Psyllid ID: psy10006


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGWCNRRENPNRNRDLS
ccccccEEEEEEEEEEEccccccccEEcccEEEEEEEEcccccccEEEEEEcccccccccccccccc
cccccEEEEEEEEEEcccccccccccccccEEEEEEEEcccccHHEEEEcccccccccccccccccc
MCKAAKTTIVEVEELvnigdldpdsihvpgifVNRIVQCSNYDKRIERSVdgwcnrrenpnrnrdls
MCKAAKTTIVEVEElvnigdldpdsiHVPGIFVNrivqcsnydkriersvdgwcnrrenpnrnrdls
MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGWCNRRENPNRNRDLS
******TTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGWC*************
**KAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRI*********************
MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGWCNRRENPNRNRDLS
**KAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDG***************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGWCNRRENPNRNRDLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query67 2.2.26 [Sep-21-2011]
Q29551 520 Succinyl-CoA:3-ketoacid c yes N/A 0.716 0.092 0.604 3e-12
P55809 520 Succinyl-CoA:3-ketoacid c yes N/A 0.716 0.092 0.583 6e-12
B2GV06 520 Succinyl-CoA:3-ketoacid c no N/A 0.716 0.092 0.583 7e-12
Q9D0K2 520 Succinyl-CoA:3-ketoacid c yes N/A 0.716 0.092 0.583 7e-12
Q54JD9 509 Probable succinyl-CoA:3-k yes N/A 0.716 0.094 0.562 1e-10
Q09450 521 Probable succinyl-CoA:3-k yes N/A 0.716 0.092 0.541 5e-09
Q9ZLE3232 Succinyl-CoA:3-ketoacid c yes N/A 0.686 0.198 0.521 2e-08
P56006232 Succinyl-CoA:3-ketoacid c yes N/A 0.671 0.193 0.533 2e-08
P42315238 Probable succinyl-CoA:3-k yes N/A 0.671 0.189 0.533 6e-08
P63648248 Probable succinyl-CoA:3-k yes N/A 0.671 0.181 0.511 8e-08
>sp|Q29551|SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa GN=OXCT1 PE=1 SV=2 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 40/48 (83%)

Query: 1   MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48
           MCKAA+TT+VEVEE+V+IG   P+ IH+P I+V+R+V+   Y+KRIER
Sbjct: 234 MCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRIER 281




Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
Sus scrofa (taxid: 9823)
EC: 2EC: .EC: 8EC: .EC: 3EC: .EC: 5
>sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens GN=OXCT1 PE=1 SV=1 Back     alignment and function description
>sp|B2GV06|SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus GN=Oxct1 PE=1 SV=1 Back     alignment and function description
>sp|Q9D0K2|SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus GN=Oxct1 PE=1 SV=1 Back     alignment and function description
>sp|Q54JD9|SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum GN=oxct1 PE=3 SV=1 Back     alignment and function description
>sp|Q09450|SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans GN=C05C10.3 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZLE3|SCOA_HELPJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain J99) GN=scoA PE=3 SV=1 Back     alignment and function description
>sp|P56006|SCOA_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=scoA PE=1 SV=1 Back     alignment and function description
>sp|P42315|SCOA_BACSU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Bacillus subtilis (strain 168) GN=scoA PE=1 SV=1 Back     alignment and function description
>sp|P63648|SCOA_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium tuberculosis GN=scoA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
307186593 834 Succinyl-CoA:3-ketoacid-coenzyme A trans 0.716 0.057 0.708 9e-13
195439856 514 GK12531 [Drosophila willistoni] gi|19416 0.716 0.093 0.666 3e-12
198436711 505 PREDICTED: similar to Oxct1 protein [Cio 0.716 0.095 0.625 3e-12
442629628 450 CG1140, isoform C [Drosophila melanogast 0.716 0.106 0.645 3e-12
24655794 502 CG1140, isoform B [Drosophila melanogast 0.716 0.095 0.645 3e-12
21358325 516 CG1140, isoform A [Drosophila melanogast 0.716 0.093 0.645 3e-12
259013617 551 AT31327p [Drosophila melanogaster] 0.716 0.087 0.645 3e-12
195490646 516 GE21204 [Drosophila yakuba] gi|194179328 0.716 0.093 0.645 3e-12
340617796 232 3-oxoacid CoA-transferase subunit A [Zob 0.716 0.206 0.687 4e-12
194746974 516 GF24850 [Drosophila ananassae] gi|190623 0.716 0.093 0.687 4e-12
>gi|307186593|gb|EFN72110.1| Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
 Score = 77.4 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/48 (70%), Positives = 42/48 (87%)

Query: 1   MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48
           MCKAAK +IVEVEE+V IG LDPD IH+PGIFV+RIV+  +Y+KRIE+
Sbjct: 601 MCKAAKISIVEVEEIVGIGQLDPDQIHLPGIFVDRIVKGPSYEKRIEK 648




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195439856|ref|XP_002067775.1| GK12531 [Drosophila willistoni] gi|194163860|gb|EDW78761.1| GK12531 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198436711|ref|XP_002131269.1| PREDICTED: similar to Oxct1 protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|442629628|ref|NP_001261301.1| CG1140, isoform C [Drosophila melanogaster] gi|440215169|gb|AGB93996.1| CG1140, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24655794|ref|NP_728699.1| CG1140, isoform B [Drosophila melanogaster] gi|23092830|gb|AAN11508.1| CG1140, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|21358325|ref|NP_647683.1| CG1140, isoform A [Drosophila melanogaster] gi|7292189|gb|AAF47600.1| CG1140, isoform A [Drosophila melanogaster] gi|16197775|gb|AAL13483.1| GH01464p [Drosophila melanogaster] gi|220946592|gb|ACL85839.1| CG1140-PA [synthetic construct] Back     alignment and taxonomy information
>gi|259013617|gb|ACV88439.1| AT31327p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195490646|ref|XP_002093227.1| GE21204 [Drosophila yakuba] gi|194179328|gb|EDW92939.1| GE21204 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|340617796|ref|YP_004736249.1| 3-oxoacid CoA-transferase subunit A [Zobellia galactanivorans] gi|339732593|emb|CAZ95861.1| 3-Oxoacid CoA-transferase subunit A [Zobellia galactanivorans] Back     alignment and taxonomy information
>gi|194746974|ref|XP_001955929.1| GF24850 [Drosophila ananassae] gi|190623211|gb|EDV38735.1| GF24850 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
FB|FBgn0035298 516 CG1140 [Drosophila melanogaste 0.716 0.093 0.645 2.9e-12
ZFIN|ZDB-GENE-040723-3 525 oxct1a "3-oxoacid CoA transfer 0.955 0.121 0.523 1.3e-11
ZFIN|ZDB-GENE-060929-212 526 oxct1b "3-oxoacid CoA transfer 0.716 0.091 0.604 2.2e-11
UNIPROTKB|F1N9Z7 506 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.094 0.625 2.6e-11
UNIPROTKB|F1NRM0 510 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.094 0.625 2.7e-11
UNIPROTKB|E9PDW2 334 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.143 0.583 3.7e-11
UNIPROTKB|Q29551 520 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.092 0.604 4.5e-11
UNIPROTKB|Q24JZ7 520 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.092 0.583 5.8e-11
UNIPROTKB|F1PJ13 520 OXCT1 "Succinyl-CoA:3-ketoacid 0.716 0.092 0.583 5.8e-11
RGD|2323650 446 LOC100359544 "succinyl-CoA:3-k 0.716 0.107 0.583 9.2e-11
FB|FBgn0035298 CG1140 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 2.9e-12, P = 2.9e-12
 Identities = 31/48 (64%), Positives = 40/48 (83%)

Query:     1 MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48
             MC+AAK T+ EVEE+V IG L PD IHVPGI++NRI + +NY+KR+ER
Sbjct:   228 MCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVER 275




GO:0008260 "3-oxoacid CoA-transferase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0046952 "ketone body catabolic process" evidence=ISS
ZFIN|ZDB-GENE-040723-3 oxct1a "3-oxoacid CoA transferase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-212 oxct1b "3-oxoacid CoA transferase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9Z7 OXCT1 "Succinyl-CoA:3-ketoacid-coenzyme A transferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRM0 OXCT1 "Succinyl-CoA:3-ketoacid-coenzyme A transferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDW2 OXCT1 "Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29551 OXCT1 "Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q24JZ7 OXCT1 "Succinyl-CoA:3-ketoacid-coenzyme A transferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ13 OXCT1 "Succinyl-CoA:3-ketoacid-coenzyme A transferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2323650 LOC100359544 "succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P63648SCOA_MYCTU2, ., 8, ., 3, ., 50.51110.67160.1814yesN/A
Q54JD9SCOT_DICDI2, ., 8, ., 3, ., 50.56250.71640.0943yesN/A
Q01103PCAI_PSEPU2, ., 8, ., 3, ., 60.54280.52230.1515yesN/A
Q9D0K2SCOT1_MOUSE2, ., 8, ., 3, ., 50.58330.71640.0923yesN/A
P55809SCOT1_HUMAN2, ., 8, ., 3, ., 50.58330.71640.0923yesN/A
P42315SCOA_BACSU2, ., 8, ., 3, ., 50.53330.67160.1890yesN/A
P56006SCOA_HELPY2, ., 8, ., 3, ., 50.53330.67160.1939yesN/A
Q9ZLE3SCOA_HELPJ2, ., 8, ., 3, ., 50.52170.68650.1982yesN/A
Q29551SCOT1_PIG2, ., 8, ., 3, ., 50.60410.71640.0923yesN/A
Q09450SCOT_CAEEL2, ., 8, ., 3, ., 50.54160.71640.0921yesN/A
P63649SCOA_MYCBO2, ., 8, ., 3, ., 50.51110.67160.1814yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
COG1788220 COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA tra 4e-16
TIGR02429222 TIGR02429, pcaI_scoA_fam, 3-oxoacid CoA-transferas 1e-14
smart00882212 smart00882, CoA_trans, Coenzyme A transferase 2e-10
pfam01144216 pfam01144, CoA_trans, Coenzyme A transferase 4e-10
PRK09920219 PRK09920, PRK09920, acetyl-CoA:acetoacetyl-CoA tra 2e-07
COG4670 527 COG4670, COG4670, Acyl CoA:acetate/3-ketoacid CoA 0.002
>gnl|CDD|224702 COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism] Back     alignment and domain information
 Score = 68.4 bits (168), Expect = 4e-16
 Identities = 22/37 (59%), Positives = 29/37 (78%)

Query: 1   MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIV 37
           M  AAK TIVEVEE+V +G+LDP+ +  PGIFV+ +V
Sbjct: 178 MAMAAKRTIVEVEEIVPLGELDPEEVVTPGIFVDAVV 214


Length = 220

>gnl|CDD|131482 TIGR02429, pcaI_scoA_fam, 3-oxoacid CoA-transferase, A subunit Back     alignment and domain information
>gnl|CDD|214882 smart00882, CoA_trans, Coenzyme A transferase Back     alignment and domain information
>gnl|CDD|201623 pfam01144, CoA_trans, Coenzyme A transferase Back     alignment and domain information
>gnl|CDD|182146 PRK09920, PRK09920, acetyl-CoA:acetoacetyl-CoA transferase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|227016 COG4670, COG4670, Acyl CoA:acetate/3-ketoacid CoA transferase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 67
COG1788220 AtoD Acyl CoA:acetate/3-ketoacid CoA transferase, 99.55
PRK09920219 acetyl-CoA:acetoacetyl-CoA transferase subunit alp 99.52
TIGR02429222 pcaI_scoA_fam 3-oxoacid CoA-transferase, A subunit 99.5
KOG3822|consensus 516 99.41
COG4670 527 Acyl CoA:acetate/3-ketoacid CoA transferase [Lipid 99.25
PF01144217 CoA_trans: Coenzyme A transferase; InterPro: IPR00 98.37
TIGR01110 543 mdcA malonate decarboxylase, alpha subunit. This m 97.72
TIGR01584 492 citF citrate lyase, alpha subunit. This is a model 93.41
TIGR03458 485 YgfH_subfam succinate CoA transferases. A closely 90.69
PF04223 466 CitF: Citrate lyase, alpha subunit (CitF); InterPr 80.84
>COG1788 AtoD Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism] Back     alignment and domain information
Probab=99.55  E-value=2.6e-15  Score=107.65  Aligned_cols=40  Identities=55%  Similarity=0.931  Sum_probs=39.0

Q ss_pred             CcccccEeEEEeceEeeCCCCCCCceeCCceeeeEEEecC
Q psy10006          1 MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCS   40 (67)
Q Consensus         1 mA~AAk~vIvqve~iV~~G~l~P~~V~iPGi~VD~VV~~~   40 (67)
                      ||||||+|||||||||+.|+|+|+++++||+|||+||+++
T Consensus       178 ~A~AAk~~IvevEeIV~~gel~P~~v~tPg~~Vd~vV~~~  217 (220)
T COG1788         178 MAMAAKRTIVEVEEIVPLGELDPEEVVTPGIFVDAVVEVP  217 (220)
T ss_pred             HHhhcCeEEEEEEeeeccCccCccceecchheeEEEEecC
Confidence            7999999999999999999999999999999999999976



>PRK09920 acetyl-CoA:acetoacetyl-CoA transferase subunit alpha; Provisional Back     alignment and domain information
>TIGR02429 pcaI_scoA_fam 3-oxoacid CoA-transferase, A subunit Back     alignment and domain information
>KOG3822|consensus Back     alignment and domain information
>COG4670 Acyl CoA:acetate/3-ketoacid CoA transferase [Lipid metabolism] Back     alignment and domain information
>PF01144 CoA_trans: Coenzyme A transferase; InterPro: IPR004165 Coenzyme A (CoA) transferases belong to an evolutionary conserved [, ] family of enzymes catalyzing the reversible transfer of CoA from one carboxylic acid to another Back     alignment and domain information
>TIGR01110 mdcA malonate decarboxylase, alpha subunit Back     alignment and domain information
>TIGR01584 citF citrate lyase, alpha subunit Back     alignment and domain information
>TIGR03458 YgfH_subfam succinate CoA transferases Back     alignment and domain information
>PF04223 CitF: Citrate lyase, alpha subunit (CitF); InterPro: IPR006472 These sequences, from both Gram-positive and Gram-negative bacteria, represent the alpha subunit of the holoenzyme citrate lyase composed of alpha (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
1ooz_A 475 Deletion Mutant Of Succinyl-coa:3-ketoacid Coa Tran 2e-13
1o9l_A 481 Succinate:coenzyme-A Transferase (Pig Heart) Length 2e-13
3oxo_A 488 Succinyl-Coa:3-Ketoacid Coa Transferase From Pig He 2e-13
2nrc_A 481 C28a Mutant Of Succinyl-Coa:3-Ketoacid Coa Transfer 2e-13
2nrb_A 481 C28s Mutant Of Succinyl-Coa:3-Ketoacid Coa Transfer 2e-13
3dlx_A 489 Crystal Structure Of Human 3-Oxoacid Coa Transferas 5e-13
1m3e_A 481 Succinyl-Coa:3-Ketoacid Coa Transferase From Pig He 1e-12
3rrl_A235 Complex Structure Of 3-Oxoadipate Coa-Transferase S 2e-09
3cdk_A241 Crystal Structure Of The Co-Expressed Succinyl-Coa 4e-09
>pdb|1OOZ|A Chain A, Deletion Mutant Of Succinyl-coa:3-ketoacid Coa Transferase From Pig Heart Length = 475 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 2e-13, Method: Composition-based stats. Identities = 29/48 (60%), Positives = 40/48 (83%) Query: 1 MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48 MCKAA+TT+VEVEE+V+IG P+ IH+P I+V+R+V+ Y+KRIER Sbjct: 195 MCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRIER 242
>pdb|1O9L|A Chain A, Succinate:coenzyme-A Transferase (Pig Heart) Length = 481 Back     alignment and structure
>pdb|3OXO|A Chain A, Succinyl-Coa:3-Ketoacid Coa Transferase From Pig Heart Covalently Bound To Coa Length = 488 Back     alignment and structure
>pdb|2NRC|A Chain A, C28a Mutant Of Succinyl-Coa:3-Ketoacid Coa Transferase From Pig Heart Length = 481 Back     alignment and structure
>pdb|2NRB|A Chain A, C28s Mutant Of Succinyl-Coa:3-Ketoacid Coa Transferase From Pig Heart Length = 481 Back     alignment and structure
>pdb|3DLX|A Chain A, Crystal Structure Of Human 3-Oxoacid Coa Transferase 1 Length = 489 Back     alignment and structure
>pdb|1M3E|A Chain A, Succinyl-Coa:3-Ketoacid Coa Transferase From Pig Heart (Selenomethionine) Length = 481 Back     alignment and structure
>pdb|3RRL|A Chain A, Complex Structure Of 3-Oxoadipate Coa-Transferase Subunit A And B From Helicobacter Pylori 26695 Length = 235 Back     alignment and structure
>pdb|3CDK|A Chain A, Crystal Structure Of The Co-Expressed Succinyl-Coa Transferase A And B Complex From Bacillus Subtilis Length = 241 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
3rrl_A235 Succinyl-COA:3-ketoacid-coenzyme A transferase SU; 3e-26
3cdk_A241 Succinyl-COA:3-ketoacid-coenzyme A transferase sub 2e-25
1k6d_A220 Acetate COA-transferase alpha subunit; structural 3e-21
3k6m_A 481 Succinyl-COA:3-ketoacid-coenzyme A transferase 1, 3e-19
2ahu_A 531 Putative enzyme YDIF; COA transferase, glutamyl th 3e-16
1poi_A317 Glutaconate coenzyme A-transferase; COA, glutamate 4e-15
>3rrl_A Succinyl-COA:3-ketoacid-coenzyme A transferase SU; MCSG,PSI-biology, structural genomics, midwest center for ST genomics; 2.29A {Helicobacter pylori} Length = 235 Back     alignment and structure
 Score = 94.3 bits (235), Expect = 3e-26
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 1   MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48
              AAK  + EVEE+V  G+LDPD IH+PGI+V  I +   ++KRIE+
Sbjct: 181 CAMAAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEKRIEK 228


>3cdk_A Succinyl-COA:3-ketoacid-coenzyme A transferase subunit A; CO-expressed complex, hetero-tetramer, structural genomics, PSI-2; 2.59A {Bacillus subtilis} Length = 241 Back     alignment and structure
>1k6d_A Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: c.124.1.2 Length = 220 Back     alignment and structure
>3k6m_A Succinyl-COA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT, COA transferase, dynamic domain, glycerol, mitochondri transferase; 1.50A {Sus scrofa} PDB: 1m3e_A* 1o9l_A 1ooy_A 2nrc_A 2nrb_A 3oxo_A* 1ooz_A 1ope_A 3dlx_A Length = 481 Back     alignment and structure
>2ahu_A Putative enzyme YDIF; COA transferase, glutamyl thioester, structural genomi montreal-kingston bacterial structural genomics initiative; 1.90A {Escherichia coli} SCOP: c.124.1.3 c.124.1.2 PDB: 2ahv_A* 2ahw_A* Length = 531 Back     alignment and structure
>1poi_A Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} SCOP: c.124.1.2 Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
3rrl_A235 Succinyl-COA:3-ketoacid-coenzyme A transferase SU; 99.59
3cdk_A241 Succinyl-COA:3-ketoacid-coenzyme A transferase sub 99.57
3k6m_A 481 Succinyl-COA:3-ketoacid-coenzyme A transferase 1, 99.35
1k6d_A220 Acetate COA-transferase alpha subunit; structural 99.33
1poi_A317 Glutaconate coenzyme A-transferase; COA, glutamate 99.15
2ahu_A 531 Putative enzyme YDIF; COA transferase, glutamyl th 98.89
2hj0_A 519 Putative citrate lyase, ALFA subunit; alpha beta p 97.9
1xr4_A 509 Putative citrate lyase alpha chain/citrate-ACP TR; 97.84
2nvv_A 506 Acetyl-COA hydrolase/transferase family protein; a 97.73
2g39_A 497 Acetyl-COA hydrolase; coenzyme A transferase, stru 97.72
3d3u_A 439 4-hydroxybutyrate COA-transferase; alpha-beta prot 97.57
2oas_A 436 ATOA, 4-hydroxybutyrate coenzyme A transferase; al 97.22
3gk7_A 448 4-hydroxybutyrate COA-transferase; alpha/beta prot 97.18
3eh7_A 434 4-hydroxybutyrate COA-transferase; citrate lyase, 96.97
3qli_A 455 Coenzyme A transferase; COEN transferase; 1.90A {Y 93.94
4eu9_A 514 Succinyl-COA:acetate coenzyme A transferase; HET: 85.13
>3rrl_A Succinyl-COA:3-ketoacid-coenzyme A transferase SU; MCSG,PSI-biology, structural genomics, midwest center for ST genomics; 2.29A {Helicobacter pylori} Back     alignment and structure
Probab=99.59  E-value=3.6e-16  Score=110.02  Aligned_cols=53  Identities=45%  Similarity=0.758  Sum_probs=49.8

Q ss_pred             CcccccEeEEEeceEeeCCCCCCCceeCCceeeeEEEecCCcccceeeeeeee
Q psy10006          1 MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIERSVDGW   53 (67)
Q Consensus         1 mA~AAk~vIvqve~iV~~G~l~P~~V~iPGi~VD~VV~~~~~e~~ie~~t~~~   53 (67)
                      ||+|||+||+||+++|+.|+++|+.|++||+||||||++++++|+||++|.+.
T Consensus       181 ~a~aA~~vIveve~iv~~g~l~p~~v~ipg~~VD~VV~~~~~~~~~~~~~~~~  233 (235)
T 3rrl_A          181 CAMAAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEKRIEKITTRS  233 (235)
T ss_dssp             HHHTEEEEEEEESEEECTTSSCTTTCSBCGGGCSEEEECSCCCCCCSBCCCCC
T ss_pred             HHHhcCEEEEEEeeccccCccCCceEEeChHHeEEEEECCCCccceEEEEeec
Confidence            68999999999999999999999999999999999999988899999998753



>3cdk_A Succinyl-COA:3-ketoacid-coenzyme A transferase subunit A; CO-expressed complex, hetero-tetramer, structural genomics, PSI-2; 2.59A {Bacillus subtilis} Back     alignment and structure
>3k6m_A Succinyl-COA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT, COA transferase, dynamic domain, glycerol, mitochondri transferase; 1.50A {Sus scrofa} PDB: 1m3e_A* 1o9l_A 1ooy_A 2nrc_A 2nrb_A 3oxo_A* 1ooz_A 1ope_A 3dlx_A Back     alignment and structure
>1k6d_A Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: c.124.1.2 Back     alignment and structure
>1poi_A Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} SCOP: c.124.1.2 Back     alignment and structure
>2ahu_A Putative enzyme YDIF; COA transferase, glutamyl thioester, structural genomi montreal-kingston bacterial structural genomics initiative; 1.90A {Escherichia coli} SCOP: c.124.1.3 c.124.1.2 PDB: 2ahv_A* 2ahw_A* Back     alignment and structure
>2hj0_A Putative citrate lyase, ALFA subunit; alpha beta protein., structural genomics, PSI-2, protein STR initiative; HET: CIT; 2.70A {Streptococcus mutans} Back     alignment and structure
>1xr4_A Putative citrate lyase alpha chain/citrate-ACP TR; the midwest center for structural genomics, MCSG, structural genomics; 2.37A {Salmonella typhimurium} SCOP: c.124.1.2 c.124.1.2 Back     alignment and structure
>2nvv_A Acetyl-COA hydrolase/transferase family protein; alpha beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Porphyromonas gingivalis} Back     alignment and structure
>2g39_A Acetyl-COA hydrolase; coenzyme A transferase, structural G PSI, protein structure initiative, midwest center for struc genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: c.124.1.2 c.124.1.2 Back     alignment and structure
>3d3u_A 4-hydroxybutyrate COA-transferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.80A {Porphyromonas gingivalis} Back     alignment and structure
>2oas_A ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein STRU initiative; HET: COA; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3gk7_A 4-hydroxybutyrate COA-transferase; alpha/beta protein; HET: SPD; 1.85A {Clostridium aminobutyricum} PDB: 3qdq_A* Back     alignment and structure
>3eh7_A 4-hydroxybutyrate COA-transferase; citrate lyase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Porphyromonas gingivalis} Back     alignment and structure
>3qli_A Coenzyme A transferase; COEN transferase; 1.90A {Yersinia pestis} PDB: 3qlk_A 3s8d_A Back     alignment and structure
>4eu9_A Succinyl-COA:acetate coenzyme A transferase; HET: COA; 1.48A {Acetobacter aceti} PDB: 4eua_A* 4eu3_A* 4eu4_A* 4eu5_A* 4eu6_A* 4eu7_A* 4eu8_A* 4eub_A* 4euc_A* 4eud_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 67
d1ooya2242 c.124.1.2 (A:1-242) Succinate:CoA transferase, N-t 3e-22
d1k6da_219 c.124.1.2 (A:) Acetate:CoA transferase alpha {Esch 1e-14
d2ahua2273 c.124.1.2 (A:4-276) Putative enzyme YdiF N-termina 1e-12
d1poia_317 c.124.1.2 (A:) Glutaconate:CoA transferase alpha { 3e-11
d2g39a1221 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) 5e-05
>d1ooya2 c.124.1.2 (A:1-242) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 242 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: CoA transferase alpha subunit-like
domain: Succinate:CoA transferase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]
 Score = 83.5 bits (206), Expect = 3e-22
 Identities = 29/48 (60%), Positives = 40/48 (83%)

Query: 1   MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER 48
           MCKAA+TT+VEVEE+V+IG   P+ IH+P I+V+R+V+   Y+KRIER
Sbjct: 195 MCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRIER 242


>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]} Length = 219 Back     information, alignment and structure
>d2ahua2 c.124.1.2 (A:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]} Length = 273 Back     information, alignment and structure
>d1poia_ c.124.1.2 (A:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans [TaxId: 905]} Length = 317 Back     information, alignment and structure
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
d1ooya2242 Succinate:CoA transferase, N-terminal domain {Pig 99.64
d1k6da_219 Acetate:CoA transferase alpha {Escherichia coli [T 99.44
d2ahua2273 Putative enzyme YdiF N-terminal domain {Escherichi 99.27
d1poia_317 Glutaconate:CoA transferase alpha {Acidaminococcus 99.2
d2g39a1221 Acetyl-CoA hydrolase (PA5445) {Pseudomonas aerugin 96.01
>d1ooya2 c.124.1.2 (A:1-242) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: CoA transferase alpha subunit-like
domain: Succinate:CoA transferase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.64  E-value=2.6e-17  Score=114.46  Aligned_cols=48  Identities=60%  Similarity=1.097  Sum_probs=45.7

Q ss_pred             CcccccEeEEEeceEeeCCCCCCCceeCCceeeeEEEecCCcccceee
Q psy10006          1 MCKAAKTTIVEVEELVNIGDLDPDSIHVPGIFVNRIVQCSNYDKRIER   48 (67)
Q Consensus         1 mA~AAk~vIvqve~iV~~G~l~P~~V~iPGi~VD~VV~~~~~e~~ie~   48 (67)
                      ||+|||.||||||+||+.|+|+|++|++||+|||+||++++++|+||+
T Consensus       195 ~a~Aa~~VIvqve~IV~~g~l~P~~v~IPg~~VD~VV~~p~~~~~~e~  242 (242)
T d1ooya2         195 MCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRIER  242 (242)
T ss_dssp             HTTSEEEEEEEEEEEECTTSSCGGGCSBCGGGCCEEEECSCCCCCCCC
T ss_pred             HHHhCCcEEEEEEEEecCCCcCcceEEcCcceEEEEEECCCcccccCC
Confidence            699999999999999999999999999999999999999988888875



>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahua2 c.124.1.2 (A:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1poia_ c.124.1.2 (A:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure