Psyllid ID: psy10014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
MKRIKFYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
cEEEEEcccccHHHHcHHHHHHHHHHcccccccEEEEccccccEEEEEEEEccccccccccEEEEEEEEEcc
ccEEEEccccccccccHHHHHHHHHccccccccEEccccccccEEEEEEEEccccccccccEEEEEEEEEcc
mkrikfytgpsrielspeIINCVeltinppegiiagpvneenffewealitgpegtcfeggvfpakdkills
mkrikfytgpsrielspEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
MKRIKFYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
*****FYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK******
*********************CVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
MKRIKFYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
*KRIKFYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRIKFYTGPSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
Q17QG5 165 Ubiquitin-conjugating enz yes N/A 0.583 0.254 0.833 6e-15
Q5RF84 165 Ubiquitin-conjugating enz yes N/A 0.583 0.254 0.833 6e-15
P60605 165 Ubiquitin-conjugating enz yes N/A 0.583 0.254 0.833 6e-15
P60604 165 Ubiquitin-conjugating enz yes N/A 0.583 0.254 0.833 6e-15
O00102 166 Ubiquitin-conjugating enz yes N/A 0.583 0.253 0.642 8e-10
Q9Y818 167 Ubiquitin-conjugating enz no N/A 0.583 0.251 0.5 6e-06
P62255 170 Ubiquitin-conjugating enz no N/A 0.638 0.270 0.456 2e-05
P62254 170 Ubiquitin-conjugating enz no N/A 0.638 0.270 0.456 2e-05
P62253 170 Ubiquitin-conjugating enz no N/A 0.638 0.270 0.456 2e-05
Q4R5Y8 170 Ubiquitin-conjugating enz N/A N/A 0.638 0.270 0.456 2e-05
>sp|Q17QG5|UB2G2_BOVIN Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (92%)

Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPA 65
          +LT+NPPEGI+AGP+NEENFFEWEALI GPE TCFE GVFPA
Sbjct: 15 QLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPA 56
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD).
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q5RF84|UB2G2_PONAB Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1 Back     alignment and function description
>sp|P60605|UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1 Back     alignment and function description
>sp|P60604|UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1 Back     alignment and function description
>sp|O00102|UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc7 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc15 PE=3 SV=1 Back     alignment and function description
>sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 Back     alignment and function description
>sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
242020750169 ubiquitin-conjugating enzyme E2 G2, puta 0.597 0.254 0.953 2e-16
328793847171 PREDICTED: ubiquitin-conjugating enzyme 0.597 0.251 0.930 2e-16
350408696171 PREDICTED: ubiquitin-conjugating enzyme 0.597 0.251 0.930 2e-16
322780430170 hypothetical protein SINV_08635 [Solenop 0.597 0.252 0.930 2e-16
307205475167 Ubiquitin-conjugating enzyme E2 G2 [Harp 0.597 0.257 0.930 3e-16
340728561167 PREDICTED: ubiquitin-conjugating enzyme 0.597 0.257 0.930 3e-16
91078920167 PREDICTED: similar to ubiquitin-conjugat 0.597 0.257 0.930 3e-16
357605444169 putative ubiquitin-conjugating enzyme E2 0.597 0.254 0.930 3e-16
346469883168 hypothetical protein [Amblyomma maculatu 0.597 0.255 0.930 4e-16
389611884168 courtless [Papilio xuthus] 0.597 0.255 0.906 4e-16
>gi|242020750|ref|XP_002430814.1| ubiquitin-conjugating enzyme E2 G2, putative [Pediculus humanus corporis] gi|212516017|gb|EEB18076.1| ubiquitin-conjugating enzyme E2 G2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%)

Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK 66
          +LT+NPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK
Sbjct: 15 QLTLNPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK 57

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328793847|ref|XP_625157.2| PREDICTED: ubiquitin-conjugating enzyme E2 G2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350408696|ref|XP_003488480.1| PREDICTED: ubiquitin-conjugating enzyme E2 G2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322780430|gb|EFZ09918.1| hypothetical protein SINV_08635 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307205475|gb|EFN83797.1| Ubiquitin-conjugating enzyme E2 G2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340728561|ref|XP_003402589.1| PREDICTED: ubiquitin-conjugating enzyme E2 G2-like [Bombus terrestris] gi|332020401|gb|EGI60821.1| Ubiquitin-conjugating enzyme E2 G2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|91078920|ref|XP_973689.1| PREDICTED: similar to ubiquitin-conjugating enzyme E2 g [Tribolium castaneum] gi|270004881|gb|EFA01329.1| courtless [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357605444|gb|EHJ64632.1| putative ubiquitin-conjugating enzyme E2 g [Danaus plexippus] Back     alignment and taxonomy information
>gi|346469883|gb|AEO34786.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|389611884|dbj|BAM19498.1| courtless [Papilio xuthus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
ZFIN|ZDB-GENE-050417-288 165 ube2g2 "ubiquitin-conjugating 0.583 0.254 0.880 2e-17
FB|FBgn0015374 200 crl "courtless" [Drosophila me 0.597 0.215 0.790 5.3e-17
UNIPROTKB|I3LJ21 166 UBE2G2 "Uncharacterized protei 0.583 0.253 0.857 1.8e-16
UNIPROTKB|E1C9E7 165 UBE2G2 "Uncharacterized protei 0.583 0.254 0.833 3.7e-16
UNIPROTKB|Q17QG5 165 UBE2G2 "Ubiquitin-conjugating 0.583 0.254 0.833 3.7e-16
UNIPROTKB|J9NY70 165 UBE2G2 "Uncharacterized protei 0.583 0.254 0.833 3.7e-16
UNIPROTKB|F8WDB199 UBE2G2 "Ubiquitin-conjugating 0.583 0.424 0.833 3.7e-16
UNIPROTKB|P60604 165 UBE2G2 "Ubiquitin-conjugating 0.583 0.254 0.833 3.7e-16
UNIPROTKB|Q5RF84 165 UBE2G2 "Ubiquitin-conjugating 0.583 0.254 0.833 3.7e-16
MGI|MGI:1343188 165 Ube2g2 "ubiquitin-conjugating 0.583 0.254 0.833 3.7e-16
ZFIN|ZDB-GENE-050417-288 ube2g2 "ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 37/42 (88%), Positives = 40/42 (95%)

Query:    24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPA 65
             +LT+NPPEGI+AGPVNEENFFEWEALI GPE TCFEGGVFPA
Sbjct:    15 QLTLNPPEGIVAGPVNEENFFEWEALIMGPEDTCFEGGVFPA 56
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0016874 "ligase activity" evidence=IEA
FB|FBgn0015374 crl "courtless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJ21 UBE2G2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9E7 UBE2G2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QG5 UBE2G2 "Ubiquitin-conjugating enzyme E2 G2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY70 UBE2G2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8WDB1 UBE2G2 "Ubiquitin-conjugating enzyme E2 G2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P60604 UBE2G2 "Ubiquitin-conjugating enzyme E2 G2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RF84 UBE2G2 "Ubiquitin-conjugating enzyme E2 G2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1343188 Ube2g2 "ubiquitin-conjugating enzyme E2G 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O00102UBC7_SCHPO6, ., 3, ., 2, ., 1, 90.64280.58330.2530yesN/A
Q17QG5UB2G2_BOVIN6, ., 3, ., 2, ., 1, 90.83330.58330.2545yesN/A
P60604UB2G2_HUMAN6, ., 3, ., 2, ., 1, 90.83330.58330.2545yesN/A
P60605UB2G2_MOUSE6, ., 3, ., 2, ., 1, 90.83330.58330.2545yesN/A
Q5RF84UB2G2_PONAB6, ., 3, ., 2, ., 1, 90.83330.58330.2545yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 9e-12
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 1e-11
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-10
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 3e-10
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 4e-04
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 8e-04
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 56.1 bits (136), Expect = 9e-12
 Identities = 23/43 (53%), Positives = 30/43 (69%)

Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK 66
          +L  +PP GI AGPV+++N F WEA ITGP  T +EGG+F   
Sbjct: 16 KLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKLT 58

Length = 153
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.88
KOG0417|consensus148 99.86
KOG0426|consensus 165 99.85
KOG0419|consensus152 99.82
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.81
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.81
KOG0894|consensus 244 99.79
KOG0425|consensus 171 99.73
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.73
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.71
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.67
KOG0421|consensus175 99.66
KOG0424|consensus158 99.64
KOG0418|consensus 200 99.64
KOG0428|consensus 314 99.56
KOG0427|consensus161 99.55
KOG0423|consensus 223 99.38
KOG0422|consensus153 99.25
KOG0416|consensus 189 99.09
KOG0895|consensus 1101 98.88
KOG0420|consensus184 98.65
KOG0429|consensus 258 98.45
KOG0896|consensus138 98.05
KOG0895|consensus 1101 98.02
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.88  E-value=2.9e-22  Score=123.31  Aligned_cols=62  Identities=40%  Similarity=0.701  Sum_probs=57.9

Q ss_pred             ChhhhhHHHHHHHHHhhCCCCCEEEeecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecCC
Q psy10014         11 SRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS   72 (72)
Q Consensus        11 s~~~~~Rl~kE~~~l~~~~~~~i~~~~~~~~nl~~w~~~i~GP~~tpy~gg~f~~~i~fp~~   72 (72)
                      ++.+.+||++|++.|+++++++|++.+.+++|+++|+++|.||++||||||+|++.|.||++
T Consensus         3 s~~a~~RL~kE~~~l~~~~~~~~~a~p~~d~~l~~w~~~i~GP~dtpYegg~f~~~l~fP~~   64 (153)
T COG5078           3 SPSALKRLLKELKKLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKLTLEFPED   64 (153)
T ss_pred             chhHHHHHHHHHHHHhcCCCCceEEEECCCCcceeEEEEEECCCCCCcCCCEEEEEEECCCC
Confidence            34599999999999999999999999987669999999999999999999999999999975

>KOG0417|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
3fsh_A 168 Crystal Structure Of The Ubiquitin Conjugating Enzy 5e-16
3h8k_A 164 Crystal Structure Of Ube2g2 Complxed With The G2br 5e-16
2kly_A 167 Solution Structure Of Human Ubiquitin Conjugating E 5e-16
2cyx_A 170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 6e-16
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 2e-06
2ucz_A 165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 1e-05
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 2e-05
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-05
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 9e-05
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-04
1q34_A 163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-04
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 1e-04
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 1e-04
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 2e-04
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 2e-04
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 2e-04
1pzv_A 164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 2e-04
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 2e-04
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 2e-04
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 3e-04
3jvz_A146 E2~ubiquitin-Hect Length = 146 3e-04
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-04
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 3e-04
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 3e-04
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 3e-04
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-04
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 3e-04
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 3e-04
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-04
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 3e-04
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 3e-04
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 3e-04
1jas_A152 Hsubc2b Length = 152 3e-04
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 3e-04
1x23_A155 Crystal Structure Of Ubch5c Length = 155 3e-04
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-04
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 4e-04
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 5e-04
4ii2_C 163 Crystal Structure Of Ubiquitin Activating Enzyme 1 7e-04
2pwq_A 216 Crystal Structure Of A Putative Ubiquitin Conjugati 8e-04
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 9e-04
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure 
Iteration: 1

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (92%)
Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPA 65
          +LT+NPPEGI+AGP+NEENFFEWEALI GPE TCFE GVFPA
Sbjct: 18 QLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPA 59
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
3h8k_A 164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 3e-17
2ucz_A 165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 4e-17
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 5e-17
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 2e-16
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 4e-16
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 2e-15
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 7e-15
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 1e-14
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 1e-14
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 1e-14
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 1e-14
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 2e-14
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 2e-14
1ayz_A 169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-14
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 2e-14
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 3e-14
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 4e-14
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 5e-14
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 5e-14
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 5e-14
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 5e-14
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 6e-14
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 6e-14
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 7e-14
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 8e-14
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 8e-14
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 9e-14
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 1e-13
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-13
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 2e-13
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-13
1yh2_A 169 HSPC150 protein similar to ubiquitin-conjugating e 3e-13
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 1e-12
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 7e-12
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 9e-12
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 1e-11
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 1e-11
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 1e-11
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 2e-11
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 4e-11
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 5e-11
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 1e-10
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 2e-10
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 9e-10
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 3e-09
1yf9_A 171 Ubiquitin carrier protein 4; SGPP, structural geno 5e-09
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 6e-08
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 1e-07
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 4e-07
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 9e-05
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
 Score = 69.7 bits (171), Expect = 3e-17
 Identities = 35/43 (81%), Positives = 39/43 (90%)

Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAK 66
          +LT+NPPEGI+AGP+NEENFFEWEALI GPE TCFE GVFPA 
Sbjct: 14 QLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAI 56
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
2ucz_A 165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.87
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.86
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.86
3h8k_A 164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.86
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.85
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.85
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.85
1ayz_A 169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.85
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.85
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.85
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.85
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.84
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.84
1yh2_A 169 HSPC150 protein similar to ubiquitin-conjugating e 99.84
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.84
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.84
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.83
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.83
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.83
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.83
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.83
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.83
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.83
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.82
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.82
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.82
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.82
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.82
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.82
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.82
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.82
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.82
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.81
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.81
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.8
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.8
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.79
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.79
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.78
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.78
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.77
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.76
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.75
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.75
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.74
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.72
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.72
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.7
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.69
1yf9_A 171 Ubiquitin carrier protein 4; SGPP, structural geno 99.68
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.66
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.36
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 98.19
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 94.17
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 83.4
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
Probab=99.87  E-value=5.7e-22  Score=121.98  Aligned_cols=63  Identities=35%  Similarity=0.587  Sum_probs=58.6

Q ss_pred             CChhhhhHHHHHHHHHhhCCCCCEEEeecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecCC
Q psy10014         10 PSRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS   72 (72)
Q Consensus        10 ~s~~~~~Rl~kE~~~l~~~~~~~i~~~~~~~~nl~~w~~~i~GP~~tpy~gg~f~~~i~fp~~   72 (72)
                      |++.+.+||++|+++|++++++||.+.+.+++|+++|+++|.||++|||+||.|++.|.||++
T Consensus         1 M~~~a~~RL~kEl~~l~~~~~~gi~~~~~~~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~   63 (165)
T 2ucz_A            1 MSKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKD   63 (165)
T ss_dssp             -CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCTT
T ss_pred             CChHHHHHHHHHHHHHHhCCCCCEEEEECCCCCccEEEEEEECCCCCCccCcEEEEEEECCcc
Confidence            677899999999999999999999999976679999999999999999999999999999975
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 72
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-10
d1pzva_ 161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 2e-10
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 3e-10
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 1e-09
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 2e-09
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 5e-09
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 7e-09
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 8e-09
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 6e-08
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 3e-07
d2ucza_ 164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-07
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 4e-07
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 4e-07
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 4e-07
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 5e-07
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 1e-06
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-06
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 3e-06
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 4e-06
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 4e-06
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 2e-05
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-05
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 3e-05
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 3e-05
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 1e-04
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 1e-04
d1yf9a1 158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 2e-04
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 5e-04
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 0.001
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]

 Score = 51.3 bits (122), Expect = 1e-10
 Identities = 12/42 (28%), Positives = 18/42 (42%)

Query: 24 ELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPA 65
           +  +P   I    V+E +    +    GP GT +EGG F  
Sbjct: 12 AVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 53
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
d2ucza_ 164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.85
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.85
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.84
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.84
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.84
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.83
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.83
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.83
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.83
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.82
d1pzva_ 161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.82
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.81
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.8
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.8
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.78
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.78
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.78
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.76
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.73
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.71
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.65
d1yf9a1 158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.63
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.57
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 98.24
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 94.49
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]

Probab=99.87  E-value=3.5e-22  Score=121.21  Aligned_cols=62  Identities=35%  Similarity=0.610  Sum_probs=58.4

Q ss_pred             ChhhhhHHHHHHHHHhhCCCCCEEEeecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecCC
Q psy10014         11 SRIELSPEIINCVELTINPPEGIIAGPVNEENFFEWEALITGPEGTCFEGGVFPAKDKILLS   72 (72)
Q Consensus        11 s~~~~~Rl~kE~~~l~~~~~~~i~~~~~~~~nl~~w~~~i~GP~~tpy~gg~f~~~i~fp~~   72 (72)
                      |..|.+||++|+++|++++++||.+.+.+++|++.|+++|.||++|||+||+|++.|.||++
T Consensus         1 s~~a~kRL~~E~~~l~~~~~~gi~~~p~~e~nl~~w~~~I~Gp~~tpy~gg~f~~~i~fp~~   62 (164)
T d2ucza_           1 SKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKD   62 (164)
T ss_dssp             CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCTT
T ss_pred             CHHHHHHHHHHHHHHhhCCCCCEEEEECCccchhhhheeeeCCCcccccCCeeEEEEecCCC
Confidence            46789999999999999999999999977779999999999999999999999999999975
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure