRGIISSVQRVALALSPSHISSQVGLRTPLGTPEAQTLARWICQSYRGYMGVELLKSNSD 716

Query: 695 GSESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRK 754
           G+ESILKNLWHHTDA++CCS+KALPVFTFANQAGLDMLETTLVALQDI+LEKIFDD+GRK
Sbjct: 717 GNESILKNLWHHTDAIICCSMKALPVFTFANQAGLDMLETTLVALQDISLEKIFDDNGRK 776

Query: 755 ALFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 814
            L +EFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEE AHCICF+FINWSFV
Sbjct: 777 TLCSEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEENAHCICFVFINWSFV 836




Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation. May regulates procambial and vascular tissue formation or maintenance, and vascular development in inflorescence stems.
Arabidopsis thaliana (taxid: 3702)
>sp|Q39123|ATHB8_ARATH Homeobox-leucine zipper protein ATHB-8 OS=Arabidopsis thaliana GN=ATHB-8 PE=1 SV=1 Back     alignment and function description
>sp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. japonica GN=HOX32 PE=2 SV=1 Back     alignment and function description
>sp|A2XK30|HOX32_ORYSI Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. indica GN=HOX32 PE=2 SV=1 Back     alignment and function description
>sp|Q2QM96|HOX33_ORYSJ Homeobox-leucine zipper protein HOX33 OS=Oryza sativa subsp. japonica GN=HOX33 PE=2 SV=1 Back     alignment and function description
>sp|A2ZMN9|HOX33_ORYSI Homeobox-leucine zipper protein HOX33 OS=Oryza sativa subsp. indica GN=HOX33 PE=2 SV=2 Back     alignment and function description
>sp|A2WLR5|HOX29_ORYSI Homeobox-leucine zipper protein HOX29 OS=Oryza sativa subsp. indica GN=HOX29 PE=2 SV=2 Back     alignment and function description
>sp|Q5QMZ9|HOX29_ORYSJ Homeobox-leucine zipper protein HOX29 OS=Oryza sativa subsp. japonica GN=HOX29 PE=2 SV=2 Back     alignment and function description
>sp|O04291|ATB14_ARATH Homeobox-leucine zipper protein ATHB-14 OS=Arabidopsis thaliana GN=ATHB-14 PE=1 SV=1 Back     alignment and function description
>sp|A2XBL9|HOX10_ORYSI Homeobox-leucine zipper protein HOX10 OS=Oryza sativa subsp. indica GN=HOX10 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query814
255549852839 DNA binding protein, putative [Ricinus c 1.0 0.970 0.895 0.0
225442501837 PREDICTED: homeobox-leucine zipper prote 0.998 0.971 0.898 0.0
297743212835 unnamed protein product [Vitis vinifera] 0.996 0.971 0.898 0.0
225442503854 PREDICTED: homeobox-leucine zipper prote 0.998 0.951 0.880 0.0
444436435844 HB1-like protein [Eucalyptus cladocalyx] 1.0 0.964 0.877 0.0
225442505832 PREDICTED: homeobox-leucine zipper prote 0.985 0.963 0.893 0.0
206572105838 putative HB15 HD-ZipIII [Malus x domesti 1.0 0.971 0.878 0.0
449447807837 PREDICTED: homeobox-leucine zipper prote 0.998 0.971 0.878 0.0
224059140851 predicted protein [Populus trichocarpa] 0.998 0.955 0.872 0.0
224074019837 predicted protein [Populus trichocarpa] 0.998 0.971 0.872 0.0
>gi|255549852|ref|XP_002515977.1| DNA binding protein, putative [Ricinus communis] gi|223544882|gb|EEF46397.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1564 bits (4049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/839 (89%), Positives = 784/839 (93%), Gaps = 25/839 (2%)

Query: 1   MAMSCKDGKT-GSLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEP 59
           MAMSCKDGK   +LDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQ IRECPILSNIEP
Sbjct: 1   MAMSCKDGKQPANLDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQFIRECPILSNIEP 60

Query: 60  KQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQ 119
           KQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQ
Sbjct: 61  KQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENGYFRQ 120

Query: 120 HTQSTTLATKDTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVE 179
           HTQ+TTLATKDTSC+SVVTSGQHHLTPQH PRDASPAGLLSIAEETLTEFLSKATGTAVE
Sbjct: 121 HTQNTTLATKDTSCDSVVTSGQHHLTPQHQPRDASPAGLLSIAEETLTEFLSKATGTAVE 180

Query: 180 WVQMPGMKPGPDSVGIVAISHGCSGVAARACGLVGLEPTRVAEILKDRP----------- 228
           WVQMPGMKPGPDS+GI+AISHGC+GVAARACGLVGLEPTRVAEILKDRP           
Sbjct: 181 WVQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPTRVAEILKDRPSWFRDCRAVDV 240

Query: 229 -------RGSAI------LYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPT 275
                   G  I      LYA TTLAPARDFWLLRYTSVLEDGSLV+CERSLKN QNGP+
Sbjct: 241 LNVLPTANGGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVICERSLKNTQNGPS 300

Query: 276 MPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKT 335
           MPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKT
Sbjct: 301 MPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKT 360

Query: 336 TMAALRQLRQMAQEVTQSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDG 395
           TMAALRQLRQ+AQE +QS+V  WGRRPAALRALSQRLSRGFNEA+NGFTDEGW++MGNDG
Sbjct: 361 TMAALRQLRQIAQEASQSNVTNWGRRPAALRALSQRLSRGFNEALNGFTDEGWSMMGNDG 420

Query: 396 MDDVTVLVNSSPDKLMGLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSE 455
           MDDVT+LVNSSP+KLMGLNLSF+NGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSE
Sbjct: 421 MDDVTILVNSSPEKLMGLNLSFSNGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSE 480

Query: 456 WADNNIDVYSAAAIKVGPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPE 515
           WADNNID YSAAAIKVGPC+LPG+R+G+FG QVILPLAHTIEHEEF+EVIKLEG GHSPE
Sbjct: 481 WADNNIDAYSAAAIKVGPCTLPGTRIGSFGGQVILPLAHTIEHEEFLEVIKLEGAGHSPE 540

Query: 516 DAIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGKETS 575
           D IMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDS KE S
Sbjct: 541 DPIMPRDMFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSAKEAS 600

Query: 576 SPNRTLDLASALEIGPAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYV 635
           SPNRTLDLASALEIGPAGN+++ +YS+NS CMRSVMTIAFEFAFESHMQEHVA+MARQYV
Sbjct: 601 SPNRTLDLASALEIGPAGNKSSTDYSSNSGCMRSVMTIAFEFAFESHMQEHVASMARQYV 660

Query: 636 RSIISSVQRVALALSPSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEG 695
           RSIISSVQRVALALSPS+  S AGLRTPLGTPEA TLARWIC SYRCYLGV+LLKSSSEG
Sbjct: 661 RSIISSVQRVALALSPSHSGSHAGLRTPLGTPEAQTLARWICQSYRCYLGVELLKSSSEG 720

Query: 696 SESILKNLWHHTDAVMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKA 755
            ESILK LWHH+DA+MCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRK 
Sbjct: 721 GESILKTLWHHSDAIMCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKT 780

Query: 756 LFAEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 814
           L +EFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEE AHCICFMFINWSFV
Sbjct: 781 LCSEFPQIMQQGFACLQGGICLSSMGRPVSYERAVAWKVLNEEENAHCICFMFINWSFV 839




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442501|ref|XP_002284003.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743212|emb|CBI36079.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442503|ref|XP_002284014.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|444436435|gb|AGE09585.1| HB1-like protein [Eucalyptus cladocalyx] Back     alignment and taxonomy information
>gi|225442505|ref|XP_002284009.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|206572105|gb|ACI13685.1| putative HB15 HD-ZipIII [Malus x domestica] Back     alignment and taxonomy information
>gi|449447807|ref|XP_004141659.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Cucumis sativus] gi|449480641|ref|XP_004155954.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224059140|ref|XP_002299735.1| predicted protein [Populus trichocarpa] gi|60327629|gb|AAX19054.1| class III HD-Zip protein 5 [Populus trichocarpa] gi|222846993|gb|EEE84540.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224074019|ref|XP_002304217.1| predicted protein [Populus trichocarpa] gi|60327631|gb|AAX19055.1| class III HD-Zip protein 6 [Populus trichocarpa] gi|222841649|gb|EEE79196.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query814
TAIR|locus:2034086837 ATHB-15 "AT1G52150" [Arabidops 0.708 0.689 0.871 0.0
TAIR|locus:2134088833 HB-8 "AT4G32880" [Arabidopsis 0.705 0.689 0.75 0.0
TAIR|locus:2061544852 PHB "AT2G34710" [Arabidopsis t 0.705 0.673 0.624 4.5e-286
TAIR|locus:2028140841 PHV "AT1G30490" [Arabidopsis t 0.695 0.673 0.601 7.6e-273
TAIR|locus:2175856842 REV "AT5G60690" [Arabidopsis t 0.954 0.922 0.651 2.6e-269
TAIR|locus:2119048762 ATML1 "AT4G21750" [Arabidopsis 0.240 0.257 0.280 1.4e-23
TAIR|locus:2135368743 PDF2 "AT4G04890" [Arabidopsis 0.257 0.282 0.290 8.1e-23
TAIR|locus:2207235721 HDG2 "AT1G05230" [Arabidopsis 0.084 0.095 0.434 1.5e-18
TAIR|locus:2127008802 ANL2 "ANTHOCYANINLESS 2" [Arab 0.094 0.096 0.383 2.3e-15
TAIR|locus:2098866808 HDG1 "AT3G61150" [Arabidopsis 0.095 0.096 0.388 4e-13
TAIR|locus:2034086 ATHB-15 "AT1G52150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2607 (922.8 bits), Expect = 0., Sum P(2) = 0.
 Identities = 509/584 (87%), Positives = 541/584 (92%)

Query:   234 LYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEMLPSGYL 293
             LYA TTLAP RDFWLLRYTSVLEDGSLVVCERSLK+ QNGP+MP VQ+FVRAEML SGYL
Sbjct:   258 LYAPTTLAPPRDFWLLRYTSVLEDGSLVVCERSLKSTQNGPSMPLVQNFVRAEMLSSGYL 317

Query:   294 IRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALRQLRQMAQEVTQ- 352
             IRPC+GGGSIIHIVDHMDLE  SVPEVLRPLYES  VLAQKTTMAALRQL+Q+AQEVTQ 
Sbjct:   318 IRPCDGGGSIIHIVDHMDLEACSVPEVLRPLYESPKVLAQKTTMAALRQLKQIAQEVTQT 377

Query:   353 -SSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWTVMGNDGMDDVTVLVNSSPDKLM 411
              SSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGW+V+G D MDDVT+ VNSSPDKLM
Sbjct:   378 NSSVNGWGRRPAALRALSQRLSRGFNEAVNGFTDEGWSVIG-DSMDDVTITVNSSPDKLM 436

Query:   412 GLNLSFANGFPAVSNAVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDVYSAAAIKV 471
             GLNL+FANGF  VSN VLCAKASMLLQNVPPAILLRFLREHRSEWADNNID Y AAA+KV
Sbjct:   437 GLNLTFANGFAPVSNVVLCAKASMLLQNVPPAILLRFLREHRSEWADNNIDAYLAAAVKV 496

Query:   472 GPCSLPGSRVGTFGSQVILPLAHTIEHEEFMEVIKLEGVGHSPEDAIMPRDMFLLQLCSG 531
             GPCS   +RVG FG QVILPLAHTIEHEEFMEVIKLEG+GHSPEDAI+PRD+FLLQLCSG
Sbjct:   497 GPCS---ARVGGFGGQVILPLAHTIEHEEFMEVIKLEGLGHSPEDAIVPRDIFLLQLCSG 553

Query:   532 MDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSGK-ETSSPNRTLDLASALEIG 590
             MDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDS K E SSPNRTLDLASALEIG
Sbjct:   554 MDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIPLDSAKQEVSSPNRTLDLASALEIG 613

Query:   591 PAGNRATNNYSTNSTCMRSVMTIAFEFAFESHMQEHVATMARQYVRSIISSVQRVALALS 650
              AG +A+ + S NSTC RSVMTIAFEF  ESHMQEHVA+MARQYVR IISSVQRVALALS
Sbjct:   614 SAGTKASTDQSGNSTCARSVMTIAFEFGIESHMQEHVASMARQYVRGIISSVQRVALALS 673

Query:   651 PSNISSQAGLRTPLGTPEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAV 710
             PS+ISSQ GLRTPLGTPEA TLARWIC SYR Y+GV+LLKS+S+G+ESILKNLWHHTDA+
Sbjct:   674 PSHISSQVGLRTPLGTPEAQTLARWICQSYRGYMGVELLKSNSDGNESILKNLWHHTDAI 733

Query:   711 MCCSLKALPVFTFANQAGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFAC 770
             +CCS+KALPVFTFANQAGLDMLETTLVALQDI+LEKIFDD+GRK L +EFPQIMQQGFAC
Sbjct:   734 ICCSMKALPVFTFANQAGLDMLETTLVALQDISLEKIFDDNGRKTLCSEFPQIMQQGFAC 793

Query:   771 LQGGICLSSMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 814
             LQGGICLSSMGRPVSYERAVAWKVLNEEE AHCICF+FINWSFV
Sbjct:   794 LQGGICLSSMGRPVSYERAVAWKVLNEEENAHCICFVFINWSFV 837


GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;TAS
GO:0005634 "nucleus" evidence=ISM;ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0009855 "determination of bilateral symmetry" evidence=RCA;IMP
GO:0010014 "meristem initiation" evidence=RCA;IMP
GO:0009887 "organ morphogenesis" evidence=RCA;IMP
GO:0010073 "meristem maintenance" evidence=RCA;TAS
GO:0010075 "regulation of meristem growth" evidence=RCA;IMP
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0048263 "determination of dorsal identity" evidence=IMP
GO:0080060 "integument development" evidence=IGI
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010051 "xylem and phloem pattern formation" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2134088 HB-8 "AT4G32880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061544 PHB "AT2G34710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028140 PHV "AT1G30490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175856 REV "AT5G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39123ATHB8_ARATHNo assigned EC number0.75830.98890.9663nono
A2WLR5HOX29_ORYSINo assigned EC number0.64500.98030.9268N/Ano
Q6AST1HOX32_ORYSJNo assigned EC number0.67690.98890.9371yesno
A2XK30HOX32_ORYSINo assigned EC number0.67690.98890.9371N/Ano
Q9ZU11ATB15_ARATHNo assigned EC number0.85350.99500.9688yesno
A2ZMN9HOX33_ORYSINo assigned EC number0.65540.98280.9356N/Ano
A2Z8L4HOX9_ORYSINo assigned EC number0.63640.97050.9404N/Ano
A2XBL9HOX10_ORYSINo assigned EC number0.62790.98640.9570N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
pfam08670148 pfam08670, MEKHLA, MEKHLA domain 7e-83
cd08875229 cd08875, START_ArGLABRA2_like, C-terminal lipid-bi 6e-64
pfam01852205 pfam01852, START, START domain 4e-44
smart00234205 smart00234, START, in StAR and phosphatidylcholine 1e-30
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-17
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-17
smart0038957 smart00389, HOX, Homeodomain 2e-16
cd00177193 cd00177, START, Lipid-binding START domain of mamm 6e-13
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-12
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 4e-05
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-04
cd08868208 cd08868, START_STARD1_3_like, Cholesterol-binding 0.001
>gnl|CDD|219964 pfam08670, MEKHLA, MEKHLA domain Back     alignment and domain information
 Score =  260 bits (667), Expect = 7e-83
 Identities = 85/148 (57%), Positives = 107/148 (72%)

Query: 667 PEALTLARWICHSYRCYLGVDLLKSSSEGSESILKNLWHHTDAVMCCSLKALPVFTFANQ 726
           PEALTLARW+C SYR + G DLL S+    +S+LK LWHH DAV+C SLKA PVF +ANQ
Sbjct: 1   PEALTLARWLCQSYRRHTGRDLLPSADSSGDSLLKALWHHPDAVLCHSLKADPVFNYANQ 60

Query: 727 AGLDMLETTLVALQDITLEKIFDDHGRKALFAEFPQIMQQGFACLQGGICLSSMGRPVSY 786
           A LD+LETT V LQD+   K  ++ GRK   +E  ++MQQGFACL  G+ +SSMGR  S 
Sbjct: 61  AALDLLETTWVELQDLPSRKTAEESGRKERCSELAKVMQQGFACLYSGVRISSMGRRFSI 120

Query: 787 ERAVAWKVLNEEETAHCICFMFINWSFV 814
           E+AVAWK+L+E+   H    MF+NWSF+
Sbjct: 121 EQAVAWKLLDEDGAYHGQAAMFVNWSFL 148


The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins. Length = 148

>gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information
>gnl|CDD|216740 pfam01852, START, START domain Back     alignment and domain information
>gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|176877 cd08868, START_STARD1_3_like, Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 814
cd08875229 START_ArGLABRA2_like C-terminal lipid-binding STAR 100.0
PF08670148 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK 100.0
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.68
smart00234206 START in StAR and phosphatidylcholine transfer pro 99.63
PF01852206 START: START domain; InterPro: IPR002913 START (St 99.58
KOG0843197 consensus Transcription factor EMX1 and related HO 99.49
KOG0488309 consensus Transcription factor BarH and related HO 99.49
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.48
KOG0489261 consensus Transcription factor zerknullt and relat 99.48
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.46
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.4
KOG0850245 consensus Transcription factor DLX and related pro 99.38
KOG0848317 consensus Transcription factor Caudal, contains HO 99.38
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.37
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.36
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.35
KOG0493342 consensus Transcription factor Engrailed, contains 99.32
KOG0494332 consensus Transcription factor CHX10 and related H 99.31
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.28
COG5576156 Homeodomain-containing transcription factor [Trans 99.19
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.17
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.16
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.11
KOG0847288 consensus Transcription factor, contains HOX domai 99.07
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.07
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.05
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.04
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.02
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.01
cd00177193 START Lipid-binding START domain of mammalian STAR 98.94
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 98.92
cd08904204 START_STARD6-like Lipid-binding START domain of ma 98.91
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 98.78
cd08871222 START_STARD10-like Lipid-binding START domain of m 98.76
KOG0490235 consensus Transcription factor, contains HOX domai 98.7
cd08905209 START_STARD1-like Cholesterol-binding START domain 98.63
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.56
PLN00188719 enhanced disease resistance protein (EDR2); Provis 98.46
cd08906209 START_STARD3-like Cholesterol-binding START domain 98.42
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.41
KOG0849354 consensus Transcription factor PRD and related pro 98.35
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.31
cd08909205 START_STARD13-like C-terminal lipid-binding START 98.23
cd08902202 START_STARD4-like Lipid-binding START domain of ma 98.11
KOG0775304 consensus Transcription factor SIX and related HOX 98.04
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 97.87
cd08908204 START_STARD12-like C-terminal lipid-binding START 97.73
cd08874205 START_STARD9-like C-terminal START domain of mamma 97.66
cd08910207 START_STARD2-like Lipid-binding START domain of ma 97.55
cd08907205 START_STARD8-like C-terminal lipid-binding START d 97.44
KOG0774334 consensus Transcription factor PBX and related HOX 97.39
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 97.31
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.28
cd08872235 START_STARD11-like Ceramide-binding START domain o 97.25
cd08873235 START_STARD14_15-like Lipid-binding START domain o 97.21
KOG0490235 consensus Transcription factor, contains HOX domai 97.14
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 97.07
cd08870209 START_STARD2_7-like Lipid-binding START domain of 97.01
KOG2252558 consensus CCAAT displacement protein and related h 96.99
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 96.92
cd08911207 START_STARD7-like Lipid-binding START domain of ma 96.78
cd08913240 START_STARD14-like Lipid-binding START domain of m 96.7
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 96.52
cd08914236 START_STARD15-like Lipid-binding START domain of m 96.38
PRK13557 540 histidine kinase; Provisional 96.09
cd08871222 START_STARD10-like Lipid-binding START domain of m 95.62
KOG11461406 consensus Homeobox protein [General function predi 94.9
PRK13559 361 hypothetical protein; Provisional 94.74
cd08904204 START_STARD6-like Lipid-binding START domain of ma 94.53
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 94.24
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 93.77
PRK11091 779 aerobic respiration control sensor protein ArcB; P 93.04
KOG0773342 consensus Transcription factor MEIS1 and related H 93.03
cd08874205 START_STARD9-like C-terminal START domain of mamma 92.78
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 92.75
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 92.71
PRK09413121 IS2 repressor TnpA; Reviewed 92.67
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 92.06
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 91.8
cd00177193 START Lipid-binding START domain of mammalian STAR 91.53
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 91.14
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 90.79
cd08907205 START_STARD8-like C-terminal lipid-binding START d 90.67
smart0034044 HALZ homeobox associated leucin zipper. 89.77
PRK13558 665 bacterio-opsin activator; Provisional 89.35
PRK13560 807 hypothetical protein; Provisional 89.33
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 88.81
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 88.74
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 88.48
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 88.45
KOG4196135 consensus bZIP transcription factor MafK [Transcri 86.49
cd08909205 START_STARD13-like C-terminal lipid-binding START 86.3
smart00234206 START in StAR and phosphatidylcholine transfer pro 85.38
cd08908204 START_STARD12-like C-terminal lipid-binding START 84.97
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 84.79
cd08906209 START_STARD3-like Cholesterol-binding START domain 84.41
smart0033865 BRLZ basic region leucin zipper. 84.19
cd08913240 START_STARD14-like Lipid-binding START domain of m 83.46
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 82.8
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 82.39
PRK09776 1092 putative diguanylate cyclase; Provisional 82.16
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 82.04
PRK10060 663 RNase II stability modulator; Provisional 80.86
>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information
Probab=100.00  E-value=7e-66  Score=531.32  Aligned_cols=187  Identities=36%  Similarity=0.587  Sum_probs=169.9

Q ss_pred             ccchHHHHHHHHHHHHHHhcCCCcceeeCCCCCC---CCCccceeec------cCCCcceeeeeeeEEeechhHHHHHhc
Q 048771          155 PAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKP---GPDSVGIVAI------SHGCSGVAARACGLVGLEPTRVAEILK  225 (814)
Q Consensus       155 ~~~l~~lA~~Am~Ell~la~~~eplWi~~~g~k~---g~d~~~~~~~------~~~~~~eAsR~~glV~~~~~~LVe~lm  225 (814)
                      +++|++||++||+||++||++++|+|++++|+|+   ++|+++..+.      ..||.+||||+||+|+||+.+|||+||
T Consensus         1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~lm   80 (229)
T cd08875           1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEILM   80 (229)
T ss_pred             ChHHHHHHHHHHHHHHHHhccCCCCceecCCCCccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHHh
Confidence            4689999999999999999999999999999987   7888754432      236999999999999999999999999


Q ss_pred             CCCC--------------------------CCc------eeeeccccccCceeeEEEeecccCCCcEEEEEeeccCCCCC
Q 048771          226 DRPR--------------------------GSA------ILYALTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNG  273 (814)
Q Consensus       226 D~~~--------------------------~G~------~M~a~SpLvp~Re~~fLRyckq~~~G~waVvDvSld~~~~~  273 (814)
                      |+++                          +|+      +||+||||||+|||||||||||++||+|||||||+|+.+. 
T Consensus        81 D~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~-  159 (229)
T cd08875          81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQT-  159 (229)
T ss_pred             ChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeeccccc-
Confidence            9998                          244      4567999999999999999999999999999999998763 


Q ss_pred             CCCCCCCCccceeecCcceEEeeCCCCceEEEEEEeeeccCCCcCccchhhhchhHHHHHHHHHHHH-HHHH
Q 048771          274 PTMPPVQHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAAL-RQLR  344 (814)
Q Consensus       274 ~~~~~~~~~~r~~rlPSGclIq~~~nG~skVtwVeH~e~d~~~v~~l~rpl~~Sg~afgar~w~~~L-r~~e  344 (814)
                        .++.++|+||||+|||||||||+|||||||||||+|||++.+|.+||++++||+||||+||+++| ||||
T Consensus       160 --~p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~~~~~l~~~l~~sg~AfgA~rw~a~lqRqce  229 (229)
T cd08875         160 --APPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE  229 (229)
T ss_pred             --CCCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCCcccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence              33445789999999999999999999999999999999999999999999999999999999999 7997



This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells.

>PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 1e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 8e-05
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 1e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Query: 24 EQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQR 76 +Q+ L Y P+P ++ ++QL+ ++ + P+ I+VWFQN+RC++K+R Sbjct: 13 KQLHTLRTCYAANPRPDALMKEQLVE----MTGLSPRVIRVWFQNKRCKDKKR 61
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query814
2pso_A237 STAR-related lipid transfer protein 13; alpha and 3e-19
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 5e-17
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-16
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 2e-15
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-13
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 4e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 7e-13
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 9e-13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 5e-12
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-11
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-11
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 7e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 3e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-10
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 5e-10
3qsz_A189 STAR-related lipid transfer protein; structural ge 5e-10
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 7e-10
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 1e-09
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 2e-09
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 2e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-09
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-09
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 3e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-07
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-07
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-07
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 7e-07
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 7e-07
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-06
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-06
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-06
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-06
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-06
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-06
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 3e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 5e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 5e-06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 7e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-06
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 8e-06
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-05
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-05
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 1e-05
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-05
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-05
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-05
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-05
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 4e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-05
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 6e-05
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 7e-05
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 7e-05
2wt7_B90 Transcription factor MAFB; transcription, transcri 9e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 1e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-04
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 2e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 4e-04
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 5e-04
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 Back     alignment and structure
 Score = 86.7 bits (214), Expect = 3e-19
 Identities = 46/233 (19%), Positives = 78/233 (33%), Gaps = 35/233 (15%)

Query: 130 DTSCESVVTSGQHHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPG 189
                S V  G  +L  Q    + S A   +     +     +A      WV        
Sbjct: 4   HHHHSSGVDLGTENLYFQS--MEESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNT 61

Query: 190 PDSVGIVAISHGCSGVAARACGLVGLEPTRVAE-ILKDRP----------------RGSA 232
              +    +  G      +A   V   P+ V   +L++R                 R + 
Sbjct: 62  --DLAFKKVGDGNPLKLWKASVEVEAPPSVVLNRVLRERHLWDEDFVQWKVVETLDRQTE 119

Query: 233 ILYALT---TLAPARDFWLLRYTSV-LEDGSLVVCERSLKNIQNGPTMPPVQHFVRAEML 288
           I   +       P+RDF +LR     L  G   +   S+++         +   VRA ++
Sbjct: 120 IYQYVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEH-----EEAQLLGGVRAVVM 174

Query: 289 PSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALR 341
            S YLI PC  G S +  +  +DL+    PE     +    + A +  +A +R
Sbjct: 175 DSQYLIEPCGSGKSRLTHICRIDLKGH-SPEWYSKGF--GHLCAAE--VARIR 222


>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Length = 255 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query814
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 99.74
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.62
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.62
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.61
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.61
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.61
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.6
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.6
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.6
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.59
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.59
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.59
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.59
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.59
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.58
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.58
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.57
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.57
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.57
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.56
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.56
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.56
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.56
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.56
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.56
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.55
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.55
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.55
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.55
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.54
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.54
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.54
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.54
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.54
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.54
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.54
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.53
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.53
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.53
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.53
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.53
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.53
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.52
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.52
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.52
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.51
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.5
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.5
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.5
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.49
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.47
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.46
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.46
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.46
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.45
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.45
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.44
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.44
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.43
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.42
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.41
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.41
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.41
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.41
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.41
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.41
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.4
2e19_A64 Transcription factor 8; homeobox domain, structura 99.4
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.39
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.37
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.36
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.3
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.26
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 99.25
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 99.24
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.1
2pso_A237 STAR-related lipid transfer protein 13; alpha and 99.09
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.0
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.95
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.9
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.85
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.76
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 98.75
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 98.66
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.36
3qsz_A189 STAR-related lipid transfer protein; structural ge 98.1
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 97.9
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 97.55
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 97.53
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 97.52
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 97.46
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 97.36
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 97.32
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 97.29
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 97.21
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 97.21
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 97.19
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 97.14
1byw_A110 Protein (human ERG potassium channel); PAS domain, 97.09
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 97.02
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 96.99
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 96.88
2r78_A117 Sensor protein; sensory box sensor histidine kinas 96.83
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 96.75
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 96.66
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 96.65
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 96.57
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 96.51
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 96.49
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 96.43
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 96.4
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.37
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 96.26
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 96.04
3olo_A118 Two-component sensor histidine kinase; structural 96.03
3eeh_A125 Putative light and redox sensing histidine kinase; 95.99
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 95.96
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 95.91
3b33_A115 Sensor protein; structural genomics, PAS domain, n 95.85
3mjq_A126 Uncharacterized protein; NESG, structural genomics 95.82
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 95.71
3nja_A125 Probable ggdef family protein; structural genomics 95.63
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 95.61
3icy_A118 Sensor protein; sensory box histidine kinase/respo 95.31
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 94.88
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 94.83
2pso_A237 STAR-related lipid transfer protein 13; alpha and 94.76
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 94.37
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 94.35
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 94.15
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 94.03
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 93.52
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 93.31
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 93.22
3qsz_A189 STAR-related lipid transfer protein; structural ge 93.16
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 93.06
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 92.41
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 91.37
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 90.75
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 90.58
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 89.19
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 89.03
4f3l_A361 Mclock, circadian locomoter output cycles protein 87.74
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 87.58
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 87.58
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 87.15
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 86.86
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 86.51
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 86.34
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 86.05
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 82.44
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 82.16
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 81.16
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=8.9e-17  Score=164.84  Aligned_cols=180  Identities=20%  Similarity=0.223  Sum_probs=142.6

Q ss_pred             CccchHHHHHHHHHHHHHHhcCCCcceeeCCCCCCCCCccceeecc-CCCcceeeeeeeEEeechhHHHHHh--cCCCC-
Q 048771          154 SPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSVGIVAIS-HGCSGVAARACGLVGLEPTRVAEIL--KDRPR-  229 (814)
Q Consensus       154 ~~~~l~~lA~~Am~Ell~la~~~eplWi~~~g~k~g~d~~~~~~~~-~~~~~eAsR~~glV~~~~~~LVe~l--mD~~~-  229 (814)
                      .+..+.++|++||+|++++++.+ ..|..... +.|   +.++-.. .+..+.+.|..|+|.+.+.+|++.|  +|.+. 
T Consensus        20 ~~~~y~~~a~~~~~~~l~~~~~~-~~W~~~~~-~~g---v~v~~~~~~~~~~~~~k~~~~v~~~~~~v~~~l~~~d~~~r   94 (231)
T 2r55_A           20 FQSMAAQMSEAVAEKMLQYRRDT-AGWKICRE-GNG---VSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLR   94 (231)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHCC-SSCEEEEC-CSS---EEEEEEECSSSSSEEEEEEEEESSCHHHHHHHHCC--CCSH
T ss_pred             hHHHHHHHHHHHHHHHHHHhcCC-CCCEEEEe-CCC---EEEEEEccCCCCCcEEEEEEEECCCHHHHHHHHHhhCcchh
Confidence            35779999999999999999754 68987532 222   2222111 2345688999999999999999999  55554 


Q ss_pred             ----------------CCc--eeee-----ccccccCceeeEEEeecccCCCcEEEEEeeccCCCCCCCCCCCCCcccee
Q 048771          230 ----------------GSA--ILYA-----LTTLAPARDFWLLRYTSVLEDGSLVVCERSLKNIQNGPTMPPVQHFVRAE  286 (814)
Q Consensus       230 ----------------~G~--~M~a-----~SpLvp~Re~~fLRyckq~~~G~waVvDvSld~~~~~~~~~~~~~~~r~~  286 (814)
                                      ++.  .+|.     ++++|++|||.++||+++.++|.|+|+.+|++.    +..|+...++|++
T Consensus        95 ~~Wd~~~~~~~vle~i~~~~~i~~~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~~~Sv~~----~~~P~~~~~VR~~  170 (231)
T 2r55_A           95 VKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEH----PLCPPKPGFVRGF  170 (231)
T ss_dssp             HHHCTTCSEEEEEEECSSSEEEEEEECCCBTTTTBCCEEEEEEEEEEECTTSCEEEEEEECCC----TTSCCCTTCEEEE
T ss_pred             hhhccccceeEEEEEcCCCEEEEEEEeccccCCccCCCeEEEEEEEEEcCCCEEEEEEEeccC----CCCCCCCCCEEEE
Confidence                            333  3332     346899999999999999999999999999984    3455566899999


Q ss_pred             ecCcceEEeeCC--CCceEEEEEEeeeccCCCcCccchhhhchhHHHHHHHHHHHHH-HHHhh
Q 048771          287 MLPSGYLIRPCE--GGGSIIHIVDHMDLEPWSVPEVLRPLYESSTVLAQKTTMAALR-QLRQM  346 (814)
Q Consensus       287 rlPSGclIq~~~--nG~skVtwVeH~e~d~~~v~~l~rpl~~Sg~afgar~w~~~Lr-~~e~l  346 (814)
                      .++|||+||+++  +|.|+|||+.|+|..-+ +|   +.++++.+..+...|++.|| +|+..
T Consensus       171 ~~~~g~~i~p~~~~~~~t~vt~~~~~Dp~G~-iP---~~lvn~~~~~~~~~~~~~Lr~~~~~~  229 (231)
T 2r55_A          171 NHPCGCFCEPLPGEPTKTNLVTFFHTDLSGY-LP---QNVVDSFFPRSMTRFYANLQKAVKQF  229 (231)
T ss_dssp             ECSEEEEEEECC--CCCEEEEEEECEECCSS-CC---HHHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred             EEeeEEEEEEeCCCCCcEEEEEEEEeCCCCC-cc---HHHHHHHHhHhHHHHHHHHHHHHHHh
Confidence            999999999998  78999999999999876 66   68899999999999999996 88764



>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 814
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-18
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 6e-17
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 7e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-15
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-14
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-14
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 4e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 7e-14
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 8e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-13
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-12
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-12
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-11
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-10
d2psoa1197 d.129.3.2 (A:908-1104) Star-related lipid transfer 3e-09
d1em2a_214 d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu 2e-05
d1ln1a_203 d.129.3.2 (A:) Phosphatidylcholine transfer protei 0.001
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 77.9 bits (192), Expect = 2e-18
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 17 KYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK-Q 75
          K   YT  Q   LE+ +      +  RR ++ R      N+  +Q+K+WFQNRR + K  
Sbjct: 16 KRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLL----NLTERQVKIWFQNRRMKMKKI 71

Query: 76 RKEASR 81
           K+ ++
Sbjct: 72 NKDRAK 77


>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query814
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.68
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.67
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.65
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.65
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.65
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.65
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.64
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.62
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.62
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.61
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.61
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.6
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.6
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.59
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.59
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.56
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.56
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.55
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.55
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.53
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.53
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.51
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.47
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.45
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.45
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.44
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.37
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.36
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.34
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.29
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.22
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.7
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 98.28
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.07
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 98.05
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 97.98
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 97.74
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 97.3
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.18
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 97.13
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 97.11
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 96.77
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 96.22
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 96.2
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 96.1
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 94.73
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 94.11
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 92.48
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 90.37
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=5.2e-18  Score=138.16  Aligned_cols=57  Identities=32%  Similarity=0.562  Sum_probs=55.1

Q ss_pred             CCCcccCCHHHHHHHHHhHhcCCCCCHHHHHHHHHhcCcccCCCccceeeccccchhHHHh
Q 048771           15 NGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQ   75 (814)
Q Consensus        15 ~rkr~r~T~~Ql~~LE~~F~~~~~Ps~~~R~~LA~~L~~~~gL~~rQVkvWFQNRRaK~Kr   75 (814)
                      +++|++||++|+.+||..|..++||+..+|.+||..|    ||+++||++||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l----~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAAT----SLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHT----CCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHc----CCCHHHeeecccchhhhccC
Confidence            5778999999999999999999999999999999999    99999999999999999985



>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure