Psyllid ID: psy1024

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MMTHHHSSSSVTTRMREEDAQEIMHHSSHHSSSVHHHSEHSKQTISHSTSSSATSVQHKMKRGTSPALSQAGLSHVASATLSQTTSSSVSTNHGPQSHSHHHQHSHHHHHQTATASPPASAISGSKSRGIGDPIPNHILLSEHKPRPSESQSSSSAQPPSSSPDCHSLPACLCYQLELEHLEREKREREIRELRERELNDRIKEDLIKNASRPFDPHWLELQRSSLDALRAHALAAALHSPLPPHGMAAGHPAFLPPEMGGLPHGLGMPGVDSVKHEALTISGDEGSMQPEEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAELKIKLFCPVFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAEREREEREKAQASMCNLLSRNPERIDTPRRRGGGGGGEEEEEEEGEEEEEEKEKKKEKKKKKKKKKKKKEEEEEEEEEKKKMMMMMKKIRRRPKEFLHRI
ccccccccccccHHHcHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcc
cccccccccccccccHHHHHHHHHHccccccccccccccccccEEEccccccccHHHHcccccccHHHHHccccEHEEEEEcccccccccccccccccccccccccccccccccccccccEEcccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcc
mmthhhssssvtTRMREEDAQEimhhsshhsssvhhhsehskqtishstsssatsvqhkmkrgtspalsqagLSHVASatlsqttsssvstnhgpqshshhhqhshhhhhqtatasppasaisgsksrgigdpipnhillsehkprpsesqssssaqppssspdchslpaclCYQLELEHLEREKREREIRELRERELNDRIKEDLiknasrpfdphwLELQRSSLDALRAHALAAAlhsplpphgmaaghpaflppemgglphglgmpgvdsvkhealtisgdegsmqpeeeeipspphhiprgpspepkiedsechrsQSAIFLRhwnrgdynsccrtdltfkpvpdsklARKREERLRKQAELKIKLFCPVflrhwnrgdynsccrtdltfkpvpdsklARKREERLRKQAEREREEREKAQASMCNLlsrnperidtprrrggggggeeeeeeegeeEEEEKEKKKEKKKKKKKKKKKKEEEEEEEEEKKKMMMMMKKIRRRPKEFLHRI
mmthhhssssvtTRMREEDAQEIMHHSSHHSSSVHHHSEHSKQTISHSTSSSATSVQHKMKRGTSPALSQAGLSHVASATLSQTTSSSVSTNHGPQSHSHHHQHSHHHHHQTATASPPASAISGSKSRGIGDPIPNHILLSEHKPRPSESQSSSSAQPPSSSPDCHSLPACLCYQLELEHLEREKREREIRElrerelndrikedliknasrpfdpHWLELQRSSLDALRAHALAAALHSPLPPHGMAAGHPAFLPPEMGGLPHGLGMPGVDSVKHEALTISGDEGSMQPEEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCcrtdltfkpvpdsklarKREERLRKqaelkiklfcpvflrhwnrGDYNSccrtdltfkpvpdsklarkrEERLRKQAerereerekaqasmcnllsrnperidtprrrggggggeeeeeeegeeeeeekekkkekkkkkkkkkkkkeeeeeeeeeKKKMMMmmkkirrrpkeflhri
MMThhhssssVTTRMREEDAQEIMhhsshhsssvhhhsehskqtishstsssatsVQHKMKRGTSPALSQAGLSHvasatlsqttsssvstNHGPqshshhhqhshhhhhqtatasppasaISGSKSRGIGDPIPNHILLSEHKprpsesqssssaqppssspDCHSLPACLCYQlelehlerekrereirelrerelNDRIKEDLIKNASRPFDPHWLELQRssldalrahalaaalhsplpphGMAAGHPAFlppemgglphglgmpgVDSVKHEALTISGDEGSMQpeeeeipspphhipRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDSklarkreerlrkqaelkIKLFCPVFLRHWNRGDYNSCCRTDLTFKPVPDSklarkreerlrkqaerereerekaqaSMCNLLSRNPERIDTPRRRggggggeeeeeeegeeeeeekekkkekkkkkkkkkkkkeeeeeeeeekkkmmmmmkkIRRRPKEFLHRI
**********************************************************************************************************************************************************************SLPACLCYQLELEH***********************************PHWLELQRSSLDALRAHALAAA*************************************************************************************AIFLRHWNRGDYNSCCRTDLTFKP*****************AELKIKLFCPVFLRHWNRGDYNSCCRTDLTFK***********************************************************************************************************************
************************************************************************************************************************************************************************************************************************************************************************************************************************************************CCRTDLTFKP****************************FLRHWNRGDYNSCCRTDLTFKPVP*******************************************************************************************************KIRRRP***LH**
******************************************************************************************************************************SRGIGDPIPNHILLSE***********************HSLPACLCYQLELEHLEREKREREIRELRERELNDRIKEDLIKNASRPFDPHWLELQRSSLDALRAHALAAALHSPLPPHGMAAGHPAFLPPEMGGLPHGLGMPGVDSVKHEALTIS*****************HHIPR***************SQSAIFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAELKIKLFCPVFLRHWNRGDYNSCCRTDLTFKPVPDSKLA***********************SMCNLLSRNPERIDTP******************************************************MMMMKKIRRRPKEFLHRI
*******************************************************************************************************************************RGIGDPIPNHILLS***********************CHSLPACLCYQLELEHLEREKREREIRELRERELNDRIKEDLIKNASRPFDPHWLELQRSSLDALRAHALAAALH*********A*HPAF*******************************************************************SAIFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAELKIKLFCPVFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLR*********************************************************************KKK**************MMMKKI**RP*E*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMTHHHSSSSVTTRMREEDAQEIMHHSSHHSSSVHHHSEHSKQTISHSTSSSATSVQHKMKRGTSPALSQAGLSHVASATLSQTTSSSVSTNHGPQSHSHHHQHSHHHHHQTATASPPASAISGSKSRGIGDPIPNHILLSEHKPRPSESQSSSSAQPPSSSPDCHSLPACLCYQxxxxxxxxxxxxxxxxxxxxxxxxxxIKEDLIKNASRPFDPHWLELQRSSLDALRAHALAAALHSPLPPHGMAAGHPAFLPPEMGGLPHGLGMPGVDSVKHEALTISGDEGSMQPEEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAELKIKLFCPVFLRHWNRGDYNSCCRTDLTFKPVPDxxxxxxxxxxxxxxxxxxxxxxxxxxxxMCNLLSRNPERIDTPRRRGGGGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKEFLHRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q62901 1559 Arginine-glutamic acid di yes N/A 0.085 0.028 0.586 4e-06
Q80TZ9 1558 Arginine-glutamic acid di yes N/A 0.085 0.028 0.586 4e-06
Q9P2R6 1566 Arginine-glutamic acid di no N/A 0.085 0.028 0.586 4e-06
Q8IDX6 3130 Reticulocyte-binding prot yes N/A 0.254 0.041 0.25 9e-06
O35126 1175 Atrophin-1 OS=Mus musculu no N/A 0.087 0.038 0.489 0.0004
P54258 1183 Atrophin-1 OS=Rattus norv no N/A 0.087 0.038 0.489 0.0004
Q5IS70 1186 Atrophin-1 OS=Pan troglod no N/A 0.087 0.037 0.489 0.0004
P54259 1190 Atrophin-1 OS=Homo sapien no N/A 0.087 0.037 0.489 0.0004
>sp|Q62901|RERE_RAT Arginine-glutamic acid dipeptide repeats protein OS=Rattus norvegicus GN=Rere PE=2 SV=2 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 2/46 (4%)

Query: 375  FLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAEREREE 420
            F +H +RG YNSC RTDL F P+  SKLA+KREE + K A+RE E+
Sbjct: 1125 FYKHLDRG-YNSCARTDLYFMPLAGSKLAKKREEAIEK-AKREAEQ 1168
Plays a role as a transcriptional repressor during development. May play a role in the control of cell survival (By similarity). Interacts with FAT1.
Rattus norvegicus (taxid: 10116)
>sp|Q80TZ9|RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus GN=Rere PE=1 SV=3 Back     alignment and function description
>sp|Q9P2R6|RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens GN=RERE PE=1 SV=2 Back     alignment and function description
>sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 Back     alignment and function description
>sp|O35126|ATN1_MOUSE Atrophin-1 OS=Mus musculus GN=Atn1 PE=1 SV=1 Back     alignment and function description
>sp|P54258|ATN1_RAT Atrophin-1 OS=Rattus norvegicus GN=Atn1 PE=2 SV=1 Back     alignment and function description
>sp|Q5IS70|ATN1_PANTR Atrophin-1 OS=Pan troglodytes GN=ATN1 PE=2 SV=1 Back     alignment and function description
>sp|P54259|ATN1_HUMAN Atrophin-1 OS=Homo sapiens GN=ATN1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
193666871 1481 PREDICTED: hypothetical protein LOC10016 0.231 0.080 0.573 4e-33
357608228 1316 hypothetical protein KGM_11067 [Danaus p 0.155 0.060 0.876 4e-33
242017148 1644 grunge, putative [Pediculus humanus corp 0.145 0.045 0.844 3e-30
28574395 1988 grunge, isoform C [Drosophila melanogast 0.225 0.058 0.529 1e-25
24660942 1985 grunge, isoform H [Drosophila melanogast 0.225 0.058 0.529 1e-25
18700713 1985 transcriptional corepressor Atro [Drosop 0.225 0.058 0.523 1e-25
45552995 1985 grunge, isoform D [Drosophila melanogast 0.225 0.058 0.529 1e-25
24660946 1966 grunge, isoform A [Drosophila melanogast 0.225 0.059 0.529 1e-25
195441551 2052 GK20351 [Drosophila willistoni] gi|19416 0.143 0.036 0.797 1e-25
442631044 2007 grunge, isoform J [Drosophila melanogast 0.225 0.057 0.523 1e-25
>gi|193666871|ref|XP_001947031.1| PREDICTED: hypothetical protein LOC100168816 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (70%), Gaps = 24/143 (16%)

Query: 225  SLDALRAHALAAALHSPLPPHGMAAGHPAFLPPEMGGLPHGLGMP-GVDSVK-HEALTIS 282
            SL+ALRAH    A+H          G+       MG +    GMP G++ +K  + ++ S
Sbjct: 963  SLEALRAHT---AIH----------GY-------MGAMELATGMPPGMEMIKPDQMMSQS 1002

Query: 283  GDEGSMQPEEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDL 342
             D+G+   EEE  PSP  H+P GPSPEPKIEDSECHRSQSAIFL+HWNRG++NSCCRTDL
Sbjct: 1003 TDDGNN--EEESSPSPNLHVPHGPSPEPKIEDSECHRSQSAIFLKHWNRGEFNSCCRTDL 1060

Query: 343  TFKPVPDSKLARKREERLRKQAE 365
            TFKPVP+SKL+RKREER R+QAE
Sbjct: 1061 TFKPVPESKLSRKREERTRRQAE 1083

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357608228|gb|EHJ65885.1| hypothetical protein KGM_11067 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242017148|ref|XP_002429054.1| grunge, putative [Pediculus humanus corporis] gi|212513909|gb|EEB16316.1| grunge, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|28574395|ref|NP_788478.1| grunge, isoform C [Drosophila melanogaster] gi|28380568|gb|AAO41268.1| grunge, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24660942|ref|NP_523973.2| grunge, isoform H [Drosophila melanogaster] gi|23093911|gb|AAF50413.2| grunge, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|18700713|gb|AAL78679.1|AF475087_1 transcriptional corepressor Atro [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552995|ref|NP_996025.1| grunge, isoform D [Drosophila melanogaster] gi|386770802|ref|NP_001246670.1| grunge, isoform E [Drosophila melanogaster] gi|45445992|gb|AAS65054.1| grunge, isoform D [Drosophila melanogaster] gi|383291813|gb|AFH04341.1| grunge, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24660946|ref|NP_659574.1| grunge, isoform A [Drosophila melanogaster] gi|23093912|gb|AAN12008.1| grunge, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195441551|ref|XP_002068571.1| GK20351 [Drosophila willistoni] gi|194164656|gb|EDW79557.1| GK20351 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|442631044|ref|NP_001261581.1| grunge, isoform J [Drosophila melanogaster] gi|440215489|gb|AGB94276.1| grunge, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
FB|FBgn00108251988 Gug "Grunge" [Drosophila melan 0.091 0.023 0.787 1.5e-14
UNIPROTKB|F1PCK7 1208 RERE "Uncharacterized protein" 0.089 0.038 0.574 4.8e-06
UNIPROTKB|B1AKN3 1298 RERE "Arginine-glutamic acid d 0.089 0.035 0.574 5.2e-06
UNIPROTKB|F1MGR3 1545 RERE "Uncharacterized protein" 0.089 0.029 0.574 6.4e-06
ZFIN|ZDB-GENE-070212-3 1216 rereb "arginine-glutamic acid 0.089 0.037 0.574 6.4e-06
MGI|MGI:2683486 1558 Rere "arginine glutamic acid d 0.089 0.029 0.574 6.5e-06
RGD|629475 1559 Rere "arginine-glutamic acid d 0.089 0.029 0.574 6.5e-06
UNIPROTKB|Q9P2R6 1566 RERE "Arginine-glutamic acid d 0.089 0.029 0.574 6.5e-06
UNIPROTKB|E1BVH0 1299 RERE "Uncharacterized protein" 0.089 0.035 0.553 2.6e-05
UNIPROTKB|E1C7L8 1162 ATN1 "Uncharacterized protein" 0.089 0.039 0.553 8.7e-05
FB|FBgn0010825 Gug "Grunge" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 1.5e-14, P = 1.5e-14
 Identities = 37/47 (78%), Positives = 41/47 (87%)

Query:   304 RGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDS 350
             RGPSPE K +D+ECHRSQSAIF+RH +RGDYNSC RTDL FKPV DS
Sbjct:  1712 RGPSPEAKPDDTECHRSQSAIFVRHIDRGDYNSCTRTDLIFKPVADS 1758
GO:0070491 "repressing transcription factor binding" evidence=IPI
GO:0009880 "embryonic pattern specification" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0003714 "transcription corepressor activity" evidence=IGI;NAS;IDA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0035282 "segmentation" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0003682 "chromatin binding" evidence=IEA
GO:0007379 "segment specification" evidence=IMP
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IGI
GO:0001654 "eye development" evidence=IMP
GO:0008586 "imaginal disc-derived wing vein morphogenesis" evidence=IMP
GO:0004407 "histone deacetylase activity" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0005705 "polytene chromosome interband" evidence=IDA
UNIPROTKB|F1PCK7 RERE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B1AKN3 RERE "Arginine-glutamic acid dipeptide (RE) repeats, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGR3 RERE "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070212-3 rereb "arginine-glutamic acid dipeptide (RE) repeats b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2683486 Rere "arginine glutamic acid dipeptide (RE) repeats" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|629475 Rere "arginine-glutamic acid dipeptide (RE) repeats" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2R6 RERE "Arginine-glutamic acid dipeptide repeats protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVH0 RERE "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7L8 ATN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-11
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-06
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 2e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-06
pfam09756189 pfam09756, DDRGK, DDRGK domain 3e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-06
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 4e-06
pfam00183 529 pfam00183, HSP90, Hsp90 protein 6e-06
pfam00183 529 pfam00183, HSP90, Hsp90 protein 7e-06
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 8e-06
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 8e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-06
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 1e-05
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 1e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 3e-05
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 3e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 3e-05
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 4e-05
pfam00183 529 pfam00183, HSP90, Hsp90 protein 6e-05
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 6e-05
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 6e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-05
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 7e-05
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 8e-05
pfam07543139 pfam07543, PGA2, Protein trafficking PGA2 8e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 1e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 1e-04
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 1e-04
pfam09756 189 pfam09756, DDRGK, DDRGK domain 2e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 2e-04
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 2e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 3e-04
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 3e-04
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 3e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-04
pfam01956168 pfam01956, DUF106, Integral membrane protein DUF10 3e-04
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
cd11486635 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporte 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 6e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 6e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-04
COG5163591 COG5163, NOP7, Protein required for biogenesis of 6e-04
cd02988 192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil 6e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 7e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-04
pfam09736141 pfam09736, Bud13, Pre-mRNA-splicing factor of RES 7e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-04
pfam04641254 pfam04641, Rtf2, Replication termination factor 2 7e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 7e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 7e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-04
pfam09756 189 pfam09756, DDRGK, DDRGK domain 8e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 8e-04
pfam09726680 pfam09726, Macoilin, Transmembrane protein 8e-04
PRK14160 211 PRK14160, PRK14160, heat shock protein GrpE; Provi 8e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.001
PHA0260880 PHA02608, 67, prohead core protein; Provisional 0.001
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
COG1293 564 COG1293, COG1293, Predicted RNA-binding protein ho 0.001
pfam04615 728 pfam04615, Utp14, Utp14 protein 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.002
PRK14160 211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.002
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.002
pfam05285 317 pfam05285, SDA1, SDA1 0.002
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 0.003
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
pfam06102168 pfam06102, DUF947, Domain of unknown function (DUF 0.003
pfam0774195 pfam07741, BRF1, Brf1-like TBP-binding domain 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.004
pfam06424131 pfam06424, PRP1_N, PRP1 splicing factor, N-termina 0.004
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.004
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.004
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information 
 Score = 67.0 bits (163), Expect = 1e-11
 Identities = 41/72 (56%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 291 EEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDS 350
           EE E P PP   PR PSPEP + ++  H SQSA F +H +RG YNSC RTDL F P+  S
Sbjct: 520 EEPESPPPP---PRSPSPEPTVVNTPSHASQSARFYKHLDRG-YNSCARTDLYFTPLASS 575

Query: 351 KLARKREERLRK 362
           KLA+KREE + K
Sbjct: 576 KLAKKREEAVEK 587

Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|219461 pfam07543, PGA2, Protein trafficking PGA2 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|216807 pfam01956, DUF106, Integral membrane protein DUF106 Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|212055 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporter SGLT1;solute binding domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) Back     alignment and domain information
>gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|203444 pfam06424, PRP1_N, PRP1 splicing factor, N-terminal Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
PF03154 982 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 100.0
KOG2133|consensus 1229 99.84
KOG2653|consensus487 99.69
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.65
PF03154 982 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 99.63
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 99.36
PRK09287459 6-phosphogluconate dehydrogenase; Validated 99.23
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.23
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.22
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 99.15
KOG2133|consensus 1229 98.75
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.88
PRK00247429 putative inner membrane protein translocase compon 95.75
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 95.55
KOG1144|consensus 1064 94.3
PTZ00266 1021 NIMA-related protein kinase; Provisional 93.99
KOG4364|consensus 811 93.6
PF06658142 DUF1168: Protein of unknown function (DUF1168); In 93.4
PF07946321 DUF1682: Protein of unknown function (DUF1682); In 92.65
KOG2573|consensus498 92.56
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 89.95
KOG2572|consensus498 89.49
KOG2270|consensus520 89.03
KOG4364|consensus 811 88.49
KOG2002|consensus1018 88.3
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 86.82
PF05835139 Synaphin: Synaphin protein; InterPro: IPR008849 Th 83.18
KOG2412|consensus 591 82.29
PF09428131 DUF2011: Fungal protein of unknown function (DUF20 81.48
KOG1924|consensus 1102 81.14
KOG2573|consensus498 81.08
KOG2357|consensus440 80.52
>PF03154 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene Back     alignment and domain information 
Probab=100.00  E-value=5.1e-33  Score=299.33  Aligned_cols=90  Identities=56%  Similarity=0.873  Sum_probs=83.5

Q ss_pred             cccCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccchhhhhhhcccCCCCcccccccccccCCChH
Q psy1024         272 DSVKHEALTISGDEGSMQPEEEEIPSPPHHIPRGPSPEPKIEDSECHRSQSAIFLRHWNRGDYNSCCRTDLTFKPVPDSK  351 (514)
Q Consensus       272 ~~~p~~~~~~~~~E~~~e~ee~esp~P~~~~~RsPSPEPkvvD~~~H~SQSArF~kHldRG~yNSC~RTDL~F~Pl~~SK  351 (514)
                      ..+++.+++||+ |+.||.||+|+|+|+   +|+|||||||||++||+||||||+|||||| ||||+|||||||||+|||
T Consensus       505 ~~~~~p~~qIKe-Ep~eE~EepEsp~pp---pRsPSPEPkvvDtp~HaSQSArF~kHldRG-~NSCaRTDL~F~Pl~gSK  579 (982)
T PF03154_consen  505 SSPPLPPIQIKE-EPPEEEEEPESPPPP---PRSPSPEPKVVDTPSHASQSARFNKHLDRG-YNSCARTDLYFVPLPGSK  579 (982)
T ss_pred             CCCCCCcccccC-CCCccccCCCCCCCC---CCCCCCCCccccchhhhhHHHHHHHHhhcc-cccccccceeeeecCccH
Confidence            446788899988 888999999999887   799999999999999999999999999999 899999999999999999


Q ss_pred             HHHHhHHH---HHHHHHh
Q psy1024         352 LARKREER---LRKQAEL  366 (514)
Q Consensus       352 LArKree~---~Rk~ae~  366 (514)
                      |||||+|+   .||+||+
T Consensus       580 LAkKRee~~ek~RReaEq  597 (982)
T PF03154_consen  580 LAKKREERVEKARREAEQ  597 (982)
T ss_pred             HhhhhHHHHHHHHhhhhc
Confidence            99999986   5788887

DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
>KOG2133|consensus Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03154 Atrophin-1: Atrophin-1 family; InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG2133|consensus Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK00247 putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>PF06658 DUF1168: Protein of unknown function (DUF1168); InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2573|consensus Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG2572|consensus Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PF05835 Synaphin: Synaphin protein; InterPro: IPR008849 This family consists of several eukaryotic synaphin 1 and 2 proteins Back     alignment and domain information
>KOG2412|consensus Back     alignment and domain information
>PF09428 DUF2011: Fungal protein of unknown function (DUF2011); InterPro: IPR018555 This is a family of fungal proteins whose function is unknown Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>KOG2573|consensus Back     alignment and domain information
>KOG2357|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-08
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-06
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 4e-06
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 2e-05
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 4e-05
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 6e-05
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 7e-05
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 3e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 3e-05
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 2e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 2e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 7e-04
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 2e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 5e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 9e-04
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 53.2 bits (127), Expect = 2e-08
 Identities = 15/96 (15%), Positives = 38/96 (39%), Gaps = 29/96 (30%)

Query: 406 REERLRKQAEREREEREKAQASMCNLLSRNPERIDTPRRRGGGGGGEEEEEEEGEEEEEE 465
           + +RL ++ E  R+ RE+             +R+            +E +      E+E 
Sbjct: 76  QADRLTQEPESIRKWREE-----------QRKRL------------QELDAASKVMEQEW 112

Query: 466 KEKKKE------KKKKKKKKKKKKEEEEEEEEEKKK 495
           +EK K+      +++ ++ +K K      ++   ++
Sbjct: 113 REKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQ 148
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 99.58
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.57
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.53
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 99.5
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 99.42
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 99.42
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 95.47
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 89.25
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 84.7
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
Probab=99.58  E-value=9.1e-17  Score=161.31  Aligned_cols=63  Identities=25%  Similarity=0.256  Sum_probs=57.0

Q ss_pred             hhhhcCCCCcccccccccccCCChhHHHHhHHhhHHhHHHHHHHHHHHHHhhhhhhcCCCceeeCCCCCCCC
Q psy1024         377 RHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAEREREEREKAQASMCNLLSRNPERIDTPRRRGGG  448 (514)
Q Consensus       377 KHldRG~pNSC~RTDL~Fydl~~SKLAgkR~ErLpanaEleQaqRDyfgAhtyelLsrpgefihT~WtRGGG  448 (514)
                      ..++.|+|.||++++|.|||       +||+++||+|  ++||||||||||||+++|++|.||||+|++.||
T Consensus       413 ~a~~~gip~P~~s~al~y~~-------~~r~~~lpan--liqaqRd~FGaH~~~r~d~~g~~~h~~w~~~~~  475 (484)
T 4gwg_A          413 TGVQAGIPMPCFTTALSFYD-------GYRHEMLPAS--LIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG  475 (484)
T ss_dssp             HHHHHTCCCHHHHHHHHHHH-------HHTCSCCTHH--HHHHHHHHHHCCCEEETTEEEEEECCCCC----
T ss_pred             HHHHcCCCHHHHHHHHHHHH-------HhccCCCHHH--HHHHHHHhhCCcceEecCCCCCccccCcCCCCC
Confidence            46678999999999999999       9999999999  999999999999999999999999999997444
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 514
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
d1yz1a1172 b.88.1.2 (A:1-172) Translationally controlled tumo 5e-04
d1txja_171 b.88.1.2 (A:) Translationally controlled tumor pro 6e-04
d1h6qa_168 b.88.1.2 (A:) Translationally controlled tumor pro 0.003
d1k4ta3230 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase 0.003
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.5 bits (94), Expect = 3e-04
 Identities = 16/103 (15%), Positives = 42/103 (40%), Gaps = 9/103 (8%)

Query: 401 KLARKREERLRKQAEREREEREKAQASMCNLLSRNPERIDTPRRRGGGGGGEEEEEEEGE 460
           ++ R + E  +  A+   E + K +  M        E +             E+ E +  
Sbjct: 207 EVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQ---------LTEKMENDRV 257

Query: 461 EEEEEKEKKKEKKKKKKKKKKKKEEEEEEEEEKKKMMMMMKKI 503
           +  +E+E+    K +++++  K+  ++E    K ++  +  K+
Sbjct: 258 QLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKM 300
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1yz1a1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Plasmodium knowlesi [TaxId: 5850]} Length = 171 Back     information, alignment and structure
>d1h6qa_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 168 Back     information, alignment and structure
>d1k4ta3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 99.56
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 99.25
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: 6-phosphogluconate dehydrogenase (6PGD)
species: Sheep (Ovis orientalis aries) [TaxId: 9940]

Probab=99.56  E-value=2.6e-16  Score=148.96  Aligned_cols=67  Identities=22%  Similarity=0.216  Sum_probs=63.0

Q ss_pred             hhhhhhhhcCCCCcccccccccccCCChhHHHHhHHhhHHhHHHHHHHHHHHHHhhhhhhcCCCceeeCCCCCCCC
Q psy1024         373 PVFLRHWNRGDYNSCCRTDLTFKPVPDSKLARKREERLRKQAEREREEREKAQASMCNLLSRNPERIDTPRRRGGG  448 (514)
Q Consensus       373 arF~KHldRG~pNSC~RTDL~Fydl~~SKLAgkR~ErLpanaEleQaqRDyfgAhtyelLsrpgefihT~WtRGGG  448 (514)
                      ..+...++.|+|.||++++|+||+       .+|.+.+|.|  ++||||||||+|+|++++++|+|+||+|+++||
T Consensus       231 ~~v~~ai~~gip~P~lssaL~y~~-------~~~~~~lp~~--lIQAqRD~FG~H~~~r~d~~G~f~H~~W~~~~~  297 (297)
T d2pgda1         231 RAISTGVQAGIPMPCFTTALSFYD-------GYRHAMLPAN--LIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG  297 (297)
T ss_dssp             HHHHHHHHHTCCCHHHHHHHHHHH-------HHHCSSCTHH--HHHHHHHHHHCCCBCCSSSTTCCBCCCCSCSCC
T ss_pred             HHHHHHHHcCCChHHHHHHHHHHH-------HhccCCchhH--HHHHHHHHhcCCCeeecCCCCCcccCCCCCCCC
Confidence            345668889999999999999999       9999999999  999999999999999999999999999999887
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure