Psyllid ID: psy10221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| 91078266 | 343 | PREDICTED: similar to GA10520-PA [Tribol | 0.910 | 0.177 | 0.721 | 2e-20 | |
| 270004863 | 349 | arrowhead [Tribolium castaneum] | 0.910 | 0.174 | 0.721 | 2e-20 | |
| 357605400 | 406 | hypothetical protein KGM_21596 [Danaus p | 0.985 | 0.162 | 0.621 | 2e-18 | |
| 379698940 | 274 | arrowhead PA [Bombyx mori] gi|346223348| | 0.940 | 0.229 | 0.619 | 2e-17 | |
| 346223350 | 105 | arrowhead PB [Bombyx mori] | 0.910 | 0.580 | 0.622 | 1e-16 | |
| 328708271 | 346 | PREDICTED: LIM/homeobox protein Awh-like | 0.940 | 0.182 | 0.587 | 3e-16 | |
| 312371800 | 295 | hypothetical protein AND_21634 [Anophele | 0.895 | 0.203 | 0.616 | 7e-16 | |
| 157134682 | 306 | arrowhead [Aedes aegypti] gi|108870378|g | 0.895 | 0.196 | 0.633 | 8e-16 | |
| 170034020 | 304 | arrowhead [Culex quinquefasciatus] gi|16 | 0.880 | 0.194 | 0.627 | 1e-15 | |
| 170034030 | 169 | arrowhead [Culex quinquefasciatus] gi|16 | 1.0 | 0.396 | 0.582 | 2e-15 |
| >gi|91078266|ref|XP_971202.1| PREDICTED: similar to GA10520-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 103 bits (256), Expect = 2e-20, Method: Compositional matrix adjust.
Identities = 44/61 (72%), Positives = 52/61 (85%)
Query: 7 TELRYCVACGESITDKYLLQVSDKSWHAQCLRCCICQLVLDRHPSCFIKDEAVYCKQDYA 66
TE R C ACGE I+DK+LL+VS +SWHA+CLRCC+CQL LDR PSCFI+D A+YCK DYA
Sbjct: 78 TEYRLCSACGEPISDKFLLEVSGRSWHARCLRCCVCQLQLDRQPSCFIRDRAIYCKADYA 137
Query: 67 K 67
K
Sbjct: 138 K 138
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270004863|gb|EFA01311.1| arrowhead [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357605400|gb|EHJ64588.1| hypothetical protein KGM_21596 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|379698940|ref|NP_001243941.1| arrowhead PA [Bombyx mori] gi|346223348|dbj|BAK78925.1| arrowhead PA [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|346223350|dbj|BAK78926.1| arrowhead PB [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|328708271|ref|XP_001949712.2| PREDICTED: LIM/homeobox protein Awh-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312371800|gb|EFR19896.1| hypothetical protein AND_21634 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|157134682|ref|XP_001663345.1| arrowhead [Aedes aegypti] gi|108870378|gb|EAT34603.1| AAEL013168-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170034020|ref|XP_001844873.1| arrowhead [Culex quinquefasciatus] gi|167875281|gb|EDS38664.1| arrowhead [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170034030|ref|XP_001844878.1| arrowhead [Culex quinquefasciatus] gi|167875286|gb|EDS38669.1| arrowhead [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| FB|FBgn0013751 | 275 | Awh "Arrowhead" [Drosophila me | 0.910 | 0.221 | 0.606 | 1.4e-18 | |
| ZFIN|ZDB-GENE-031008-2 | 332 | lhx8a "LIM homeobox 8a" [Danio | 0.895 | 0.180 | 0.516 | 2.5e-15 | |
| UNIPROTKB|J9PBA6 | 295 | LHX8 "Uncharacterized protein" | 0.805 | 0.183 | 0.537 | 1.4e-14 | |
| UNIPROTKB|H0YL58 | 68 | LHX8 "LIM/homeobox protein Lhx | 0.805 | 0.794 | 0.537 | 2.3e-14 | |
| UNIPROTKB|C8YLT4 | 295 | Lhx8 "LIM homeobox 8" [Sus scr | 0.805 | 0.183 | 0.537 | 3.2e-14 | |
| UNIPROTKB|E2REU0 | 379 | LHX8 "Uncharacterized protein" | 0.805 | 0.142 | 0.537 | 4.2e-14 | |
| UNIPROTKB|F1P4G9 | 347 | LHX8 "Uncharacterized protein" | 0.805 | 0.155 | 0.537 | 5.3e-14 | |
| MGI|MGI:1096343 | 367 | Lhx8 "LIM homeobox protein 8" | 0.805 | 0.147 | 0.537 | 6.4e-14 | |
| UNIPROTKB|G3V6V6 | 367 | Lhx8 "RCG29002" [Rattus norveg | 0.805 | 0.147 | 0.537 | 6.4e-14 | |
| UNIPROTKB|E1BBB7 | 371 | LHX8 "Uncharacterized protein" | 0.805 | 0.145 | 0.537 | 6.6e-14 |
| FB|FBgn0013751 Awh "Arrowhead" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
Identities = 37/61 (60%), Positives = 45/61 (73%)
Query: 7 TELRYCVACGESITDKYLLQVSDKSWHAQCLRCCICQLVLDRHPSCFIKDEAVYCKQDYA 66
TELR C ACGE I+D++ L+V SWHA CLRCC+C LDR SCFI++ VYCK DY+
Sbjct: 3 TELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYS 62
Query: 67 K 67
K
Sbjct: 63 K 63
|
|
| ZFIN|ZDB-GENE-031008-2 lhx8a "LIM homeobox 8a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PBA6 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YL58 LHX8 "LIM/homeobox protein Lhx8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C8YLT4 Lhx8 "LIM homeobox 8" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2REU0 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4G9 LHX8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1096343 Lhx8 "LIM homeobox protein 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6V6 Lhx8 "RCG29002" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BBB7 LHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 8e-23 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 3e-16 | |
| cd09381 | 56 | cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L | 4e-14 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 4e-13 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 5e-13 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 3e-12 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 4e-12 | |
| cd09380 | 54 | cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | 5e-12 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 2e-10 | |
| cd09370 | 52 | cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | 2e-10 | |
| cd09368 | 52 | cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L | 4e-10 | |
| cd09466 | 56 | cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | 7e-10 | |
| cd09386 | 55 | cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( | 2e-09 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 3e-09 | |
| cd09468 | 52 | cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | 6e-09 | |
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 1e-08 | |
| cd09467 | 55 | cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | 1e-08 | |
| cd09462 | 74 | cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 | 1e-07 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 3e-07 | |
| cd09355 | 53 | cd09355, LIM2_Ajuba_like, The second LIM domain of | 4e-06 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 9e-06 | |
| cd09388 | 55 | cd09388, LIM1_LMO1_LMO3, The first LIM domain of L | 1e-05 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 2e-04 | |
| cd09384 | 56 | cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( | 3e-04 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 0.001 | |
| cd09353 | 60 | cd09353, LIM2_Zyxin, The second LIM domain of Zyxi | 0.001 |
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
Score = 81.3 bits (201), Expect = 8e-23
Identities = 33/54 (61%), Positives = 41/54 (75%)
Query: 12 CVACGESITDKYLLQVSDKSWHAQCLRCCICQLVLDRHPSCFIKDEAVYCKQDY 65
C CGE ITD++LL+VS +SWH CLRCC+CQ L+R PSCF +D +YCK DY
Sbjct: 1 CTGCGEPITDRFLLKVSGRSWHVSCLRCCVCQTPLERQPSCFTRDRQIYCKADY 54
|
The first LIM domain of Arrowhead (AWH): Arrowhead belongs to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. During embryogenesis of Drosophila, Arrowhead is expressed in each abdominal segment and in the labial segment. Late in embryonic development, expression of arrowhead is refined to the abdominal histoblasts and salivary gland imaginal ring cells themselves. The Arrowhead gene required for establishment of a subset of imaginal tissues: the abdominal histoblasts and the salivary gland imaginal rings. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 54 |
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | Back alignment and domain information |
|---|
| >gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | Back alignment and domain information |
|---|
| >gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.78 | |
| KOG1701|consensus | 468 | 99.53 | ||
| KOG4577|consensus | 383 | 99.35 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 99.27 | |
| KOG1701|consensus | 468 | 99.27 | ||
| KOG1044|consensus | 670 | 99.27 | ||
| KOG1703|consensus | 479 | 99.25 | ||
| KOG2272|consensus | 332 | 99.07 | ||
| KOG4577|consensus | 383 | 98.94 | ||
| KOG2272|consensus | 332 | 98.81 | ||
| KOG1700|consensus | 200 | 98.6 | ||
| KOG1700|consensus | 200 | 98.49 | ||
| KOG1702|consensus | 264 | 98.44 | ||
| KOG1703|consensus | 479 | 98.2 | ||
| KOG1044|consensus | 670 | 98.11 | ||
| KOG0490|consensus | 235 | 97.02 | ||
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 95.0 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.68 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 94.55 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.1 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 92.87 | |
| PF14471 | 51 | DUF4428: Domain of unknown function (DUF4428) | 92.16 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 90.74 | |
| PF12674 | 81 | Zn_ribbon_2: Putative zinc ribbon domain | 88.94 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 88.9 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 88.42 | |
| COG2191 | 206 | Formylmethanofuran dehydrogenase subunit E [Energy | 87.84 | |
| PF04570 | 58 | DUF581: Protein of unknown function (DUF581); Inte | 87.8 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 87.52 | |
| PF10886 | 54 | DUF2685: Protein of unknown function (DUF2685); In | 87.37 | |
| PF06689 | 41 | zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IP | 87.32 | |
| PF04810 | 40 | zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: | 85.41 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 84.85 | |
| PF00645 | 82 | zf-PARP: Poly(ADP-ribose) polymerase and DNA-Ligas | 84.57 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 84.55 | |
| KOG2893|consensus | 341 | 84.51 | ||
| PF02069 | 52 | Metallothio_Pro: Prokaryotic metallothionein; Inte | 84.42 | |
| PF13834 | 99 | DUF4193: Domain of unknown function (DUF4193) | 84.11 | |
| PRK00420 | 112 | hypothetical protein; Validated | 81.69 | |
| COG4847 | 103 | Uncharacterized protein conserved in archaea [Func | 81.08 | |
| PF07503 | 35 | zf-HYPF: HypF finger; InterPro: IPR011125 Zinc fin | 80.61 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 80.51 |
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Probab=99.78 E-value=3.5e-19 Score=79.10 Aligned_cols=55 Identities=33% Similarity=0.796 Sum_probs=49.1
Q ss_pred ccccCccccCceee-eecCceeccccccccccccccCCCCceeeeCCeecchhhhcC
Q psy10221 12 CVACGESITDKYLL-QVSDKSWHAQCLRCCICQLVLDRHPSCFIKDEAVYCKQDYAK 67 (67)
Q Consensus 12 C~~C~~~i~~~~~~-~~~~~~~h~~cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~k 67 (67)
|.+|+++|.+.+.+ .+.++.||++||+|..|+++|.+.. ++..++++||+.||.+
T Consensus 1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~-~~~~~~~~~C~~c~~~ 56 (58)
T PF00412_consen 1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGD-FYEKDGKPYCKDCYQK 56 (58)
T ss_dssp BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSS-EEEETTEEEEHHHHHH
T ss_pred CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCe-eEeECCEEECHHHHhh
Confidence 78999999977665 6999999999999999999998876 6889999999999863
|
Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include: Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types. Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein. Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO). Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation []. Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6. These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is: C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD] LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A .... |
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
| >PF14471 DUF4428: Domain of unknown function (DUF4428) | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF12674 Zn_ribbon_2: Putative zinc ribbon domain | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF04570 DUF581: Protein of unknown function (DUF581); InterPro: IPR007650 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF10886 DUF2685: Protein of unknown function (DUF2685); InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins | Back alignment and domain information |
|---|
| >PF06689 zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04810 zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00645 zf-PARP: Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region; InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >PF02069 Metallothio_Pro: Prokaryotic metallothionein; InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel | Back alignment and domain information |
|---|
| >PF13834 DUF4193: Domain of unknown function (DUF4193) | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4847 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF07503 zf-HYPF: HypF finger; InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 67 | ||||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 8e-09 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 2e-08 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 3e-08 | ||
| 1m3v_A | 122 | Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And | 4e-07 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 5e-07 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 5e-07 | ||
| 2l4z_A | 123 | Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L | 7e-07 |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
|
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-18 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 2e-15 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-15 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 6e-15 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-04 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 6e-15 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 3e-04 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 8e-15 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 1e-06 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 3e-13 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 1e-05 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 6e-13 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 9e-13 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 8e-11 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 1e-10 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-10 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 5e-04 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 3e-10 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 2e-09 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 4e-09 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-08 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 2e-08 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 4e-08 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-08 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 8e-08 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 8e-08 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-07 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 1e-07 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 3e-07 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 7e-07 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 5e-06 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 9e-07 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 2e-06 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 2e-06 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 3e-06 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 3e-06 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 3e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 4e-06 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 5e-06 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 7e-06 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 7e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 8e-06 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 1e-05 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-05 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 1e-04 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 3e-04 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 3e-04 |
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
Score = 72.1 bits (176), Expect = 1e-18
Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
Query: 7 TELRYCVACGESITDKYLLQVSDKSWHAQCLRCCICQLVL-DRHPSCFIKDEAVYCKQDY 65
+ C CG I D++LL D WH++CL+C CQ L D S + K + C+ DY
Sbjct: 59 LSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSSCQAQLGDIGTSSYTKSGMILCRNDY 118
Query: 66 AK 67
+
Sbjct: 119 IR 120
|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.82 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.82 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.81 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.81 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.81 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.8 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.8 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.8 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.8 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.79 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.79 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.78 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.78 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.78 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.78 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.78 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.78 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.78 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.77 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.77 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.77 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.77 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.77 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.77 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.77 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.76 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.76 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.76 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.75 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.75 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.75 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.75 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.75 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.75 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.74 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.74 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.74 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.72 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.72 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.72 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.71 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.69 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.67 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.64 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.6 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.58 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.54 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.52 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 98.87 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.85 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 97.58 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 96.06 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 89.28 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 89.2 | |
| 1jjd_A | 55 | Metallothionein, SMTA; zinc finger, zinc cluster, | 88.64 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 87.91 | |
| 2das_A | 62 | Zinc finger MYM-type protein 5; trash domain, stru | 85.9 | |
| 2gvi_A | 204 | Conserved hypothetical protein; structural genomic | 84.78 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 84.09 | |
| 2ds5_A | 51 | CLPX, ATP-dependent CLP protease ATP-binding subun | 82.21 | |
| 1ovx_A | 67 | ATP-dependent CLP protease ATP-binding subunit CL; | 82.19 | |
| 2dmj_A | 106 | Poly (ADP-ribose) polymerase family, member 1; zin | 81.76 | |
| 1v9x_A | 114 | Poly (ADP-ribose) polymerase; PARP, DNA repair, in | 80.38 |
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
Probab=99.82 E-value=1.4e-20 Score=86.90 Aligned_cols=62 Identities=23% Similarity=0.419 Sum_probs=54.9
Q ss_pred ccccCCccccccCccccCceeeeecCceeccccccccccccccCCCCceeeeCCeecch-hhhc
Q psy10221 4 TIITELRYCVACGESITDKYLLQVSDKSWHAQCLRCCICQLVLDRHPSCFIKDEAVYCK-QDYA 66 (67)
Q Consensus 4 ~~~~~~~~C~~C~~~i~~~~~~~~~~~~~h~~cf~C~~C~~~l~~~~~~~~~~~~~~C~-~~y~ 66 (67)
++....+.|.+|+++|.+.+.+.+.++.||++||+|..|+++|.+.. ++.+++.+||+ .||.
T Consensus 4 ~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~-~~~~~g~~yC~~~cy~ 66 (76)
T 2cu8_A 4 GSSGMASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGG-HAEHDGKPFCHKPCYA 66 (76)
T ss_dssp SCCCCCCBCTTTCCBCCTTTEEEETTEEEETTTCBCSSSCCBCCTTS-CEEETTEEECTTTHHH
T ss_pred ccCCCCCCCcCCCCEeECCeEEEECCeEeeCCCCCCCCCCCccCCCc-eEeECCEEecchHHHH
Confidence 45667789999999999777889999999999999999999998754 57899999999 7985
|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2das_A Zinc finger MYM-type protein 5; trash domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.17 | Back alignment and structure |
|---|
| >2gvi_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.87A {Thermoplasma acidophilum} SCOP: d.81.3.1 g.39.1.18 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ds5_A CLPX, ATP-dependent CLP protease ATP-binding subunit CLPX; treble cleft zinc finger, metal binding protein, protein binding; HET: PG4; 1.50A {Escherichia coli} SCOP: g.39.1.11 PDB: 2ds6_A 2ds8_A 2ds7_A | Back alignment and structure |
|---|
| >1ovx_A ATP-dependent CLP protease ATP-binding subunit CL; treble CLEF zinc finger, homodimer, metal binding protein; NMR {Escherichia coli} SCOP: g.39.1.11 | Back alignment and structure |
|---|
| >2dmj_A Poly (ADP-ribose) polymerase family, member 1; zinc finger, PARP-1, ADPRT, NAD(+) ADP-ribosyltransferase 1, poly(ADP-ribose) synthetase 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v9x_A Poly (ADP-ribose) polymerase; PARP, DNA repair, inflammation, cell death, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 67 | ||||
| d1rutx1 | 30 | g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m | 4e-07 | |
| d1j2oa1 | 30 | g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m | 5e-06 |
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: LIM only 4 (Lmo4) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 39.3 bits (92), Expect = 4e-07
Identities = 12/28 (42%), Positives = 17/28 (60%)
Query: 10 RYCVACGESITDKYLLQVSDKSWHAQCL 37
+ C CG I D++LL D WH++CL
Sbjct: 3 KRCAGCGGKIADRFLLYAMDSYWHSRCL 30
|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 99.22 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 99.04 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 99.01 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 99.01 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 99.0 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.97 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.96 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.96 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.91 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.84 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.84 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.83 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.74 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.74 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.66 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.64 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.63 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.63 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.56 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.55 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.5 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.45 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 98.43 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.4 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.39 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.37 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 98.35 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 98.34 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.32 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.31 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.27 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.23 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.22 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.2 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.17 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.11 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.1 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.05 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.99 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.98 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.93 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.93 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.9 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.72 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.69 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.66 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.64 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.62 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.58 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.55 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.45 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 97.43 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.42 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.35 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 97.24 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.18 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.05 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.89 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 96.55 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.34 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.01 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.97 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 94.32 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 91.71 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 90.2 | |
| d2dasa1 | 49 | Zinc finger MYM-type protein 5 {Human (Homo sapien | 89.51 | |
| d1uw0a_ | 117 | DNA ligase III {Human (Homo sapiens) [TaxId: 9606] | 88.86 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 88.53 | |
| d2gvia2 | 33 | Uncharacterized protein Ta1109 {Thermoplasma acido | 86.53 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 86.33 | |
| d2ds5a1 | 38 | ClpX chaperone zinc binding domain {Escherichia co | 83.83 | |
| d2d8va1 | 54 | Zinc finger FYVE domain-containing protein 19 {Mou | 80.15 |
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Thyroid receptor interacting protein 6, TRIP6 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.22 E-value=5.6e-12 Score=48.30 Aligned_cols=34 Identities=26% Similarity=0.728 Sum_probs=31.1
Q ss_pred cccccCCccccccCccccCceeeeecCceeccccc
Q psy10221 3 KTIITELRYCVACGESITDKYLLQVSDKSWHAQCL 37 (67)
Q Consensus 3 ~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~h~~cf 37 (67)
..|+.....|..|+++|.+. ++++.|+.|||.||
T Consensus 2 ~Cy~~tlEkC~~C~~~I~dr-iLrA~Gk~yHP~CF 35 (35)
T d2dloa1 2 GCYVATLEKCATCSQPILDR-ILRAMGKAYHPGCF 35 (35)
T ss_dssp CCCCSSCCBCTTTCCBCCSC-CEEETTEEECTTTC
T ss_pred hhHHHHHHHHHHhchHHHHH-HHHHhCCCCCCCCC
Confidence 35788899999999999997 89999999999998
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dasa1 g.39.1.17 (A:8-56) Zinc finger MYM-type protein 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw0a_ g.39.1.12 (A:) DNA ligase III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gvia2 g.39.1.18 (A:169-201) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ds5a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d8va1 g.43.1.1 (A:8-61) Zinc finger FYVE domain-containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|