Psyllid ID: psy10095

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680
MTGPQTKKKKNCTNKRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEYVPPQYPMEE
cccccccccccccccHHHHHccccccccHHHHcccHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHccccccccccccEEEEccccccccccccccccEEEcccHHHHHHHHHHcccccccccccEEEEcccccccccccccccccccccccccccEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHcEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcEEEcccccccccccccccccccccccccccHHcccccEEEEEEccccHHHHHHHcccccccccHHHHHHccccccccccccccccccc
ccccccccccccccccEEEcccccccHHHHHHHHccHHHHHHHcccccccccccccEEEEcHHHHHHcHHHHHHHccccHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccEEEEccccccccccccccccccEEEEccccEEEEcccHHHHHHHHHHHHHHHHHcccccEEEccccHHEEEEEEccccccccccccEEEEccccccccccccccccEccccHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHcccccccccccccccHHHHHHHHHHHEHEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHcccccHHEEEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEHEEEEEEEEEcccHHHHcccccccccEEcccccccHHHHHccccEEEEEcccccEEHcHHccccccccccHHHHHcccccHcccccccccccccc
mtgpqtkkkknctnkrsiKTKLYKRDLDQIDGDCKEENAEKLLHQeidfdkpgeaqfYCLHCARHFIDEHALKEHFRTKVHKRRLKalevepytveeseraagygsyqtpkirkLQTQsldktaeiqpVREYCSALFITNDKlsqlcsnvspsydvkhvlENEDLIVNQLKQrridisefDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVnksklepsQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLklpnyldnstpeVYETIyeydpdregknkidmDALSKYVQYTNRLDIhylgnaakfeYLIPIILKDYftvkhnfmpftntdlckgvivegygdhylsphdnmvlvnnendlseigyeerrnhlvgSAHMSMFCAyhtnhsvnvkdlpvkyvtsgkqygfhnllcentlktskhSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYrickapadvlhtseshrlEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTrkrarglgcedgaelnmkdslDANLVQMSTNYClvlrkpytveeseraagygsyqtpkirkLQTQsldktaeyvppqypmee
mtgpqtkkkknctnkrsiktklykrdldqIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKrrlkalevepytveeseraagygsyqtpkirKLQTQSLDKTAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLvnksklepsqleKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVlklpnyldnstpEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGwlrtkcqisiirtismrirgtrkrarglgcedgaelnMKDSLDANLVQMSTNYCLVLrkpytveeseraagygsyqtpkirklqtqsldktaeyvppqypmee
MTGPQTKKKKNCTNKRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQisiirtismrirgtrKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEYVPPQYPMEE
*****************************************LLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTV***************************TAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKS**********YLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVE***************************************
*********************LYKRDLDQIDGDCK************DFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQ***************************************SNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFV************************************************FDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIY*****REGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENT*****HSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIV**********KLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEE*E******SYQTPKIRKL**QSLDKTAEYV*PQ*****
*************NKRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEYVPPQYPMEE
***************RSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQ***I***************PVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEYVPPQY****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGPQTKKKKNCTNKRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEIQPVREYCSALFITNDKLSQLCSNVSPSYDVKHVLENEDLIVNQLKQRRIDISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLERKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVYETIYEYDPDREGKNKIDMDALSKYVQYTNRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNNHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWMKKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNRSYAQVLGWLRTKCQISIIRTISMRIRGTRKRARGLGCEDGAELNMKDSLDANLVQMSTNYCLVLRKPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEYVPPQYPMEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query680 2.2.26 [Sep-21-2011]
B0BLT0128 Zinc finger protein 593 O yes N/A 0.164 0.875 0.605 6e-30
Q9W3Y0162 Zinc finger protein 593 h yes N/A 0.113 0.475 0.662 8e-27
Q9U239128 Zinc finger protein 593 h yes N/A 0.161 0.859 0.478 5e-19
O00488134 Zinc finger protein 593 O yes N/A 0.163 0.828 0.429 4e-17
Q9DB42134 Zinc finger protein 593 O yes N/A 0.141 0.716 0.474 3e-16
Q08004166 Bud site selection protei yes N/A 0.166 0.680 0.425 2e-15
Q9P370124 Zinc finger protein bud20 yes N/A 0.169 0.927 0.436 4e-15
Q553S1141 Zinc finger protein 593 h yes N/A 0.138 0.666 0.402 1e-12
Q8SWF6104 Zinc finger C2H2 protein yes N/A 0.144 0.942 0.355 1e-07
Q9NP81518 Serine--tRNA ligase, mito no N/A 0.511 0.671 0.193 9e-05
>sp|B0BLT0|ZN593_XENTR Zinc finger protein 593 OS=Xenopus tropicalis GN=znf593 PE=2 SV=1 Back     alignment and function desciption
 Score =  133 bits (334), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 84/114 (73%), Gaps = 2/114 (1%)

Query: 5   QTKKKKNCTNKRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCAR 64
           ++ KKKN +  +  KTK   +DLDQI  D K ENA+ LL+QEID+  PG AQ YCLHC+R
Sbjct: 11  KSDKKKNIS--KLWKTKRRVKDLDQIHHDMKPENAKLLLNQEIDYQLPGNAQHYCLHCSR 68

Query: 65  HFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQ 118
           +F+D   LKEHF+TKVHKRRLK L  EPYT EE+ERAAG GSY  PK+  +QTQ
Sbjct: 69  YFVDLKTLKEHFKTKVHKRRLKQLREEPYTQEEAERAAGMGSYIPPKLINVQTQ 122

Xenopus tropicalis (taxid: 8364)
>sp|Q9W3Y0|ZN593_DROME Zinc finger protein 593 homolog OS=Drosophila melanogaster GN=CG3224 PE=2 SV=1 Back     alignment and function description
>sp|Q9U239|ZN593_CAEEL Zinc finger protein 593 homolog OS=Caenorhabditis elegans GN=Y56A3A.18 PE=3 SV=1 Back     alignment and function description
>sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2 Back     alignment and function description
>sp|Q9DB42|ZN593_MOUSE Zinc finger protein 593 OS=Mus musculus GN=Znf593 PE=2 SV=2 Back     alignment and function description
>sp|Q08004|BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD20 PE=1 SV=1 Back     alignment and function description
>sp|Q9P370|BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud20 PE=3 SV=1 Back     alignment and function description
>sp|Q553S1|ZN593_DICDI Zinc finger protein 593 homolog OS=Dictyostelium discoideum GN=DDB_G0275351 PE=3 SV=1 Back     alignment and function description
>sp|Q8SWF6|Z231_ENCCU Zinc finger C2H2 protein ECU02_0310 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0310 PE=3 SV=1 Back     alignment and function description
>sp|Q9NP81|SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens GN=SARS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
91080729133 PREDICTED: similar to CG3224 CG3224-PA [ 0.151 0.774 0.699 1e-36
193575627145 PREDICTED: zinc finger protein 593-like 0.197 0.924 0.532 6e-34
357631595150 hypothetical protein KGM_15560 [Danaus p 0.152 0.693 0.673 8e-34
332026291139 Zinc finger protein 593 [Acromyrmex echi 0.154 0.755 0.647 1e-32
383855682143 PREDICTED: zinc finger protein 593 homol 0.167 0.797 0.571 5e-32
332375072137 unknown [Dendroctonus ponderosae] 0.147 0.729 0.68 6e-32
350417764143 PREDICTED: zinc finger protein 593 homol 0.151 0.720 0.616 2e-31
307208300142 Zinc finger protein 593-like protein [Ha 0.151 0.725 0.640 2e-31
110757739143 PREDICTED: zinc finger protein 593 homol 0.151 0.720 0.621 3e-31
380017055143 PREDICTED: zinc finger protein 593 homol 0.151 0.720 0.611 6e-31
>gi|91080729|ref|XP_975414.1| PREDICTED: similar to CG3224 CG3224-PA [Tribolium castaneum] gi|270005870|gb|EFA02318.1| hypothetical protein TcasGA2_TC007984 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  161 bits (407), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 91/103 (88%)

Query: 15  KRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCARHFIDEHALKE 74
           K+  +TK   +DLDQID D K ENAEKL++QE+D+DKPG AQFYC+HCAR+FID+HAL E
Sbjct: 16  KKKWRTKRRTKDLDQIDEDIKPENAEKLVNQEVDYDKPGSAQFYCVHCARYFIDDHALHE 75

Query: 75  HFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQT 117
           HFRTKVHKRRLKALE+EPYT+EESERAAG+G+++ P+ RK++T
Sbjct: 76  HFRTKVHKRRLKALELEPYTIEESERAAGFGNWKAPEKRKIET 118

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193575627|ref|XP_001943955.1| PREDICTED: zinc finger protein 593-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357631595|gb|EHJ79064.1| hypothetical protein KGM_15560 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332026291|gb|EGI66428.1| Zinc finger protein 593 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383855682|ref|XP_003703339.1| PREDICTED: zinc finger protein 593 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|332375072|gb|AEE62677.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|350417764|ref|XP_003491583.1| PREDICTED: zinc finger protein 593 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|307208300|gb|EFN85725.1| Zinc finger protein 593-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|110757739|ref|XP_001120173.1| PREDICTED: zinc finger protein 593 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|380017055|ref|XP_003692481.1| PREDICTED: zinc finger protein 593 homolog [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
FB|FBgn0029885162 CG3224 [Drosophila melanogaste 0.169 0.709 0.55 1.1e-29
UNIPROTKB|Q5ZIT0133 ZNF593 "Uncharacterized protei 0.164 0.842 0.589 1.9e-29
ZFIN|ZDB-GENE-040426-1789129 znf593 "zinc finger protein 59 0.166 0.875 0.530 2.7e-26
WB|WBGene00013236128 Y56A3A.18 [Caenorhabditis eleg 0.163 0.867 0.487 1.4e-20
UNIPROTKB|O00488134 ZNF593 "Zinc finger protein 59 0.163 0.828 0.429 2.4e-17
UNIPROTKB|J9PB33182 ZNF593 "Uncharacterized protei 0.141 0.527 0.484 6.5e-17
SGD|S000004064166 BUD20 "Protein involved in bud 0.182 0.746 0.406 6.5e-17
POMBASE|SPAC19B12.11c124 SPAC19B12.11c "zinc finger pro 0.169 0.927 0.436 1.1e-16
UNIPROTKB|F1N7I8134 ZNF593 "Uncharacterized protei 0.163 0.828 0.438 1.4e-16
MGI|MGI:1915290134 Zfp593 "zinc finger protein 59 0.141 0.716 0.474 1.7e-16
FB|FBgn0029885 CG3224 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 1.1e-29, P = 1.1e-29
 Identities = 66/120 (55%), Positives = 91/120 (75%)

Query:     3 GPQTKKKK---NCTN-KRSIKTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFY 58
             G  +K+KK     T+ +R  + +  +RDLDQID D +  + E L++Q +D DKPG AQFY
Sbjct:     2 GMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQTRSGE-LINQNVDLDKPGFAQFY 60

Query:    59 CLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQ 118
             C+HCA++FID+ A++ HFRTKVHKRRLKALE+EPY++EE+ERAAG GS+  PK R ++TQ
Sbjct:    61 CVHCAKYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQ 120
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZIT0 ZNF593 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1789 znf593 "zinc finger protein 593" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00013236 Y56A3A.18 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O00488 ZNF593 "Zinc finger protein 593" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9PB33 ZNF593 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000004064 BUD20 "Protein involved in bud-site selection" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPAC19B12.11c SPAC19B12.11c "zinc finger protein, human ZNF593 ortholog" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7I8 ZNF593 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915290 Zfp593 "zinc finger protein 593" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B0BLT0ZN593_XENTRNo assigned EC number0.60520.16470.875yesN/A
Q9W3Y0ZN593_DROMENo assigned EC number0.66230.11320.4753yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
COG5112126 COG5112, UFD2, U1-like Zn-finger-containing protei 2e-24
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 4e-08
TIGR00414418 TIGR00414, serS, seryl-tRNA synthetase 2e-04
>gnl|CDD|227443 COG5112, UFD2, U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information 
 Score = 99.0 bits (246), Expect = 2e-24
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 6   TKKKKNCTNKRSI-KTKLYKRDLDQIDGDCKEENAEKLLHQEIDFDKPGEAQFYCLHCAR 64
           TK+KK  +N+  I +T+L+ RDLDQI  D   + ++K L    D + PG  Q YC+ CAR
Sbjct: 6   TKRKKRRSNRLRIKRTRLFGRDLDQIKNDLSTKESQKKL--PYDPELPGLGQHYCIECAR 63

Query: 65  HFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGY 104
           +FI E AL EH + KVHKRR K L   PYT E++E A G 
Sbjct: 64  YFITEKALMEHKKGKVHKRRAKELREVPYTQEDAEAAVGL 103

Length = 126
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 680
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal 100.0
PLN02320502 seryl-tRNA synthetase 100.0
PLN02678448 seryl-tRNA synthetase 100.0
KOG2509|consensus455 100.0
PRK05431425 seryl-tRNA synthetase; Provisional 100.0
TIGR00414418 serS seryl-tRNA synthetase. This model represents 100.0
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 100.0
PRK00960517 seryl-tRNA synthetase; Provisional 100.0
TIGR00415520 serS_MJ seryl-tRNA synthetase, Methanococcus janna 100.0
KOG3408|consensus129 100.0
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 100.0
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 100.0
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 100.0
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 100.0
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 99.98
PF00587173 tRNA-synt_2b: tRNA synthetase class II core domain 99.97
PLN02837614 threonine-tRNA ligase 99.95
PRK09194 565 prolyl-tRNA synthetase; Provisional 99.95
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 99.93
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 99.93
PRK08661477 prolyl-tRNA synthetase; Provisional 99.93
PRK03991613 threonyl-tRNA synthetase; Validated 99.91
PLN02908686 threonyl-tRNA synthetase 99.91
TIGR00408472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.89
TIGR00418563 thrS threonyl-tRNA synthetase. This model represen 99.88
PRK12305575 thrS threonyl-tRNA synthetase; Reviewed 99.87
PRK14799545 thrS threonyl-tRNA synthetase; Provisional 99.86
PRK12444639 threonyl-tRNA synthetase; Reviewed 99.85
PRK12325439 prolyl-tRNA synthetase; Provisional 99.78
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 99.74
PRK00413638 thrS threonyl-tRNA synthetase; Reviewed 99.68
PRK04173456 glycyl-tRNA synthetase; Provisional 99.68
KOG3408|consensus129 99.66
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 99.39
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 99.35
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl s 99.32
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, riboso 99.04
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 98.85
PRK09537417 pylS pyrolysyl-tRNA synthetase; Reviewed 98.84
KOG2324|consensus457 98.74
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetas 98.7
PRK14894 539 glycyl-tRNA synthetase; Provisional 98.54
KOG1637|consensus560 98.53
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 98.53
PRK07080317 hypothetical protein; Validated 98.18
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.16
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 98.06
TIGR00389551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 98.03
PRK00037412 hisS histidyl-tRNA synthetase; Reviewed 97.85
TIGR00442397 hisS histidyl-tRNA synthetase. This model finds a 97.82
PLN02734 684 glycyl-tRNA synthetase 97.79
TIGR02367453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 97.62
CHL00201430 syh histidine-tRNA synthetase; Provisional 97.6
TIGR00443314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 97.58
PF01409247 tRNA-synt_2d: tRNA synthetases class II core domai 97.32
PLN02530487 histidine-tRNA ligase 97.25
PRK12292391 hisZ ATP phosphoribosyltransferase regulatory subu 97.22
PRK12420423 histidyl-tRNA synthetase; Provisional 97.18
PRK00488339 pheS phenylalanyl-tRNA synthetase subunit alpha; V 97.13
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [T 97.08
PTZ00326494 phenylalanyl-tRNA synthetase alpha chain; Provisio 96.88
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subu 96.85
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.82
COG0124429 HisS Histidyl-tRNA synthetase [Translation, riboso 96.8
PRK12421392 ATP phosphoribosyltransferase regulatory subunit; 96.7
PLN02853492 Probable phenylalanyl-tRNA synthetase alpha chain 96.6
TIGR00468294 pheS phenylalanyl-tRNA synthetase, alpha subunit. 95.91
PLN02972763 Histidyl-tRNA synthetase 95.73
KOG0717|consensus508 95.37
PF13393311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 95.35
PRK04172489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 95.27
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 94.72
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 94.68
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subu 94.56
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 93.43
TIGR00470533 sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam 93.39
COG5188470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 93.19
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 93.13
PF00152335 tRNA-synt_2: tRNA synthetases class II (D, K and N 92.63
PRK09350306 poxB regulator PoxA; Provisional 92.61
PRK06462335 asparagine synthetase A; Reviewed 91.9
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 91.79
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 91.66
PRK05159437 aspC aspartyl-tRNA synthetase; Provisional 91.45
KOG4163|consensus 551 91.38
PLN02903 652 aminoacyl-tRNA ligase 91.26
TIGR00499496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 91.12
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 90.85
TIGR00458428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 90.7
PLN02502553 lysyl-tRNA synthetase 90.39
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.31
PRK03932450 asnC asparaginyl-tRNA synthetase; Validated 90.3
PTZ00417585 lysine-tRNA ligase; Provisional 90.16
PRK00476 588 aspS aspartyl-tRNA synthetase; Validated 89.99
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 89.55
PLN02532633 asparagine-tRNA synthetase 89.54
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 89.47
PTZ00401550 aspartyl-tRNA synthetase; Provisional 89.05
PLN02748468 tRNA dimethylallyltransferase 88.07
PRK12445505 lysyl-tRNA synthetase; Reviewed 88.04
PLN02603565 asparaginyl-tRNA synthetase 87.39
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II co 87.06
PTZ00385659 lysyl-tRNA synthetase; Provisional 87.02
TIGR00462304 genX lysyl-tRNA synthetase-like protein GenX. Many 86.82
PLN02221572 asparaginyl-tRNA synthetase 86.16
PLN02850530 aspartate-tRNA ligase 85.89
PHA0276855 hypothetical protein; Provisional 84.71
TIGR00457453 asnS asparaginyl-tRNA synthetase. In a multiple se 84.3
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 83.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 83.72
PRK12294272 hisZ ATP phosphoribosyltransferase regulatory subu 83.49
PTZ00425586 asparagine-tRNA ligase; Provisional 82.43
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe 82.27
KOG4727|consensus193 81.06
smart0035526 ZnF_C2H2 zinc finger. 80.35
TIGR03752472 conj_TIGR03752 integrating conjugative element pro 80.22
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-95  Score=786.54  Aligned_cols=381  Identities=19%  Similarity=0.239  Sum_probs=348.7

Q ss_pred             ccchHHhhcCHHHHHHHHHhcCC-CCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCChhhHHHHHHH
Q psy10095        153 SYDVKHVLENEDLIVNQLKQRRI-DISEFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSKLEPSQLEKKYLE  231 (680)
Q Consensus       153 mLD~k~i~~n~e~v~~~l~~R~~-~~dld~l~~l~~~~r~l~~~~~~L~~~rn~lsk~i~~~k~~~~~~e~~e~e~l~~~  231 (680)
                      |+|+++||+|+|.|++++.+|+. ..++|.+++++.++|+++.+.+.|+++||++|++|++.++.+.+    +.+.++++
T Consensus         1 mld~k~ir~n~d~v~~~l~~r~~~~~~~~~~~~ld~~~r~~~~~~e~l~~~rn~~sk~ig~~~~~~~~----~~~~l~~e   76 (429)
T COG0172           1 MLDLKLIRENPDAVREKLKKRGGDALDVDKLLELDEERRKLLRELEELQAERNELSKEIGRALKRGED----DAEELIAE   76 (429)
T ss_pred             CchHHHhhhCHHHHHHHHhhcCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccch----hHHHHHHH
Confidence            89999999999999999999974 45689999999999999999999999999999999966544322    46789999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCC----CCeeEE-e-CC-----CCCCCChhhhhhcCCccccc
Q psy10095        232 RKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEV----YETIYE-Y-DP-----DREGKNKIDMDALSKYVQYT  300 (680)
Q Consensus       232 ~k~Lk~elk~Le~~l~~le~~l~~~~l~LPN~~h~~VP~~----~n~vv~-~-~p-----~~~~~~H~elg~~l~l~D~~  300 (680)
                      ++.++++++.++.++++++.++..+++.|||++|++||.+    +|++++ + .|     .|.|++|++||+.+|++||+
T Consensus        77 ~~~l~~~l~~~e~~~~~~~~~l~~~ll~ipNi~~~~VPvg~de~~n~~vr~~g~~~~~~~~f~pk~H~~lge~l~~~Df~  156 (429)
T COG0172          77 VKELKEKLKELEAALDELEAELDTLLLTIPNIPHESVPVGKDEDDNVEVRRWGEPPVFVFDFEPKDHVELGEKLGLLDFE  156 (429)
T ss_pred             HHHHHHHHHhccHHHHHHHHHHHHHHHhCCCCCccccCcCCCcccceEEEEEecCccccccCCcchHHHHhhhcCcchhh
Confidence            9999999999999999999999999999999999999943    578877 3 33     45789999999999999996


Q ss_pred             ------CcceEEEeCchHHHHHHHHHHHHHHHHhhCCcEeeccCcccchHHHHhhcCCCCCCCCceEeecCCCccccccc
Q psy10095        301 ------NRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGY  374 (680)
Q Consensus       301 ------~srfyyL~G~gA~LE~ALi~y~ld~~~~~~Gf~~i~~P~~Vr~~v~~g~G~~p~~~~~~~~i~~~~~~~~~~~~  374 (680)
                            |+|||||+|.||+|++||+|||+|.|. ++||+++.||+|||.++|.||||+|+|.+++|++.+          
T Consensus       157 ~aaKvsGsrf~~~~~~~a~L~rAL~~f~ld~~~-~~Gf~e~~~P~lv~~e~m~gtgqlpkf~e~~y~v~~----------  225 (429)
T COG0172         157 RAAKVSGSRFYFYKGKGARLERALIQFMLDLHT-KHGFTEVLPPYLVNLESMFGTGQLPKFEEDLYKVED----------  225 (429)
T ss_pred             hhcccCCCceEEEcCHHHHHHHHHHHHHHHHHH-HcCceEeeCceeecHHHhhccCCCCCCcccceEecC----------
Confidence                  789999999999999999999999987 789999999999999999999999999999999983          


Q ss_pred             cCCCceeeccchhhhhhhhhcccccCCCCCCceEeeeCcccCCCccccccccccCCCCCcccchhhhccceEEEEEecCC
Q psy10095        375 EERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSKHSRVENLYNSIQREKVNLFVGTNN  454 (680)
Q Consensus       375 ~~~~l~LigTaeevpl~~~~~~e~l~~~~LPlKy~a~s~cyr~Ea~~CFR~EaGs~G~dtrGL~RvHQF~KVE~f~~~~~  454 (680)
                        .++||||||| +||+|||+|++|+.++||+||+|    |++    |||+||||+|+|||||+|||||+|||||+|| +
T Consensus       226 --~~~~LipTaE-vpl~~l~~~Eil~~~~LP~k~~~----~S~----cFR~EAGs~GrdtrGliRvHQF~KVE~v~~~-~  293 (429)
T COG0172         226 --PDLYLIPTAE-VPLTNLHRDEILDEEDLPIKYTA----YSP----CFRSEAGSAGKDTRGLIRVHQFDKVELVVIT-K  293 (429)
T ss_pred             --CCEEEEecch-hhhHHhhcccccccccCCeeeEE----ECh----hhhcccccccccccceeeeeeeeeEEEEEEe-C
Confidence              3799999997 99999999999999999999999    666    7777899999999999999999999999999 9


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHcCCceEEeecCCCCCCcccccceeeeeeecCCCceeeeeecCcchhhhHHHHHHHHHHH
Q psy10095        455 HENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLNSWVTCMDLNAKVYIQIVFFIQEMSWM  534 (680)
Q Consensus       455 pe~S~~~~eeml~~~e~il~~L~LpyRVv~m~tgdLg~~a~kkyDIEvW~P~~~~Y~EisS~Sn~~~~q~~~~~~e~~~~  534 (680)
                      ||+|+.+||+|+++|++|++.|+||||||.+|||||||+|++|||||||||++++|+||||||||+++|           
T Consensus       294 Pe~S~~~~E~m~~~ae~il~~LeLPyRvv~lctGDlgf~a~kkYDlEvWlP~q~~yrEisScSnc~DfQ-----------  362 (429)
T COG0172         294 PEESEEELEEMLGNAEEVLQELELPYRVVNLCTGDLGFSAAKKYDLEVWLPGQNKYREISSCSNCTDFQ-----------  362 (429)
T ss_pred             cchhHHHHHHHHHHHHHHHHHhCCCceEeeeccCCcCCcccCceeEEEEecCCCCceeeeeeeccccHH-----------
Confidence            999999999999999999999999999999999999999999999999999999999999999999999           


Q ss_pred             HhhhccccccccCCCCcccchHHHHHHHHHHhhhcC-Cc-ccchhhhhhchhHHHHHHHHhhhcc
Q psy10095        535 KKLAEKIIPNIDENIGMEYMSFLKRTADRLCMKWNR-SY-AQVLGWLRTKCQISIIRTISMRIRG  597 (680)
Q Consensus       535 ~k~~~~l~~s~dG~~g~e~~~F~krLA~~Ls~Kw~~-~y-s~~i~wir~~~sfailr~~~~c~~g  597 (680)
                                                |.|+-++|+. .. +..+-++.+....|+.|+...=+-+
T Consensus       363 --------------------------aRR~~~Ryr~~~~~k~~~vhTLNGsglA~~R~l~AilEN  401 (429)
T COG0172         363 --------------------------ARRLNIRYRDKEEGKREFVHTLNGSGLAVGRTLVAILEN  401 (429)
T ss_pred             --------------------------HHHHhcccccccCCCcEEEEeccchHHHHHHHHHHHHHc
Confidence                                      7888888854 34 4456777888888999987766554

>PLN02320 seryl-tRNA synthetase Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>KOG2509|consensus Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2324|consensus Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1637|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG4163|consensus Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>PLN02221 asparaginyl-tRNA synthetase Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PTZ00425 asparagine-tRNA ligase; Provisional Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>KOG4727|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
1zr9_A124 Solution Structure Of A Human C2h2-Type Zinc Finger 2e-17
1wle_A501 Crystal Structure Of Mammalian Mitochondrial Seryl- 3e-05
>pdb|1ZR9|A Chain A, Solution Structure Of A Human C2h2-Type Zinc Finger Protein Length = 124 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 3/111 (2%)
Query: 19  KTKLYKRDLDQIDGDCKEENAEKLL---HQEIDFDKPGEAQFYCLHCARHFIDEHALKEH 75
           K K  + DLD+I  + + + + +     + E D D PG     CL CAR+FID   LK H
Sbjct: 10  KAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTH 69
Query: 76  FRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEI 126
           FR+K HK+RLK L VEPY+ EE+ERAAG GSY  P+   + T+   +  E+
Sbjct: 70  FRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEM 120
>pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna Synthetase Complexed With Seryl-Adenylate Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 2e-37
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
 Score =  134 bits (339), Expect = 2e-37
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 3/117 (2%)

Query: 14  NKRSIKTKLYKRDLDQIDGDCKEENAEKLL---HQEIDFDKPGEAQFYCLHCARHFIDEH 70
           +    K K  + DLD+I  + + + + +     + E D D PG     CL CAR+FID  
Sbjct: 5   HHHLEKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDST 64

Query: 71  ALKEHFRTKVHKRRLKALEVEPYTVEESERAAGYGSYQTPKIRKLQTQSLDKTAEIQ 127
            LK HFR+K HK+RLK L VEPY+ EE+ERAAG GSY  P+   + T+   +  E+ 
Sbjct: 65  NLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMD 121
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 100.0
3qne_A485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 100.0
3vbb_A522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 100.0
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 100.0
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 100.0
1ses_A421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 100.0
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 100.0
3err_A536 Fusion protein of microtubule binding domain from 100.0
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl- 100.0
1nj1_A501 PROR, proline-tRNA synthetase, proline--tRNA ligas 100.0
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 100.0
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 99.97
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.97
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.96
3uh0_A460 Threonyl-tRNA synthetase, mitochondrial; threonine 99.93
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, 99.9
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 99.9
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 99.89
3ikl_A459 DNA polymerase subunit gamma-2, mitochondrial; tra 99.88
1nj8_A459 Proline-tRNA synthetase, proline--tRNA ligase; cla 99.86
1ati_A505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.84
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.82
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 99.81
3a32_A471 Probable threonyl-tRNA synthetase 1; aeropyrum per 99.74
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 99.74
1g5h_A454 Mitochondrial DNA polymerase accessory subunit; in 99.53
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 99.38
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 99.13
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 98.86
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 98.85
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 98.53
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 98.47
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; 98.45
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 98.3
3rac_A373 Histidine-tRNA ligase; structural genomics, PSI-bi 98.19
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 98.17
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; 98.11
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 97.91
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 97.89
4g84_A464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 97.45
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.42
4g85_A517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 97.09
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; 96.07
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enz 96.01
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 95.9
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; struc 95.86
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 94.72
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterote 93.72
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.25
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 93.24
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 93.02
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 92.97
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 92.3
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 92.27
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 92.22
3pco_A327 Phenylalanyl-tRNA synthetase, alpha subunit; amino 91.93
2xgt_A435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 91.71
1e1o_A504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 91.4
2du7_A549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 90.9
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 90.14
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 89.7
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 89.57
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 89.56
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 89.47
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 89.43
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; class 88.78
4ex5_A529 Lysine--tRNA ligase; structural genomics, niaid, n 88.72
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 88.34
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 87.85
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 87.67
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 87.47
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 87.16
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 87.06
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 86.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.9
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 86.88
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 86.77
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 86.74
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.61
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 86.5
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.31
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 86.24
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.21
1ard_A29 Yeast transcription factor ADR1; transcription reg 86.17
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.48
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.25
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.63
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 84.96
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.37
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 84.33
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 84.3
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 83.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 83.75
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.44
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 83.36
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 83.85
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 83.18
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 83.09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 83.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 82.91
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 82.86
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 82.73
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 82.67
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 82.66
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 82.59
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 82.28
1paa_A30 Yeast transcription factor ADR1; transcription reg 82.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 82.14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 82.12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.92
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.68
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.63
2du3_A534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 81.55
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.48
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 82.24
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.29
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 81.2
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.1
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 81.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.99
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 80.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 80.97
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 80.96
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 80.82
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 80.8
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 80.79
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.69
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.65
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.64
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 80.62
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 80.54
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 80.52
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.48
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.36
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.34
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.27
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 80.18
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.18
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.17
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 80.16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 80.13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.1
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.02
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-83  Score=707.39  Aligned_cols=350  Identities=12%  Similarity=0.158  Sum_probs=317.6

Q ss_pred             ccchHHhhcCH--HHHHHHHHhcCCCCC-hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCC----------
Q psy10095        153 SYDVKHVLENE--DLIVNQLKQRRIDIS-EFDFTQMREKYKEFVGVEKITTELEHKLVDLEQYLLVNKSK----------  219 (680)
Q Consensus       153 mLD~k~i~~n~--e~v~~~l~~R~~~~d-ld~l~~l~~~~r~l~~~~~~L~~~rn~lsk~i~~~k~~~~~----------  219 (680)
                      |||+++||+|+  +.|++++++|+.+++ +|+|+++|++||+++.++++|+++||++|++|+++++.++.          
T Consensus         7 mldi~~~r~~~~~~~v~~~~~~R~~~~~~~d~~~~ld~~~r~~~~~~~~l~~~rN~~sk~i~~~~~~~~~~~~~~~~~~~   86 (484)
T 3lss_A            7 VLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEADGDTSEIPPQ   86 (484)
T ss_dssp             CCCGGGGGSHHHHHHHHHHHHHTTCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC----------
T ss_pred             cccHHHHHcCCCHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccccccc
Confidence            89999999995  999999999999887 79999999999999999999999999999999998763210          


Q ss_pred             ---------CChhhHHHH----HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCCC-----CeeEE-e-
Q psy10095        220 ---------LEPSQLEKK----YLE-RKQLKAEIKKFDSFMLDYQRNVIIKVLKLPNYLDNSTPEVY-----ETIYE-Y-  278 (680)
Q Consensus       220 ---------~e~~e~e~l----~~~-~k~Lk~elk~Le~~l~~le~~l~~~~l~LPN~~h~~VP~~~-----n~vv~-~-  278 (680)
                               ...++.+++    +++ +++|+++|++|++++.++++++..+++.|||++||+||.+.     |++++ | 
T Consensus        87 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~i~~le~~~~~~~~~~~~~l~~iPN~~~~~vP~g~~e~~~n~~v~~~g  166 (484)
T 3lss_A           87 VKEAYENGTLKGEQVEQLCVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFG  166 (484)
T ss_dssp             ------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCCTTSCCCSCHHHHCEEEEEES
T ss_pred             ccccccccccchhhHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCccCCCCCCcccCcEEEEecC
Confidence                     011345667    888 99999999999999999999999999999999999999652     77776 4 


Q ss_pred             -CCCCCCCChhhhhhcCCccccc-------CcceEEEeCchHHHHHHHHHHHHHHHHhhCCcEeeccCcccchHHHHhhc
Q psy10095        279 -DPDREGKNKIDMDALSKYVQYT-------NRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDLCKGVIVEGYG  350 (680)
Q Consensus       279 -~p~~~~~~H~elg~~l~l~D~~-------~srfyyL~G~gA~LE~ALi~y~ld~~~~~~Gf~~i~~P~~Vr~~v~~g~G  350 (680)
                       .|.|++++|++||+++|||||+       |++||||+|.||+|++||++|++|.+. ++||++|++|+||+.+++++||
T Consensus       167 ~~~~~~~rdH~~Lg~~l~l~df~~~a~k~sGsgf~~~~p~GarL~~aL~~f~~d~~~-~~Gy~eV~~P~lv~~~l~~~sG  245 (484)
T 3lss_A          167 NTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLV-KRGYTPFYPPFFLNRDVMGEVA  245 (484)
T ss_dssp             CTTCCCSSCHHHHHHHTTCEECSHHHHHHHCTTCCEEEHHHHHHHHHHHHHHHHHHH-TTTCEEEECCSEEEHHHHHHHS
T ss_pred             CCCCCCCCCHHHHHhhCCceeccccccccCCceEEEECCHHHHHHHHHHHHHHHHHH-HcCCEEEecCccccHHHHHhcC
Confidence             4467899999999999999995       689999999999999999999999876 5799999999999999999999


Q ss_pred             CCCCCCCCceEeecCCCccccccccCCCceeeccchhhhhhhhhcccccCCCCCCceEeeeCcccCCCccccccccccCC
Q psy10095        351 DHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNLLCENTLKTSK  430 (680)
Q Consensus       351 ~~p~~~~~~~~i~~~~~~~~~~~~~~~~l~LigTaeevpl~~~~~~e~l~~~~LPlKy~a~s~cyr~Ea~~CFR~EaGs~  430 (680)
                      ++|+|.+++|.+..          .++++||+||+| +|++++|+++++...+||++|+++|+|||.        |+||+
T Consensus       246 ~~~~f~e~mf~v~~----------~~~~~~L~PTaE-~~l~~l~~~~i~sy~dLPlr~~~~s~cFR~--------Eags~  306 (484)
T 3lss_A          246 QLSQFDEELYQVSG----------DGDKKYLIATSE-MPIAAYHRGRWFTELKEPLKYAGMSTCFRK--------EAGAH  306 (484)
T ss_dssp             CHHHHHHTCCEEES----------SSSCEEECSSTH-HHHHHHTTTCEESCCSSCEEEEEEEEEECC--------CTTCS
T ss_pred             CcccccccceEeec----------CCcceEEeccCc-HHHHHHHhccccchhhCCeeEEeecCccCC--------CCCcC
Confidence            99999999998873          135799999997 899999999999999999999996666655        57999


Q ss_pred             CCCcccchhhhccceEEEEEecCChhH--HHHHHHHHHHHHHHHHHHcCCceEEeecCCCCCCcccccceeeeeeecCCC
Q psy10095        431 HSRVENLYNSIQREKVNLFVGTNNHEN--LCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLEYQVYSYSLN  508 (680)
Q Consensus       431 G~dtrGL~RvHQF~KVE~f~~~~~pe~--S~~~~eeml~~~e~il~~L~LpyRVv~m~tgdLg~~a~kkyDIEvW~P~~~  508 (680)
                      |+|++||||||||+|||||+|| +|++  |+++|++|++++++||+.||||||||.+||||||++|+++||||||||+++
T Consensus       307 Grdt~GL~RvrqF~kvE~~~f~-~pe~~~s~~e~e~~~~~~e~il~~LGLpyrvv~l~tgdlg~~a~~~yDiE~w~P~~~  385 (484)
T 3lss_A          307 GRDTLGIFRVHQFDKIEQFVVC-SPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASG  385 (484)
T ss_dssp             SSCCSTTSSCSEEEEEEEEEEE-CSSTTHHHHHHHHHHHHHHHHHHHHTCCEEEEECCTTTCCSSCSEEEEEEEEETTTT
T ss_pred             CcccCCcceeeeEEEEEEEEEe-CcchHHHHHHHHHHHHHHHHHHHHcCCcEEEEEcCCcccCCchhheechheecCCCC
Confidence            9999999999999999999999 8998  999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeecCcchhhh
Q psy10095        509 SWVTCMDLNAKVYIQ  523 (680)
Q Consensus       509 ~Y~EisS~Sn~~~~q  523 (680)
                      .|+||||||||+++|
T Consensus       386 ~~~EIsS~Snc~dyq  400 (484)
T 3lss_A          386 AFRELVSCSNCTDYQ  400 (484)
T ss_dssp             EEEEEEEEEECTTHH
T ss_pred             CeeEEEEecCccccc
Confidence            999999999999999
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 680
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 4e-30
d1seta1110 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {T 0.003
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  110 bits (277), Expect = 4e-30
 Identities = 39/63 (61%), Positives = 44/63 (69%)

Query: 45  QEIDFDKPGEAQFYCLHCARHFIDEHALKEHFRTKVHKRRLKALEVEPYTVEESERAAGY 104
            E D D PG     CL CAR+FID   LK HFR+K HK+RLK L VEPY+ EE+ERAAG 
Sbjct: 4   AEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGM 63

Query: 105 GSY 107
           GSY
Sbjct: 64  GSY 66
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
d1seta2311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 100.0
d1nyra4291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 100.0
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.96
d1qf6a4291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 99.95
d1nj1a3265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 99.93
d1nj8a3268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 99.93
d1hc7a2272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 99.91
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 99.86
d1g5ha2290 The aaRS-like accessory subunit of mitochondrial p 99.72
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.47
d1b76a2331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 99.01
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 98.44
d1z7ma1318 ATP phosphoribosyltransferase regulatory subunit H 96.92
d1wu7a2327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 96.64
d1kmma2322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 96.37
d1h4vb2324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 96.33
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS 95.75
d1qe0a2325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 95.66
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 95.07
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 94.87
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.43
d1eova2353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 90.78
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 90.67
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 89.76
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.3
d1b8aa2335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 89.1
d1c0aa3346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 88.42
d1usya_275 ATP phosphoribosyltransferase regulatory subunit H 88.38
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 88.31
d1e1oa2342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 88.16
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 87.72
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 87.1
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 87.07
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 86.91
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 85.65
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 84.54
d2cota238 Zinc finger and SCAN domain-containing protein 16, 83.14
d1n9wa2304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 83.09
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 82.89
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 82.52
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 82.02
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 81.78
d2f23a175 GreA transcript cleavage protein, N-terminal domai 81.75
d1y0jb136 U-shaped transcription factor, different fingers { 80.48
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=100.00  E-value=1e-68  Score=562.78  Aligned_cols=232  Identities=16%  Similarity=0.203  Sum_probs=214.0

Q ss_pred             CCCeeEE-e--CCC--CCCCChhhhhhcCCccccc-----CcceEEEeCchHHHHHHHHHHHHHHHHhhCCcEeeccCcc
Q psy10095        271 VYETIYE-Y--DPD--REGKNKIDMDALSKYVQYT-----NRLDIHYLGNAAKFEYLIPIILKDYFTVKHNFMPFTNTDL  340 (680)
Q Consensus       271 ~~n~vv~-~--~p~--~~~~~H~elg~~l~l~D~~-----~srfyyL~G~gA~LE~ALi~y~ld~~~~~~Gf~~i~~P~~  340 (680)
                      ++|++++ |  .|+  |++++|+|||+++||+|+.     |+|||||+|+||+||+||+|||+|.+. ++||++|+||+|
T Consensus         5 ~~n~~i~~~G~~~~~~f~~k~H~el~~~l~l~d~~~~k~sG~rfy~l~g~~a~Le~AL~~~~ld~~~-~~gy~~v~~P~l   83 (311)
T d1seta2           5 EANREIKRVGGPPEFSFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMA-RRGFLPMTLPSY   83 (311)
T ss_dssp             GGCEEEEEESCCCCCSSCCCCHHHHHHHHTCBCTTHHHHHCSSCCCEEHHHHHHHHHHHHHHHHHHH-HTTCEEEECCSE
T ss_pred             cCCEEEEEECCCCCCCCCCCCHHHHHHHcCCcchhhceeecCceEEEECHHHHHHHHHHHHHHHhhh-cccceEEeechh
Confidence            4578777 4  454  5889999999999999986     799999999999999999999999875 579999999999


Q ss_pred             cchHHHHhhcCCCCCCCCceEeecCCCccccccccCCCceeeccchhhhhhhhhcccccCCCCCCceEeeeCcccCCCcc
Q psy10095        341 CKGVIVEGYGDHYLSPHDNMVLVNNENDLSEIGYEERRNHLVGSAHMSMFCAYHTNHSVNVKDLPVKYVTSGKQYGFHNL  420 (680)
Q Consensus       341 Vr~~v~~g~G~~p~~~~~~~~i~~~~~~~~~~~~~~~~l~LigTaeevpl~~~~~~e~l~~~~LPlKy~a~s~cyr~Ea~  420 (680)
                      |++++++|||++|+|.+++|.+.+            +++||+|||| +||+|||+++++..++||+||+++|+|      
T Consensus        84 v~~~~~~~~G~~p~f~~~~y~~~~------------~~~~LipTsE-~~l~~~~~~~i~~~~~LPlr~~~~s~c------  144 (311)
T d1seta2          84 AREKAFLGTGHFPAYRDQVWAIAE------------TDLYLTGTAE-VVLNALHSGEILPYEALPLRYAGYAPA------  144 (311)
T ss_dssp             EEHHHHHHHTCTTTTGGGSCBBTT------------SSEEECSSTH-HHHHHTTTTCEEEGGGCSEEEEEEEEE------
T ss_pred             hccchhhhcccccccccccccccc------------cceeeccccc-chhhhhhhhhhhhhhhccceEEeeccc------
Confidence            999999999999999999887652            4689999997 999999999999999999999995555      


Q ss_pred             ccccccccCCCCCcccchhhhccceEEEEEecC-ChhHHHHHHHHHHHHHHHHHHHcCCceEEeecCCCCCCccccccee
Q psy10095        421 LCENTLKTSKHSRVENLYNSIQREKVNLFVGTN-NHENLCKEFQNIQSLLKSVMDKLNMKYRICKAPADVLHTSESHRLE  499 (680)
Q Consensus       421 ~CFR~EaGs~G~dtrGL~RvHQF~KVE~f~~~~-~pe~S~~~~eeml~~~e~il~~L~LpyRVv~m~tgdLg~~a~kkyD  499 (680)
                        ||+|||++|+|++||||||||+|||||++|. +|++|+++|++|++++++++++||||||||++|++|||++|+++||
T Consensus       145 --fR~Eag~~g~~trGL~RvhQF~kvE~~~~~~~~~e~s~~~~~~~~~~~~~~~~~L~lpyrvv~~~~~dl~~~a~~~~d  222 (311)
T d1seta2         145 --FRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVD  222 (311)
T ss_dssp             --ECCCCSCTTSSCSTTSSCSEEEEEEEEEEECSCHHHHHHHHHHHHHHHHHHHHHTTCCEEEEECCTTTSCTTCSEEEE
T ss_pred             --chhhhccccccchhhhhhcccchhhhheeeccccccchhHHHHHHHHHHHHHHhhCCcchhccccCCCCchHHHhhhH
Confidence              5556899999999999999999999999994 6899999999999999999999999999999999999999999999


Q ss_pred             eeeeecCCCceeeeeecCcchhhhH
Q psy10095        500 YQVYSYSLNSWVTCMDLNAKVYIQI  524 (680)
Q Consensus       500 IEvW~P~~~~Y~EisS~Sn~~~~q~  524 (680)
                      ||||||++++|+||||||||+++|.
T Consensus       223 iE~w~P~~~~y~Ev~S~sn~~d~qs  247 (311)
T d1seta2         223 IEVYLPSEGRYRETHSCSALLDWQA  247 (311)
T ss_dssp             EEEEEGGGTEEEEEEEEEECTTHHH
T ss_pred             HHHhHhhcCCcccccCceecchHHH
Confidence            9999999999999999999999994
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f23a1 a.2.1.1 (A:3-77) GreA transcript cleavage protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure