Psyllid ID: psy10229

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MSRNNTARITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKMSRNNTAKITFRGKCKTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR
ccccccccEEEcccccccccHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccEEEEcccHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEEccccccEEEHHHHHHHHHccccccccEEEEcccHHHHHHHHHcccccEEEEEccccHHHHHHcc
ccccccccEEEccccEEEcccccccccccccccccccccccHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEcEEEEEccccccEEEEEccccccccHHHHHccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHccccEEEEEccccHHHHHccc
MSRNNTARITFMGKCktrffdrknsylpmnpglnsifsfppilewhgrkkkmsrnntakitfrgkcktrffdrknsylpmnpglnsifsfppgteegvlsyepvtqmqidyarpviilgplkdrinddlisefpeqfgscvpplgkmydRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQeqsgpsiwgkhciLDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR
msrnntaritfmgkcktrfFDRKNSYLPMNPGLNSIFSFPPILEWhgrkkkmsrnntakitfrgkcktrffDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEfpeqfgscvpPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLypvaifikpksvesiicrr
MSRNNTARITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKMSRNNTAKITFRGKCKTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR
*******RITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKM*RNNTAKITFRGKCKTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIIC**
***********MGKCKTRFFDRKNSY*********************************************************************EGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCV*******************FFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICR*
********ITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKMSRNNTAKITFRGKCKTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR
******ARITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKMSRNNTAKITFRGKCKTRFFDRKN******************TEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVES*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRNNTARITFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPILEWHGRKKKMSRNNTAKITFRGKCKTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
Q28C55927 Disks large homolog 1 OS= yes N/A 0.545 0.135 0.541 7e-35
Q5PYH5827 Discs large homolog 1-lik yes N/A 0.670 0.187 0.486 2e-34
Q12959904 Disks large homolog 1 OS= no N/A 0.545 0.139 0.529 1e-33
Q92796817 Disks large homolog 3 OS= no N/A 0.675 0.190 0.455 2e-33
Q5PYH6873 Disks large homolog 1 OS= no N/A 0.545 0.144 0.522 3e-33
Q5PYH7881 Disks large homolog 2 OS= no N/A 0.545 0.143 0.509 3e-33
Q811D0905 Disks large homolog 1 OS= no N/A 0.584 0.149 0.520 5e-33
Q62696911 Disks large homolog 1 OS= yes N/A 0.584 0.148 0.520 5e-33
P31007970 Disks large 1 tumor suppr no N/A 0.554 0.131 0.509 6e-33
Q62936849 Disks large homolog 3 OS= no N/A 0.545 0.148 0.509 9e-33
>sp|Q28C55|DLG1_XENTR Disks large homolog 1 OS=Xenopus tropicalis GN=dlg1 PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (371), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 100/155 (64%), Gaps = 29/155 (18%)

Query: 93  GTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSM 152
           G EE VLSYEPV Q +++Y+RPVIILGP KDR+NDDLISEFPE+FGSCVP   +   R  
Sbjct: 718 GQEEYVLSYEPVNQQEVNYSRPVIILGPTKDRVNDDLISEFPEKFGSCVPHTTRP-KRDY 776

Query: 153 KMEQEFGEFFTAVVQGDMPEDI-------------------YQKVKEVIQEQSGPSIWGK 193
           +++     F T+  Q  M +DI                    Q VKEV +        GK
Sbjct: 777 EIDGRDYHFVTSREQ--MEKDIQDHRFIEAGQYNSHLYGTSVQSVKEVAER-------GK 827

Query: 194 HCILDVSGNAIKRLQVASLYPVAIFIKPKSVESII 228
           HCILDVSGNAIKRLQ+A LYP+AIFIKPKSVE+II
Sbjct: 828 HCILDVSGNAIKRLQIAQLYPIAIFIKPKSVENII 862
Essential multidomain scaffolding protein required for normal development. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction and cell proliferation.
Xenopus tropicalis (taxid: 8364)
>sp|Q5PYH5|DLG1L_DANRE Discs large homolog 1-like protein OS=Danio rerio GN=dlg1l PE=2 SV=1 Back     alignment and function description
>sp|Q12959|DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens GN=DLG1 PE=1 SV=2 Back     alignment and function description
>sp|Q92796|DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens GN=DLG3 PE=1 SV=2 Back     alignment and function description
>sp|Q5PYH6|DLG1_DANRE Disks large homolog 1 OS=Danio rerio GN=dlg1 PE=2 SV=2 Back     alignment and function description
>sp|Q5PYH7|DLG2_DANRE Disks large homolog 2 OS=Danio rerio GN=dlg2 PE=2 SV=1 Back     alignment and function description
>sp|Q811D0|DLG1_MOUSE Disks large homolog 1 OS=Mus musculus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q62696|DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|P31007|DLG1_DROME Disks large 1 tumor suppressor protein OS=Drosophila melanogaster GN=dlg1 PE=1 SV=2 Back     alignment and function description
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
270001944 512 hypothetical protein TcasGA2_TC000855 [T 0.584 0.263 0.554 1e-33
189234387 729 PREDICTED: similar to discs large 1 CG17 0.584 0.185 0.554 3e-33
113931336 927 disks large homolog 1 [Xenopus (Silurana 0.545 0.135 0.541 4e-33
357630381 881 discs large 1, isoform L [Danaus plexipp 0.619 0.162 0.511 6e-33
59933280 827 discs large homolog 1-like protein [Dani 0.670 0.187 0.486 1e-32
340722459 754 PREDICTED: disks large 1 tumor suppresso 0.554 0.169 0.535 1e-32
432118144 1058 Disks large like protein 1 [Myotis david 0.545 0.119 0.535 2e-32
321464697 814 hypothetical protein DAPPUDRAFT_214226 [ 0.549 0.156 0.536 3e-32
432898248 815 PREDICTED: disks large homolog 2-like [O 0.580 0.164 0.523 3e-32
558436 926 homolog of Drosophila discs large protei 0.562 0.140 0.529 3e-32
>gi|270001944|gb|EEZ98391.1| hypothetical protein TcasGA2_TC000855 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 99/146 (67%), Gaps = 11/146 (7%)

Query: 93  GTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSM 152
           G EE VLSYEPV QM I+Y RPVIILGPLKDRINDDLISEFP++FGSCVP   +   R  
Sbjct: 303 GNEENVLSYEPVQQMAINYTRPVIILGPLKDRINDDLISEFPDKFGSCVPHTTRP-KREY 361

Query: 153 KMEQEFGEFFTAVVQ--GDMPEDIYQKVKEVIQEQSGPSIW--------GKHCILDVSGN 202
           +++     F ++  Q   D+   ++ +  +      G S+         GKHCILDVSGN
Sbjct: 362 EVDARDYHFVSSREQMEKDIQNHLFIEAGQYNDNLYGTSVASVREVADKGKHCILDVSGN 421

Query: 203 AIKRLQVASLYPVAIFIKPKSVESII 228
           AIKRLQVA L+P+AIFIKPKSVESI+
Sbjct: 422 AIKRLQVAQLFPIAIFIKPKSVESIM 447

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189234387|ref|XP_001815997.1| PREDICTED: similar to discs large 1 CG1725-PK [Tribolium castaneum] Back     alignment and taxonomy information
>gi|113931336|ref|NP_001039116.1| disks large homolog 1 [Xenopus (Silurana) tropicalis] gi|123892312|sp|Q28C55.1|DLG1_XENTR RecName: Full=Disks large homolog 1 gi|89268935|emb|CAJ82322.1| discs, large homolog 1 (Drosophila) [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|357630381|gb|EHJ78542.1| discs large 1, isoform L [Danaus plexippus] Back     alignment and taxonomy information
>gi|59933280|ref|NP_001012388.1| discs large homolog 1-like protein [Danio rerio] gi|68052302|sp|Q5PYH5.1|DLG1L_DANRE RecName: Full=Discs large homolog 1-like protein; AltName: Full=Synapse-associated protein 97B; Short=SAP-97B; Short=SAP97B gi|55977461|gb|AAV68500.1| SAP-97B [Danio rerio] Back     alignment and taxonomy information
>gi|340722459|ref|XP_003399623.1| PREDICTED: disks large 1 tumor suppressor protein-like [Bombus terrestris] gi|350416652|ref|XP_003491037.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 1 [Bombus impatiens] gi|350416654|ref|XP_003491038.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|432118144|gb|ELK38029.1| Disks large like protein 1 [Myotis davidii] Back     alignment and taxonomy information
>gi|321464697|gb|EFX75703.1| hypothetical protein DAPPUDRAFT_214226 [Daphnia pulex] Back     alignment and taxonomy information
>gi|432898248|ref|XP_004076497.1| PREDICTED: disks large homolog 2-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|558436|gb|AAA50598.1| homolog of Drosophila discs large protein, isoform 2 [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
ZFIN|ZDB-GENE-010724-8909 dlg1 "discs, large (Drosophila 0.757 0.192 0.471 1.4e-33
UNIPROTKB|F1MNQ1361 DLG2 "Uncharacterized protein" 0.575 0.368 0.527 1.6e-31
UNIPROTKB|Q12959904 DLG1 "Disks large homolog 1" [ 0.757 0.193 0.469 1.8e-31
ZFIN|ZDB-GENE-050222-3906 dlg1l "discs, large (Drosophil 0.757 0.193 0.459 1.8e-31
UNIPROTKB|F1M907767 Dlg2 "Disks large homolog 2" [ 0.727 0.219 0.475 2e-31
ZFIN|ZDB-GENE-050221-3881 dlg2 "discs, large (Drosophila 0.212 0.055 0.795 2.1e-31
UNIPROTKB|F1MNQ3800 F1MNQ3 "Uncharacterized protei 0.575 0.166 0.547 3.6e-31
UNIPROTKB|Q92796817 DLG3 "Disks large homolog 3" [ 0.748 0.211 0.443 3.8e-31
UNIPROTKB|F1RTL4480 DLG3 "Uncharacterized protein" 0.575 0.277 0.527 4.2e-31
UNIPROTKB|F1STU6236 DLG2 "Uncharacterized protein" 0.575 0.563 0.520 5.4e-31
ZFIN|ZDB-GENE-010724-8 dlg1 "discs, large (Drosophila) homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 1.4e-33, Sum P(2) = 1.4e-33
 Identities = 91/193 (47%), Positives = 119/193 (61%)

Query:    49 KKKMSRNNTAKITFRGKCKTRFFDRKN-SYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQM 107
             +K+ +R  T K   + + K    D K   ++  N   +S  SF  G E+ VLSYE VTQ 
Sbjct:   657 RKERARLKTVKFNSKSRDKADLSDDKGLKHVTSNAS-DSESSFR-GQEDYVLSYETVTQQ 714

Query:   108 QIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMYDRSMKMEQEFGEFFTAVVQ 167
             ++ Y+RPVIILGP+KDRINDDLISEFP++FGSCVP   +   R  +++     F  +  Q
Sbjct:   715 EVSYSRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRP-KRDYEVDGRDYHFVNSREQ 773

Query:   168 GDMPEDIYQ-KVKEVIQEQS---GPSIW--------GKHCILDVSGNAIKRLQVASLYPV 215
               M +DI   K  E  Q  +   G S+         GKHCILDVSGNAIKRLQ+A LYP+
Sbjct:   774 --MEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLYPI 831

Query:   216 AIFIKPKSVESII 228
             A+FIKPKSVE+I+
Sbjct:   832 AVFIKPKSVENIL 844
GO:0001935 "endothelial cell proliferation" evidence=ISS
GO:0007015 "actin filament organization" evidence=ISS
GO:0016337 "cell-cell adhesion" evidence=ISS
GO:0030866 "cortical actin cytoskeleton organization" evidence=ISS
GO:0016323 "basolateral plasma membrane" evidence=ISS
GO:0019902 "phosphatase binding" evidence=ISS
GO:0045930 "negative regulation of mitotic cell cycle" evidence=ISS
GO:0019901 "protein kinase binding" evidence=ISS
GO:0016020 "membrane" evidence=IEA
GO:0030054 "cell junction" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005789 "endoplasmic reticulum membrane" evidence=IEA
UNIPROTKB|F1MNQ1 DLG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q12959 DLG1 "Disks large homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050222-3 dlg1l "discs, large (Drosophila) homolog 1, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M907 Dlg2 "Disks large homolog 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050221-3 dlg2 "discs, large (Drosophila) homolog 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNQ3 F1MNQ3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92796 DLG3 "Disks large homolog 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTL4 DLG3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1STU6 DLG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28C55DLG1_XENTRNo assigned EC number0.54190.54540.1359yesN/A
Q62696DLG1_RATNo assigned EC number0.52050.58440.1481yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 6e-20
smart00072174 smart00072, GuKc, Guanylate kinase homologues 4e-14
PLN02772 398 PLN02772, PLN02772, guanylate kinase 2e-04
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 0.001
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information 
 Score = 83.2 bits (206), Expect = 6e-20
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 35/140 (25%)

Query: 111 YARPVIILGPL---KDRINDDLISEFPEQFGSCVP----------PLGKMY-----DRSM 152
             RP+++ GP    K  I   L+ E+PE+FG  V             GK Y     +   
Sbjct: 1   QRRPIVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPRPGEVDGKDYHFVSKEEME 60

Query: 153 KMEQ-----EFGEFFTAVVQGDMPEDIYQKVKEVIQEQSGPSIWGKHCILDVSGNAIKRL 207
                    E+ EF      G+      + ++++ +        GK CILDV    +K+L
Sbjct: 61  NDISANEFLEYAEF-----NGNYYGTSKEAIEQIAES-------GKICILDVDIQGVKQL 108

Query: 208 QVASLYPVAIFIKPKSVESI 227
           + A L P+++FIKP S++ +
Sbjct: 109 RKAELSPISVFIKPPSLKVL 128

Length = 183
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
KOG0609|consensus542 100.0
KOG0708|consensus359 100.0
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.95
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.93
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.93
PRK14737186 gmk guanylate kinase; Provisional 99.92
PLN02772 398 guanylate kinase 99.92
KOG0707|consensus231 99.84
PRK14738206 gmk guanylate kinase; Provisional 99.81
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.78
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.59
KOG3580|consensus 1027 99.59
PRK00300205 gmk guanylate kinase; Provisional 99.56
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.91
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.87
PRK08356195 hypothetical protein; Provisional 98.17
KOG3812|consensus 475 97.91
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.29
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.19
COG3709192 Uncharacterized component of phosphonate metabolis 96.43
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 91.56
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 91.46
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 90.68
PHA02530 300 pseT polynucleotide kinase; Provisional 90.33
PRK06762166 hypothetical protein; Provisional 90.16
PRK00698205 tmk thymidylate kinase; Validated 89.99
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 89.85
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 89.32
PRK00098298 GTPase RsgA; Reviewed 88.24
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 82.45
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 82.34
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 81.74
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 81.58
KOG4792|consensus293 81.44
PLN02840 421 tRNA dimethylallyltransferase 80.89
>KOG0609|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-51  Score=391.15  Aligned_cols=207  Identities=23%  Similarity=0.377  Sum_probs=182.3

Q ss_pred             EEeeeccccccCCCCCCCCCCCCCccCCCCccc--------cccccccccCCCCccceeeec------------------
Q psy10229         11 FMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPIL--------EWHGRKKKMSRNNTAKITFRG------------------   64 (231)
Q Consensus        11 ~~~~~~~~~~~~~~~~~p~~~~~gl~F~~gdil--------~Wwqa~~~~~~~~~~~~~l~~------------------   64 (231)
                      ..++|+|||.+.+|++.||. |+||+|++||||        +||||+++++. ....+||+.                  
T Consensus       215 ~~vra~FdYdP~~D~~IPCk-Eagl~F~~GDILqIv~qdD~nWWQA~~~~~~-~~~~AGLiPS~~~qerr~a~~~~~~~~  292 (542)
T KOG0609|consen  215 VFVRALFDYDPKEDDLIPCK-EAGLPFQRGDILQIVSQDDPNWWQARRVGDP-FGGLAGLIPSKELQERRVACLRREVSK  292 (542)
T ss_pred             eeehhhcCcCcccCCcccch-hcCCcccccceeeeccCCCcchhhhhcccCc-cccccccccCHHHHHHHHHHHhhhccc
Confidence            34689999999999999999 899999999999        69999999874 223455521                  


Q ss_pred             -cc--ccccccccCCCCCCCCCCCCCCCCCCCCCcceecceeeeeccCCCCceEEEECCC---hHHHHHHHHhhCCCCcc
Q psy10229         65 -KC--KTRFFDRKNSYLPMNPGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPL---KDRINDDLISEFPEQFG  138 (231)
Q Consensus        65 -~~--r~~~~~rk~~~~~~~~~l~~~~~~~~~~~~~~~~Ye~V~~~~~~~~RpVVL~GPs---k~~l~~~Ll~~~P~~F~  138 (231)
                       ..  +|..+.+|++.. ..+++.+++  +.++..++++||+|++|+++.+|+|||+||.   ...|+++|+..+|+.|+
T Consensus       293 ~~~~~~c~~l~kkkk~~-~~~y~~~~~--~~~d~~~~~tYEEV~~~~~~~rrtlVLiGa~GvGr~elk~~Li~~~p~~f~  369 (542)
T KOG0609|consen  293 EPEKTRCQRLSKKKKKK-KSKYLGKHS--AVFDQPELLTYEEVVRYPPFRRRTLVLIGAQGVGRRELKNKLIELNPDRFG  369 (542)
T ss_pred             CCcCchhcccchhhhhh-hhhhhhhcc--hhhhccccccHHHHhhhcccccceEEEECCcccchHHHHHHHHhhCccccc
Confidence             11  445555555533 223555554  5899999999999999999999999999999   88999999999999999


Q ss_pred             cccCCC----------CCcchhH--HHHHHHHhc-cCceeEEeccCCccc----hHHHHHHHhcCCCCCCCcEEEEEecH
Q psy10229        139 SCVPPL----------GKMYDRS--MKMEQEFGE-FFTAVVQGDMPEDIY----QKVKEVIQEQSGPSIWGKHCILDVSG  201 (231)
Q Consensus       139 ~~vp~T----------G~dY~FV--e~fe~~i~~-~Fd~iE~g~~~g~~Y----~sV~~v~~~~~~~~~wGk~cILDv~~  201 (231)
                      ++||||          |++||||  ++|+++|.+ +|  +|||+|.||+|    ++|+.++++       ||+||||++|
T Consensus       370 ~~VPhTtR~~r~~E~dG~eY~FVSk~~~e~dI~~~~~--lE~GEy~~nlYGTs~dsVr~v~~~-------gKicvLdv~P  440 (542)
T KOG0609|consen  370 TAVPHTTRPPRSDEVDGVEYHFVSKEEMEADIRAGKF--LEYGEYEGNLYGTSLDSVRNVIAS-------GKICVLDVEP  440 (542)
T ss_pred             cCCCCcCCCCCCCCCCCccceeeehHHHhhhhhcCCc--eecCcchhccccchHHHHHHHHHh-------CCEEEEecCH
Confidence            999999          9999999  999999999 99  99999999999    999999999       9999999999


Q ss_pred             HHHHHHHHcCCCcEEEEEcCCCHHHHhhcC
Q psy10229        202 NAIKRLQVASLYPVAIFIKPKSVESIICRR  231 (231)
Q Consensus       202 qgvk~Lr~~~~~PivIFI~ppS~e~L~~~r  231 (231)
                      |+++.||+++|.|+||||+||+++.++++|
T Consensus       441 qalk~lRt~Ef~PyVIFI~pP~~~~~r~~r  470 (542)
T KOG0609|consen  441 QALKVLRTAEFKPYVIFIAPPSLEELRALR  470 (542)
T ss_pred             HHhhhhhhhcccceEEEecCCCchhHHHHh
Confidence            999999999999999999999999998876

>KOG0708|consensus Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3tvt_A292 Structural Basis For Discs Large Interaction With P 2e-33
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 7e-33
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 9e-33
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 3e-10
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 1e-32
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 3e-10
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 8e-32
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-10
3kfv_A308 Crystal Structure Of The Sh3-Kinase Fragment Of Tig 3e-08
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 4e-07
3tsw_A391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 5e-07
3lh5_A251 Crystal Structure Of The Sh3-Guanylate Kinase Core 6e-07
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 4e-04
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure 
Iteration: 1

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (65%), Gaps = 25/152 (16%)
Query: 94  TEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPL--------- 144
           +EE VLSYE V ++ I+Y RPVIILGPLKDRINDDLISE+P++FGSCVP           
Sbjct: 82  SEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEV 141
Query: 145 -GKMY---DRSMKMEQEFGEFFTAVVQGDMPEDIY----QKVKEVIQEQSGPSIWGKHCI 196
            G+ Y       +ME++       +  G   +++Y      V+EV ++       GKHCI
Sbjct: 142 DGRDYHFVSSREQMERDIQNHL-FIEAGQYNDNLYGTSVASVREVAEK-------GKHCI 193
Query: 197 LDVSGNAIKRLQVASLYPVAIFIKPKSVESII 228
           LDVSGNAIKRLQVA LYPVA+FIKPKSV+S++
Sbjct: 194 LDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVM 225
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|3KFV|A Chain A, Crystal Structure Of The Sh3-Kinase Fragment Of Tight Junction Protein 3 (Tjp3) In Apo-Form Length = 308 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3LH5|A Chain A, Crystal Structure Of The Sh3-Guanylate Kinase Core Domain Of Zo-1 Length = 251 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
1kjw_A295 Postsynaptic density protein 95; protein-protein i 2e-29
1kjw_A295 Postsynaptic density protein 95; protein-protein i 1e-09
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 2e-29
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 2e-10
2xkx_A721 Disks large homolog 4; structural protein, scaffol 6e-27
2xkx_A721 Disks large homolog 4; structural protein, scaffol 1e-11
3kfv_A308 Tight junction protein ZO-3; structural genomics c 7e-25
3kfv_A308 Tight junction protein ZO-3; structural genomics c 6e-10
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-19
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-09
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-19
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-10
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 9e-16
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 3e-06
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 2e-14
4dey_A337 Voltage-dependent L-type calcium channel subunit; 3e-14
4dey_A337 Voltage-dependent L-type calcium channel subunit; 8e-05
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
 Score =  110 bits (277), Expect = 2e-29
 Identities = 70/163 (42%), Positives = 96/163 (58%), Gaps = 31/163 (19%)

Query: 89  SFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPLGKMY 148
           S   G E+ VLSYE VTQM++ YARP+IILGP KDR NDDL+SEFP++FGSCVP      
Sbjct: 82  SGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVP----HT 137

Query: 149 DRSMK-MEQEFGEFFTAVVQGDMPEDIYQK-------------------VKEVIQEQSGP 188
            R  +  E +  ++     +  M +DI                      V+EV ++    
Sbjct: 138 TRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQ---- 193

Query: 189 SIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR 231
              GKHCILDVS NA++RLQ A L+P+AIFI+P+S+E+++   
Sbjct: 194 ---GKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEIN 233
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
3kfv_A308 Tight junction protein ZO-3; structural genomics c 100.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 100.0
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 100.0
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.95
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.95
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.9
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.75
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.74
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.73
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.67
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.56
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.53
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.27
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.22
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.1
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.98
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.22
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.5
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.72
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.36
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.07
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.91
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 94.92
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 94.66
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.46
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 93.42
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 92.95
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 92.89
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 92.86
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 92.49
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.18
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 91.83
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 91.82
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 91.79
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 91.61
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 91.54
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 91.41
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 91.26
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 91.26
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 91.22
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 91.18
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 91.17
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 91.09
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.07
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.02
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 90.87
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 90.77
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 90.72
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 90.72
1uti_A58 GRB2-related adaptor protein 2; signaling protein 90.7
1awj_A77 ITK; transferase, regulatory intramolecular comple 90.59
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 90.56
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 90.54
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 90.45
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 90.4
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 90.39
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 90.38
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 90.36
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 90.32
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 90.3
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 90.25
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 90.23
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.12
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 90.09
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 90.06
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 90.05
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 90.05
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.02
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 90.02
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 90.02
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 90.01
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 89.96
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 89.9
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 89.85
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 89.84
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 89.79
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 89.64
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 89.58
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 89.57
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 89.55
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 89.48
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 89.4
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 89.34
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 89.3
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 89.3
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 89.28
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.2
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.14
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 88.93
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 88.92
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 88.88
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 88.87
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 88.86
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 88.84
1wxb_A68 Epidermal growth factor receptor pathway substrate 88.83
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 88.8
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 88.78
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.75
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.75
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 88.73
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 88.72
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 88.71
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 88.7
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 88.69
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 88.68
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 88.57
1i07_A60 Epidermal growth factor receptor kinase substrate 88.48
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 88.44
3u23_A65 CD2-associated protein; structural genomics, struc 88.43
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 88.34
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 88.32
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 88.29
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 88.28
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 88.27
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 88.06
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 88.05
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 88.05
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 87.96
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 87.9
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 87.9
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 87.81
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 87.79
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 87.71
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 87.69
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 87.68
2j6f_A62 CD2-associated protein; metal-binding, immune resp 87.68
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 87.65
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 87.64
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 87.63
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 87.63
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 87.59
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 87.56
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 87.55
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 87.31
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 87.28
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 87.25
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 87.22
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 87.2
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 87.17
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 87.16
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 87.15
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 87.04
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 87.04
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 87.03
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 87.01
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 87.01
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 86.81
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 86.79
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 86.77
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 86.75
2dil_A69 Proline-serine-threonine phosphatase-interacting p 86.74
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 86.72
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 86.6
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 86.56
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 86.55
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 86.53
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 86.46
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 86.39
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 86.35
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 86.26
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 86.24
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 86.17
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 86.15
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 86.12
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 86.1
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 86.07
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 86.05
2cuc_A70 SH3 domain containing ring finger 2; structural ge 85.91
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 85.83
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 85.76
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 85.71
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 85.68
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 85.65
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 85.51
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 85.5
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 85.31
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 85.19
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 85.11
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 85.07
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 85.0
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 84.88
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 84.71
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 84.66
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 84.61
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 84.58
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 84.55
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 84.43
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 84.43
2da9_A70 SH3-domain kinase binding protein 1; structural ge 84.35
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 84.23
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 84.15
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 83.86
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 83.7
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 83.65
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 83.59
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 83.46
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 83.32
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 83.1
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 82.81
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 82.8
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 82.8
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 82.67
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 82.56
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 82.26
2vli_A183 Antibiotic resistance protein; transferase, tunica 81.77
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 81.6
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 81.51
1u3o_A82 Huntingtin-associated protein-interacting protein; 81.35
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 81.31
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 81.21
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 80.49
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 80.41
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 80.29
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 80.13
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-51  Score=366.88  Aligned_cols=198  Identities=45%  Similarity=0.767  Sum_probs=155.8

Q ss_pred             EEEeeeccccccCCCCCCCCCCCCCccCCCCccc--------cccccccccCCCCccceeeecccccccccccCCCCCCC
Q psy10229         10 TFMGKCKTRFFDRKNSYLPMNPGLNSIFSFPPIL--------EWHGRKKKMSRNNTAKITFRGKCKTRFFDRKNSYLPMN   81 (231)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~p~~~~~gl~F~~gdil--------~Wwqa~~~~~~~~~~~~~l~~~~r~~~~~rk~~~~~~~   81 (231)
                      +|.++|||||-...|+++||.   ||+|++||||        +||||+++...+....+||+.... ...++.....   
T Consensus         5 s~yvRa~fdY~~~~D~~~P~~---gL~F~~gDiL~V~~~~d~~wWqA~~v~~~~~~~~~GlIPS~~-~~e~~~~~~~---   77 (292)
T 3tvt_A            5 SLYVRALFDYDPNRDDGLPSR---GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKR-RWERKMRARD---   77 (292)
T ss_dssp             CCEEEECSCBCC------------CCCBCTTCEEEEEECCSSSEEEECCCCC--------EEECHH-HHHHHHHC-----
T ss_pred             eEEEEEeccCCCCCCCCCCCC---cCCcCCCCEEEEeecCCCCeEEEEEeCCCCCccceeEEeChH-HHHHHHHHhh---
Confidence            688999999999999999997   7899999999        699999987655556789975432 1222211100   


Q ss_pred             CCCCCCCCCCCCCCcceecceeeeeccCCCCceEEEECCChHHHHHHHHhhCCCCcccccCCC----------CCcchhH
Q psy10229         82 PGLNSIFSFPPGTEEGVLSYEPVTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPL----------GKMYDRS  151 (231)
Q Consensus        82 ~~l~~~~~~~~~~~~~~~~Ye~V~~~~~~~~RpVVL~GPsk~~l~~~Ll~~~P~~F~~~vp~T----------G~dY~FV  151 (231)
                              .....++++++||+|++++++++|||||+||+|++|+++|++++|++|+++||||          |+|||||
T Consensus        78 --------~~~~~~~~~~~YE~V~~~~~~~~RpvVl~Gp~K~tl~~~Ll~~~p~~f~~sVs~TTR~pR~gE~dG~dY~Fv  149 (292)
T 3tvt_A           78 --------RSVKSEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFV  149 (292)
T ss_dssp             ----------------CCCEEEEEEEECSSCCCEEEESTTHHHHHHHHHHHCTTTEECCCCEECSCCCTTCCBTTTBEEC
T ss_pred             --------ccccccccccchheEEeccCCCCCeEEEeCCCHHHHHHHHHHhChhhccccccCCccCCcCCccCCcccccc
Confidence                    0123456789999999999999999999999999999999999999999999999          9999998


Q ss_pred             ---HHHHHHHhc-cCceeEEeccCCccc----hHHHHHHHhcCCCCCCCcEEEEEecHHHHHHHHHcCCCcEEEEEcCCC
Q psy10229        152 ---MKMEQEFGE-FFTAVVQGDMPEDIY----QKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKS  223 (231)
Q Consensus       152 ---e~fe~~i~~-~Fd~iE~g~~~g~~Y----~sV~~v~~~~~~~~~wGk~cILDv~~qgvk~Lr~~~~~PivIFI~ppS  223 (231)
                         ++|+++|++ .|  |||++++||+|    ++|++++++       |++||||||+||+++|+..+++|++|||+|||
T Consensus       150 ~s~e~fe~~i~~~~f--lE~a~~~gn~YGT~~~~V~~~~~~-------gk~viLdid~qg~~~lk~~~~~pi~IFI~PpS  220 (292)
T 3tvt_A          150 SSREQMERDIQNHLF--IEAGQYNDNLYGTSVASVREVAEK-------GKHCILDVSGNAIKRLQVAQLYPVAVFIKPKS  220 (292)
T ss_dssp             SCHHHHHHHHHTTCE--EEEEEETTEEEEEEHHHHHHHHHH-------TCEEEECCCTHHHHHHHHTTCCCEEEEECCSC
T ss_pred             CCHHHHHHHHhcCce--EEEEEEccceeEEehHHHHHHHHc-------CCcEEEeccchhhhhcccccccceEEEEECCC
Confidence               789999999 99  99999999999    899999999       99999999999999999999999999999999


Q ss_pred             HHHHhhcC
Q psy10229        224 VESIICRR  231 (231)
Q Consensus       224 ~e~L~~~r  231 (231)
                      +++|++++
T Consensus       221 ~e~L~~r~  228 (292)
T 3tvt_A          221 VDSVMEMN  228 (292)
T ss_dssp             HHHHHHTC
T ss_pred             HHHHHHHH
Confidence            99998763
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 231
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 6e-11
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 6e-07
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 2e-04
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 57.5 bits (138), Expect = 6e-11
 Identities = 30/39 (76%), Positives = 36/39 (92%)

Query: 104 VTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVP 142
           VTQM++ YARP+IILGP KDR NDDL+SEFP++FGSCVP
Sbjct: 1   VTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVP 39
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.97
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.93
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.92
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.89
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.88
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.86
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.97
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.59
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.58
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.31
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 97.54
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 94.93
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 93.9
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.81
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 93.17
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 93.11
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.97
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 92.75
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 92.16
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 92.09
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 91.96
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 91.7
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.45
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 91.22
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 91.21
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 90.86
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 90.64
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 90.32
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 90.17
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 89.76
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.46
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 88.92
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 88.52
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 88.5
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 88.45
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 88.41
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 88.32
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 88.02
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 87.94
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 87.9
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 87.9
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 87.78
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 87.47
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.95
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 86.82
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 86.33
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 86.33
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 86.3
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 85.47
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 85.42
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 85.27
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.12
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 84.82
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 83.94
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 83.85
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 82.82
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 82.64
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 82.38
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 81.9
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 81.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 81.7
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 80.53
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.97  E-value=4.2e-32  Score=228.67  Aligned_cols=119  Identities=55%  Similarity=0.978  Sum_probs=114.4

Q ss_pred             eeeccCCCCceEEEECCChHHHHHHHHhhCCCCcccccCCC----------CCcchhH---HHHHHHHhc-cCceeEEec
Q psy10229        104 VTQMQIDYARPVIILGPLKDRINDDLISEFPEQFGSCVPPL----------GKMYDRS---MKMEQEFGE-FFTAVVQGD  169 (231)
Q Consensus       104 V~~~~~~~~RpVVL~GPsk~~l~~~Ll~~~P~~F~~~vp~T----------G~dY~FV---e~fe~~i~~-~Fd~iE~g~  169 (231)
                      |+++++.++|||||+||+|++|+++|++++|+.|.+++|||          |+|||||   ++|++++++ .|  +||++
T Consensus         1 v~~~~~~~~Rpivi~Gp~K~ti~~~L~~~~p~~f~~~is~TTR~~R~~E~dG~dY~Fv~~~e~F~~~i~~~~f--iE~~~   78 (199)
T d1kjwa2           1 VTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKF--IEAGQ   78 (199)
T ss_dssp             EEEEECCSCCCEEEESTTHHHHHHHHHHHCTTTEECCCCEECSCCCTTCCBTTTBEECSCHHHHHHHHHTTCE--EEEEE
T ss_pred             CccccCCCCCCEEEECcCHHHHHHHHHHhCccceeecccccccCCCCCCCCCcccchhhhHHHHHHHHhhccc--eeeee
Confidence            78889999999999999999999999999999999999999          9999998   679999999 99  99999


Q ss_pred             cCCccc----hHHHHHHHhcCCCCCCCcEEEEEecHHHHHHHHHcCCCcEEEEEcCCCHHHHhhcC
Q psy10229        170 MPEDIY----QKVKEVIQEQSGPSIWGKHCILDVSGNAIKRLQVASLYPVAIFIKPKSVESIICRR  231 (231)
Q Consensus       170 ~~g~~Y----~sV~~v~~~~~~~~~wGk~cILDv~~qgvk~Lr~~~~~PivIFI~ppS~e~L~~~r  231 (231)
                      ++|++|    ++|++++++       |++||||++++|+++|+..++.|++|||.|||+++++++|
T Consensus        79 ~~g~~YGt~~~~i~~~~~~-------gk~~lldid~~g~~~lk~~~~~~i~IfI~pps~e~l~~l~  137 (199)
T d1kjwa2          79 YNSHLYGTSVQSVREVAEQ-------GKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEIN  137 (199)
T ss_dssp             ETTEEEEEEHHHHHHHHHT-------TCEEEECCCTTHHHHHHHTTCCCEEEEECCSSHHHHHHHC
T ss_pred             ecCCccceeeeEEEehhcC-------CCcccccccchHHhhhhhhccceeEEeeccccHHHHHhhh
Confidence            999999    899999999       9999999999999999999999999999999999998764
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure