Psyllid ID: psy10439


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MSFLVRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSASPPPPPPAPSSGGSVPGQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
ccHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccccEEEcccccccccEEEEEEEEEccccccccccEEEEEEEccEEEEEEccccEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEccccEEEEEEccEEEEEEEccccEEEEEcc
ccHHHHccHccccccccccccccccccccccccccccccccccEEEEcccccccccHcHHHHHHcccccEcccccEEEEEEcccEEEEEccccccEEEEEEEccccccEccccEEEEEEcccccHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHcccEEccccEEEEEEccccEEEcccccccEEHHEc
MSFLVRSRLTKLASkfinptynnaflnksKIICLHTTNILDAqqeikmpslsptmteGTIVKWLKkegdavapgdvlcEIQTDKAVMSFETEEEGILAKilvpenttdvkVGTLIAVMVEEGedwqnvsvsatspsatasassasppppppapssggsvpgqiinmpslsptmteGTIVKWLKkegdavvpgdvlcEIQTDKAVMSFETEEEGILAKIL
MSFLVRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQeikmpslsptMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGIlakilvpenttdvKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSASPPPPPPAPSSGGSVPGQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQtdkavmsfeteeegilakil
MSFLVRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGEDWQNvsvsatspsatasassasppppppapssggsvpgQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
****VRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQEIKM**L*PTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGEDW************************************************TEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSF************
*****************************************AQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGED*****************************SSGGSV****************GTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
MSFLVRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGEDWQN******************************SVPGQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
***************************************LDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGE**************************************QIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFLVRSRLTKLASKFINPTYNNAFLNKSKIICLHTTNILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSASPPPPPPAPSSGGSVPGQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q0WQF7 637 Dihydrolipoyllysine-resid no N/A 0.812 0.279 0.491 9e-43
P36413 635 Dihydrolipoyllysine-resid yes N/A 0.799 0.275 0.464 6e-38
Q8BMF4 642 Dihydrolipoyllysine-resid yes N/A 0.821 0.280 0.460 2e-34
P08461 632 Dihydrolipoyllysine-resid yes N/A 0.821 0.284 0.468 2e-34
P10515 647 Dihydrolipoyllysine-resid yes N/A 0.817 0.276 0.431 3e-33
P22439 501 Pyruvate dehydrogenase pr no N/A 0.506 0.221 0.524 4e-28
O66119 440 Dihydrolipoyllysine-resid yes N/A 0.410 0.204 0.644 4e-28
Q8BKZ9 501 Pyruvate dehydrogenase pr no N/A 0.442 0.193 0.561 4e-27
Q19749 507 Dihydrolipoyllysine-resid yes N/A 0.680 0.293 0.421 7e-27
O00330 501 Pyruvate dehydrogenase pr no N/A 0.484 0.211 0.504 8e-27
>sp|Q0WQF7|OPD21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=1 SV=2 Back     alignment and function desciption
 Score =  173 bits (438), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 119/187 (63%), Gaps = 9/187 (4%)

Query: 42  AQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKIL 101
           +Q  + MP+LSPTM+ G +VKW+KKEGD V  GDVLCEI+TDKA + FE++EEG LAKIL
Sbjct: 84  SQTVLAMPALSPTMSHGNVVKWMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKIL 143

Query: 102 VPENTTDVKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSASPPPPPP---------A 152
           V E + D+ V   IA+MVEE +D +NV  +          +SA     P           
Sbjct: 144 VTEGSKDIPVNEPIAIMVEEEDDIKNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQ 203

Query: 153 PSSGGSVPGQIINMPSLSPTMTEGTIVKWLKKEGDAVVPGDVLCEIQTDKAVMSFETEEE 212
           P +    P  ++ MP+LSPTM +G I KW KKEGD +  GDV+ EI+TDKA + FE+ EE
Sbjct: 204 PDASDLPPHVVLEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEE 263

Query: 213 GILAKIL 219
           G LAKIL
Sbjct: 264 GYLAKIL 270




The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 2
>sp|P36413|ODP2_DICDI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=1 SV=2 Back     alignment and function description
>sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 Back     alignment and function description
>sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 Back     alignment and function description
>sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 Back     alignment and function description
>sp|P22439|ODPX_BOVIN Pyruvate dehydrogenase protein X component OS=Bos taurus GN=PDHX PE=1 SV=3 Back     alignment and function description
>sp|O66119|ODP2_ZYMMO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdhC PE=3 SV=2 Back     alignment and function description
>sp|Q8BKZ9|ODPX_MOUSE Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=2 SV=1 Back     alignment and function description
>sp|Q19749|ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1 Back     alignment and function description
>sp|O00330|ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens GN=PDHX PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
328697856 592 PREDICTED: dihydrolipoyllysine-residue a 0.981 0.363 0.614 3e-68
322790253 618 hypothetical protein SINV_09465 [Solenop 1.0 0.354 0.498 7e-58
307183310 588 Dihydrolipoyllysine-residue acetyltransf 1.0 0.372 0.531 5e-57
332024671 585 Dihydrolipoyllysine-residue acetyltransf 0.990 0.370 0.545 2e-56
242011723 539 Lipoamide acyltransferase component of b 0.735 0.298 0.662 9e-55
340729384 597 PREDICTED: LOW QUALITY PROTEIN: dihydrol 0.963 0.353 0.523 1e-54
307206702 1490 Dihydrolipoyllysine-residue acetyltransf 0.894 0.131 0.555 1e-54
383855506 587 PREDICTED: dihydrolipoyllysine-residue a 0.876 0.327 0.567 4e-51
350417800 601 PREDICTED: dihydrolipoyllysine-residue a 0.876 0.319 0.531 1e-47
380019888 621 PREDICTED: LOW QUALITY PROTEIN: dihydrol 0.876 0.309 0.528 9e-47
>gi|328697856|ref|XP_001945646.2| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 165/218 (75%), Gaps = 3/218 (1%)

Query: 4   LVRSRLTK-LASKFINPTYNNAFLNKSKIICLHTTNILDAQ-QEIKMPSLSPTMTEGTIV 61
           L RS L   L   ++  T   +F N  KI+C+HT+++L+ + QEI MPSLSPTMTEG IV
Sbjct: 5   LFRSALKGGLHKNYLRKTLCASF-NLEKILCIHTSSLLNVKGQEINMPSLSPTMTEGNIV 63

Query: 62  KWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEE 121
           KWLKKEGD ++ GDVLCEIQTDKAVMSFETEEEG+LAKILVP++  ++KVG+LIA+MV E
Sbjct: 64  KWLKKEGDKISAGDVLCEIQTDKAVMSFETEEEGVLAKILVPDDAKEIKVGSLIALMVAE 123

Query: 122 GEDWQNVSVSATSPSATASASSASPPPPPPAPSSGGSVPGQIINMPSLSPTMTEGTIVKW 181
           GEDW++V        A+ + +S    P     ++GG+ PG  +NMPSLSPTM+EGTI+KW
Sbjct: 124 GEDWKSVETPDAKDVASIATNSQEDEPQESEQTTGGNTPGIELNMPSLSPTMSEGTIIKW 183

Query: 182 LKKEGDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL 219
            KK GD V  GDVLC+IQTDKAVMSFETEEEG LAKIL
Sbjct: 184 HKKPGDKVSAGDVLCDIQTDKAVMSFETEEEGTLAKIL 221




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322790253|gb|EFZ15252.1| hypothetical protein SINV_09465 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307183310|gb|EFN70179.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332024671|gb|EGI64864.1| Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242011723|ref|XP_002426596.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Pediculus humanus corporis] gi|212510745|gb|EEB13858.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340729384|ref|XP_003402984.1| PREDICTED: LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307206702|gb|EFN84657.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383855506|ref|XP_003703251.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417800|ref|XP_003491601.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380019888|ref|XP_003693833.1| PREDICTED: LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
UNIPROTKB|E1C6N5 632 DLAT "Uncharacterized protein" 0.383 0.132 0.535 6.6e-35
UNIPROTKB|F1SMB2 647 DLAT "Dihydrolipoyllysine-resi 0.365 0.123 0.525 1.5e-18
RGD|619859 632 Dlat "dihydrolipoamide S-acety 0.817 0.283 0.417 8.3e-34
UNIPROTKB|E2RQS9 647 DLAT "Uncharacterized protein" 0.365 0.123 0.537 3.4e-19
UNIPROTKB|P10515 647 DLAT "Dihydrolipoyllysine-resi 0.365 0.123 0.537 1.2e-18
MGI|MGI:2385311 642 Dlat "dihydrolipoamide S-acety 0.817 0.278 0.415 2.5e-33
UNIPROTKB|F1N690 647 DLAT "Dihydrolipoyllysine-resi 0.365 0.123 0.525 3.1e-18
DICTYBASE|DDB_G0277847 635 pdhC "dihydrolipoyllysine-resi 0.908 0.313 0.390 6.5e-33
ZFIN|ZDB-GENE-030131-2921 652 dlat "dihydrolipoamide S-acety 0.365 0.122 0.5 1.8e-17
UNIPROTKB|E2RM20 501 PDHX "Uncharacterized protein" 0.429 0.187 0.589 7.3e-26
UNIPROTKB|E1C6N5 DLAT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 6.6e-35, Sum P(2) = 6.6e-35
 Identities = 45/84 (53%), Positives = 61/84 (72%)

Query:    40 LDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAK 99
             L A Q++ +P+LSPTM  GTI +W KKEGD +  GD++ E++TDKA + FE+ EE  LAK
Sbjct:    67 LPAHQKVALPALSPTMQMGTIARWEKKEGDKIGEGDLIAEVETDKATVGFESLEECYLAK 126

Query:   100 ILVPENTTDVKVGTLIAVMVEEGE 123
             ILVPE T DV +G +I + VE+ E
Sbjct:   127 ILVPEGTRDVPIGAIICITVEKPE 150


GO:0004742 "dihydrolipoyllysine-residue acetyltransferase activity" evidence=IEA
GO:0006090 "pyruvate metabolic process" evidence=IEA
GO:0045254 "pyruvate dehydrogenase complex" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
UNIPROTKB|F1SMB2 DLAT "Dihydrolipoyllysine-residue acetyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQS9 DLAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P10515 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N690 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277847 pdhC "dihydrolipoyllysine-residue acetyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2921 dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM20 PDHX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4ULG1ODP2_RICFE2, ., 3, ., 1, ., 1, 20.50960.44740.2378yesN/A
O66119ODP2_ZYMMO2, ., 3, ., 1, ., 1, 20.64440.41090.2045yesN/A
Q92HK7ODP2_RICCN2, ., 3, ., 1, ., 1, 20.51920.44740.2378yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1.12LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 1e-45
TIGR01349 436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 2e-40
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 9e-40
PRK11856 411 PRK11856, PRK11856, branched-chain alpha-keto acid 3e-37
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 6e-32
COG0508 404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 2e-31
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 7e-30
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 1e-25
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 5e-25
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 9e-25
PRK05704 407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 4e-24
TIGR01349 436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 7e-24
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 1e-23
PRK11856 411 PRK11856, PRK11856, branched-chain alpha-keto acid 8e-22
PRK14875 371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 1e-21
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 6e-21
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-20
COG0508 404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 1e-18
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 5e-18
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 2e-16
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 8e-16
PRK14875 371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 3e-15
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 8e-15
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-13
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 6e-13
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 7e-13
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 9e-13
PRK05704 407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 2e-11
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 4e-11
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 1e-10
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 6e-10
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-09
PLN02226 463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 4e-08
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 6e-08
PLN02528 416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 2e-07
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 1e-05
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 1e-05
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 4e-05
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 1e-04
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 4e-04
PLN02528 416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 0.003
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 0.004
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
 Score =  156 bits (397), Expect = 1e-45
 Identities = 65/137 (47%), Positives = 82/137 (59%), Gaps = 7/137 (5%)

Query: 45  EIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPE 104
           EI MP+LSPTM EGT+ KWLKKEGD V  GDV+ EI+TDKA M  E  +EG L KILVPE
Sbjct: 4   EILMPALSPTMEEGTLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAVDEGTLGKILVPE 63

Query: 105 NTTDVKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSASPPPPPPAPSSGGSVPGQII 164
            T  VKV T IAV++EEGE     S +  +P+A A A++A+P     A +   +      
Sbjct: 64  GTEGVKVNTPIAVLLEEGES---ASDAGAAPAAAAEAAAAAPAAAAAAAAKKAAPAPAAP 120

Query: 165 NMP----SLSPTMTEGT 177
             P    +  P +  GT
Sbjct: 121 AAPAAEVAADPDIPAGT 137


Length = 464

>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.97
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 99.96
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.96
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.95
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.95
KOG0557|consensus 470 99.9
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 99.87
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 99.83
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.8
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.8
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 99.77
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.75
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.75
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 99.72
KOG0559|consensus 457 99.71
PRK0674883 hypothetical protein; Validated 99.71
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.7
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 99.68
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.66
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 99.63
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.63
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 99.62
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 99.61
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.59
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.58
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 99.57
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.55
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.5
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 99.48
KOG0558|consensus 474 99.48
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.47
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.43
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.43
PRK0705180 hypothetical protein; Validated 99.42
KOG0557|consensus 470 99.39
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.38
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.34
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.34
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.33
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.32
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.31
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 99.3
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.29
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 99.29
PRK0674883 hypothetical protein; Validated 99.28
PRK14042596 pyruvate carboxylase subunit B; Provisional 99.25
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.21
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.21
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.14
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.14
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 99.14
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 99.13
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.12
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.12
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.11
PRK14040593 oxaloacetate decarboxylase; Provisional 99.11
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 99.1
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 99.07
PRK09282592 pyruvate carboxylase subunit B; Validated 99.02
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.96
KOG0559|consensus 457 98.94
PRK129991146 pyruvate carboxylase; Reviewed 98.93
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 98.88
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.88
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 98.85
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.82
PRK14042596 pyruvate carboxylase subunit B; Provisional 98.77
KOG0558|consensus 474 98.75
PRK0705180 hypothetical protein; Validated 98.68
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.67
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 98.61
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.6
KOG0369|consensus1176 98.52
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.47
PRK14040593 oxaloacetate decarboxylase; Provisional 98.44
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.43
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 98.4
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.34
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 98.27
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.27
KOG0238|consensus670 98.26
PRK10476346 multidrug resistance protein MdtN; Provisional 98.25
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.25
PRK09783409 copper/silver efflux system membrane fusion protei 98.24
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 98.21
PRK129991146 pyruvate carboxylase; Reviewed 98.2
PRK09282592 pyruvate carboxylase subunit B; Validated 98.19
PRK00624114 glycine cleavage system protein H; Provisional 98.18
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 98.15
PRK00624114 glycine cleavage system protein H; Provisional 98.14
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 98.13
PRK13380144 glycine cleavage system protein H; Provisional 98.13
PRK13380144 glycine cleavage system protein H; Provisional 98.1
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 98.06
KOG0368|consensus 2196 98.0
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.96
PRK01202127 glycine cleavage system protein H; Provisional 97.92
PRK15030397 multidrug efflux system transporter AcrA; Provisio 97.91
PRK15136390 multidrug efflux system protein EmrA; Provisional 97.9
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 97.9
PRK01202127 glycine cleavage system protein H; Provisional 97.89
PRK09859385 multidrug efflux system protein MdtE; Provisional 97.82
PRK03598331 putative efflux pump membrane fusion protein; Prov 97.8
KOG0369|consensus1176 97.74
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.74
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.73
PRK1278484 hypothetical protein; Provisional 97.67
PRK11556415 multidrug efflux system subunit MdtA; Provisional 97.66
PRK11578370 macrolide transporter subunit MacA; Provisional 97.64
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.6
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 97.54
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 97.47
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 97.44
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 97.37
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 97.34
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 97.27
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 97.22
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 97.09
KOG0238|consensus670 97.08
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 97.07
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 96.95
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 96.94
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 96.88
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 96.82
PRK1278484 hypothetical protein; Provisional 96.69
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 96.54
COG3608331 Predicted deacylase [General function prediction o 96.39
PF05896257 NQRA: Na(+)-translocating NADH-quinone reductase s 96.25
PF05896 257 NQRA: Na(+)-translocating NADH-quinone reductase s 96.23
PRK09783 409 copper/silver efflux system membrane fusion protei 96.21
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 96.14
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 96.1
KOG0368|consensus 2196 96.07
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 95.88
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 95.82
PF13437105 HlyD_3: HlyD family secretion protein 95.6
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 95.55
PF09891150 DUF2118: Uncharacterized protein conserved in arch 95.43
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 94.97
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 94.79
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 94.76
PF00529 305 HlyD: HlyD family secretion protein the correspond 94.75
PF00529 305 HlyD: HlyD family secretion protein the correspond 94.68
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 94.54
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 94.43
PRK10476 346 multidrug resistance protein MdtN; Provisional 94.21
KOG3373|consensus172 94.2
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 94.19
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 94.16
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 94.1
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 93.91
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 93.69
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 93.63
PF09891150 DUF2118: Uncharacterized protein conserved in arch 93.37
COG3608331 Predicted deacylase [General function prediction o 93.36
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 93.31
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 93.12
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 93.12
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 93.12
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 92.98
KOG3373|consensus172 92.92
PRK09859 385 multidrug efflux system protein MdtE; Provisional 92.83
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.82
PRK05035 695 electron transport complex protein RnfC; Provision 92.8
PRK11578 370 macrolide transporter subunit MacA; Provisional 92.74
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 92.7
PRK09439169 PTS system glucose-specific transporter subunit; P 92.7
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 92.67
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 92.65
PRK03598 331 putative efflux pump membrane fusion protein; Prov 92.63
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 92.58
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 92.56
PRK10559 310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 92.52
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.51
PRK15136 390 multidrug efflux system protein EmrA; Provisional 92.45
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.3
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 92.19
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 92.15
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.15
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 92.02
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 91.96
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 91.87
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 91.83
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 91.38
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 90.97
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 90.8
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 90.73
COG4072161 Uncharacterized protein conserved in archaea [Func 90.66
PRK05035 695 electron transport complex protein RnfC; Provision 90.27
PF13437105 HlyD_3: HlyD family secretion protein 89.93
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogen 89.72
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 89.68
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 89.5
TIGR00164189 PS_decarb_rel phosphatidylserine decarboxylase pre 89.07
TIGR00164189 PS_decarb_rel phosphatidylserine decarboxylase pre 88.16
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 88.05
PF0274988 QRPTase_N: Quinolinate phosphoribosyl transferase, 87.89
COG2190156 NagE Phosphotransferase system IIA components [Car 87.65
PRK05305206 phosphatidylserine decarboxylase; Provisional 87.51
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 87.39
COG4072161 Uncharacterized protein conserved in archaea [Func 87.13
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 87.09
COG1566 352 EmrA Multidrug resistance efflux pump [Defense mec 86.66
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 86.58
PF06898385 YqfD: Putative stage IV sporulation protein YqfD; 86.57
PRK10255648 PTS system N-acetyl glucosamine specific transport 86.54
PRK05305206 phosphatidylserine decarboxylase; Provisional 86.31
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 85.79
PF0274988 QRPTase_N: Quinolinate phosphoribosyl transferase, 84.09
PRK09439169 PTS system glucose-specific transporter subunit; P 83.14
PF02666202 PS_Dcarbxylase: Phosphatidylserine decarboxylase; 82.75
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 82.31
PRK14844 2836 bifunctional DNA-directed RNA polymerase subunit b 82.3
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 81.96
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 81.14
PRK09824627 PTS system beta-glucoside-specific transporter sub 80.34
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
Probab=99.97  E-value=6.4e-30  Score=240.75  Aligned_cols=177  Identities=32%  Similarity=0.518  Sum_probs=136.3

Q ss_pred             ceeEEecCCCCCCCceEEEEEEEeCCCCeEcCCCeEEEEeccCceeeEecCCCeEEEEEEecCCCeeeecCcEEEEEeec
Q psy10439         42 AQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVMVEE  121 (219)
Q Consensus        42 ~~~~i~~P~~~~~~~~g~i~~w~v~~Gd~V~~gd~l~~iet~K~~~~i~ap~~G~v~~i~v~~Gd~~V~~G~~l~~i~~~  121 (219)
                      |.+.|+||++|.+|.+|+|.+|+|++||.|+.||.||++|+||+.+++.|+.+|+|.++++++|+. |.+|+.|+.+...
T Consensus         1 M~~~i~~P~lg~~~~eg~i~~w~v~~Gd~V~~g~~l~~vEtdKa~~ev~a~~~G~v~~i~v~~Gd~-v~vG~~ia~i~~~   79 (590)
T TIGR02927         1 MAFSVEMPALGESVTEGTITQWLKAEGDTVELDEPLLEVSTDKVDTEIPSPAAGVILEIKAEEDDT-VDIGGEIAIIGEA   79 (590)
T ss_pred             CCeeEECCCCCCCccEEEEEEEEECCCCEEeCCCeEEEEEecceEEEecCCCCEEEEEEeecCCCE-EeeeeeEEEEeec
Confidence            456899999999999999999999999999999999999999999999999999999999999999 9999999998754


Q ss_pred             Ccccccccc--ccCCC-CccccC-----CCCCCCCC----CCCC---CCCCC-CCceeeccCCCCCCcccceeeeEeecC
Q psy10439        122 GEDWQNVSV--SATSP-SATASA-----SSASPPPP----PPAP---SSGGS-VPGQIINMPSLSPTMTEGTIVKWLKKE  185 (219)
Q Consensus       122 ~~~~~~~~~--~~~~~-a~~a~a-----~a~a~~~a----~~~a---a~~~~-~~~~~i~~P~lg~~~~~~~i~~~~v~~  185 (219)
                      ++.......  ..+.. +..++.     ......+.    ..+.   ++... .....+.||++|.++.+|+|.+|++++
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~P~lg~~~~eg~i~~w~v~~  159 (590)
T TIGR02927        80 GEASAEAGAEDSAAAAEPEEAPAEEAPKEEPKAAPAESVEQAPAESSAPSQGGGAATDIEMPELGESVTEGTITQWLKAV  159 (590)
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccCCCceEEEcCCCCCCcceEEEEEEEeCC
Confidence            332110100  00000 000000     00000000    0000   01101 223689999999999999999999999


Q ss_pred             CCeecCCCeEEEEeecceeeeeeCCCCeEEEEcC
Q psy10439        186 GDAVVPGDVLCEIQTDKAVMSFETEEEGILAKIL  219 (219)
Q Consensus       186 Gd~V~~g~~l~~ve~~K~~~~i~a~~~G~v~~i~  219 (219)
                      ||.|++||.||+||+||+++||+||++|+|.+|+
T Consensus       160 Gd~V~~g~~l~~vEtdKa~~ev~s~~~G~v~~i~  193 (590)
T TIGR02927       160 GDKIEVDEPILEVSTDKVDTEIPSPVAGTILEIL  193 (590)
T ss_pred             CCEecCCCEeEEEEecceeeEEcCCCCeEEEEEe
Confidence            9999999999999999999999999999999974



This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817).

>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG3373|consensus Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>KOG3373|consensus Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein Back     alignment and domain information
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>PF02666 PS_Dcarbxylase: Phosphatidylserine decarboxylase; InterPro: IPR003817 Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 4e-26
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 1e-16
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 8e-26
1zy8_L 229 The Crystal Structure Of Dihydrolipoamide Dehydroge 2e-16
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 4e-19
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 2e-12
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 4e-19
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 2e-12
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 2e-18
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 2e-12
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 3e-18
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 1e-11
3duf_I 428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 4e-10
3duf_I 428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 3e-06
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 8e-10
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 4e-06
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 5e-07
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 3e-06
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 6e-07
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 3e-05
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 3e-05
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 3e-04
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 5e-05
>pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure

Iteration: 1

Score = 114 bits (285), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 51/83 (61%), Positives = 71/83 (85%) Query: 45 EIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPE 104 +I MPSLSPTM EG IVKWLKKEG+AV+ GD LCEI+TDKAV++ + ++GILAKI+V E Sbjct: 9 KILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEE 68 Query: 105 NTTDVKVGTLIAVMVEEGEDWQN 127 + ++++G+LI ++VEEGEDW++ Sbjct: 69 GSKNIRLGSLIGLIVEEGEDWKH 91
>pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure
>pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 Back     alignment and structure
>pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 Back     alignment and structure
>pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 Back     alignment and structure
>pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 Back     alignment and structure
>pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 3e-48
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 2e-31
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 8e-48
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 1e-32
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 1e-47
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 4e-32
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 2e-46
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitoch 1e-27
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 7e-41
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 1e-27
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 7e-26
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 9e-13
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 1e-19
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 2e-12
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 8e-19
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 3e-12
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 1e-18
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 7e-12
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 1e-17
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 5e-12
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 3e-08
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 7e-06
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 6e-08
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 6e-05
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 1e-04
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 3e-04
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 4e-04
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 9e-04
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
 Score =  152 bits (387), Expect = 3e-48
 Identities = 46/101 (45%), Positives = 64/101 (63%)

Query: 44  QEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVP 103
           Q++ +PSLSPTM  GTI +W KKEGD +  GD++ E++TDKA + FE+ EE  +AKILV 
Sbjct: 8   QKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVA 67

Query: 104 ENTTDVKVGTLIAVMVEEGEDWQNVSVSATSPSATASASSA 144
           E T DV +G +I + V + ED +         SA +  SS 
Sbjct: 68  EGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG 108


>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.86
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.85
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.83
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.83
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.8
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.77
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.75
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.74
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.73
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.73
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.71
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.69
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.67
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.58
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.5
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.48
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.45
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.44
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.44
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.42
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.42
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.41
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.4
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.39
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.37
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.35
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.35
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.33
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.26
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitoch 99.25
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 99.25
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.23
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.21
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.2
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.18
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.17
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.15
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.14
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.14
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 99.02
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 98.94
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.93
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.9
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.9
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 98.88
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 98.84
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 98.8
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 98.76
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 98.74
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 98.71
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 98.7
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 98.67
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 98.66
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.64
1hpc_A131 H protein of the glycine cleavage system; transit 98.61
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 98.58
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.58
1hpc_A131 H protein of the glycine cleavage system; transit 98.58
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.56
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.55
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 98.55
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.5
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 98.42
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 98.23
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.21
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 98.21
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 98.21
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 98.19
3klr_A125 Glycine cleavage system H protein; antiparallel be 98.15
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.14
3klr_A125 Glycine cleavage system H protein; antiparallel be 98.09
3mxu_A143 Glycine cleavage system H protein; seattle structu 98.04
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.99
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.97
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 97.94
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 97.93
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.92
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.73
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.71
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 97.6
2xha_A193 NUSG, transcription antitermination protein NUSG; 97.08
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 97.02
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 96.99
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 96.83
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 96.74
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 96.31
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 96.21
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 96.05
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 95.77
2qj8_A332 MLR6093 protein; structural genomics, joint center 95.65
2gpr_A154 Glucose-permease IIA component; phosphotransferase 95.34
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 95.09
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 94.96
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 94.75
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 94.73
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 94.22
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 94.18
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 93.97
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 91.91
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 91.57
2xha_A193 NUSG, transcription antitermination protein NUSG; 91.57
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 91.47
3our_B183 EIIA, phosphotransferase system IIA component; exh 90.89
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 89.89
2qj8_A332 MLR6093 protein; structural genomics, joint center 89.43
3lu0_D 1407 DNA-directed RNA polymerase subunit beta'; E. coli 85.1
2gpr_A154 Glucose-permease IIA component; phosphotransferase 83.6
3our_B183 EIIA, phosphotransferase system IIA component; exh 81.0
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
Probab=99.86  E-value=2.2e-21  Score=148.44  Aligned_cols=96  Identities=44%  Similarity=0.689  Sum_probs=82.2

Q ss_pred             ceeeeeeccCCcceeEEecCCCCCCCceEEEEEEEeCCCCeEcCCCeEEEEeccCceeeEecCCCeEEEEEEecCCC-ee
Q psy10439         30 KIICLHTTNILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENT-TD  108 (219)
Q Consensus        30 ~~~~~~~~~~~~~~~~i~~P~~~~~~~~g~i~~w~v~~Gd~V~~gd~l~~iet~K~~~~i~ap~~G~v~~i~v~~Gd-~~  108 (219)
                      ..|.|......+|.++|+||++|+++.+|+|.+|+|++||.|++||+|++||+||+.++|+||.+|+|.++++++|+ . 
T Consensus        14 ~~~~~~~~~~~p~~~~i~~P~lG~~~~~G~V~~~~V~~Gd~V~~Gd~L~~iEa~K~~~~I~Ap~~G~V~~i~v~~Gd~~-   92 (128)
T 1y8o_B           14 LENLYFQGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRD-   92 (128)
T ss_dssp             ---------CCCSEEEEECCCSSTTCSEEEEEEECSCTTCEECTTCEEEEEECSSCEEEEECCSCEEEEEESSCTTCCS-
T ss_pred             hccccCccccCCcceeEEcCCCCCCcccEEEEEEecCCCCEecCCCEEEEEEcCcceeEEeCCCCeEEEEEEeCCCCee-
Confidence            34666777778999999999999999999999999999999999999999999999999999999999999999998 8 


Q ss_pred             eecCcEEEEEeecCcccc
Q psy10439        109 VKVGTLIAVMVEEGEDWQ  126 (219)
Q Consensus       109 V~~G~~l~~i~~~~~~~~  126 (219)
                      |..|++|+.|.+.+++..
T Consensus        93 V~~G~~L~~i~~~~~~~~  110 (128)
T 1y8o_B           93 VPLGTPLCIIVEKEADIS  110 (128)
T ss_dssp             EETTCEEEEEESSGGGGG
T ss_pred             ecCCCEEEEEecCccchh
Confidence            999999999987654433



>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 219
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 2e-27
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 2e-16
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 4e-24
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 1e-16
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 6e-24
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 2e-15
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 2e-23
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 1e-14
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-23
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 3e-15
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 3e-19
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-11
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-18
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 3e-10
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-15
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-10
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 3e-11
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 2e-07
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of dihydrolipoamide acetyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 98.4 bits (245), Expect = 2e-27
 Identities = 43/80 (53%), Positives = 61/80 (76%)

Query: 45  EIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPE 104
           ++ +P+LSPTMT GT+ +W KK G+ ++ GD+L EI+TDKA + FE +EEG LAKILVPE
Sbjct: 7   QVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPE 66

Query: 105 NTTDVKVGTLIAVMVEEGED 124
            T DV +GT + ++VE+  D
Sbjct: 67  GTRDVPLGTPLCIIVEKEAD 86


>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.92
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.89
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.88
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.87
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.86
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.84
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.83
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.83
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.67
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.66
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.64
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.64
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.6
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.57
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.52
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.5
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.47
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.46
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.33
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.21
d1onla_127 Protein H of glycine cleavage system {Thermus ther 97.6
d1onla_127 Protein H of glycine cleavage system {Thermus ther 97.54
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 97.51
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 97.48
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 97.11
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 94.95
d1e2wa264 Cytochrome f, small domain {Chlamydomonas reinhard 92.98
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 92.53
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 92.18
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 91.74
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 90.87
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 90.23
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 89.66
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [ 89.03
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 88.91
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 88.73
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 88.52
d1tu2b266 Cytochrome f, small domain {Anabaena sp., strain P 88.41
d1qpoa2115 Quinolinic acid phosphoribosyltransferase (Nicotin 88.1
d2tpta3105 Thymidine phosphorylase {Escherichia coli [TaxId: 86.13
d2tpta3105 Thymidine phosphorylase {Escherichia coli [TaxId: 85.49
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 85.19
d1qapa2122 Quinolinic acid phosphoribosyltransferase (Nicotin 84.76
d1qpoa2115 Quinolinic acid phosphoribosyltransferase (Nicotin 84.09
d1o4ua2103 Quinolinic acid phosphoribosyltransferase (Nicotin 82.8
d1qapa2122 Quinolinic acid phosphoribosyltransferase (Nicotin 81.27
d1o4ua2103 Quinolinic acid phosphoribosyltransferase (Nicotin 80.39
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of dihydrolipoamide acetyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=5.2e-25  Score=160.46  Aligned_cols=87  Identities=49%  Similarity=0.812  Sum_probs=80.6

Q ss_pred             CCcceeEEecCCCCCCCceEEEEEEEeCCCCeEcCCCeEEEEeccCceeeEecCCCeEEEEEEecCCCeeeecCcEEEEE
Q psy10439         39 ILDAQQEIKMPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDVKVGTLIAVM  118 (219)
Q Consensus        39 ~~~~~~~i~~P~~~~~~~~g~i~~w~v~~Gd~V~~gd~l~~iet~K~~~~i~ap~~G~v~~i~v~~Gd~~V~~G~~l~~i  118 (219)
                      +++++++|+||+||++|++|+|++|+|++||.|++||+||+|||||++++|+||.+|+|.++++++|+..|++|++|+.|
T Consensus         1 ~~p~~iei~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vETdK~~~ei~a~~~G~l~~i~v~eGd~~v~vG~~ia~i   80 (102)
T d1y8ob1           1 SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCII   80 (102)
T ss_dssp             CCCSEEEEECCCSSTTCSEEEEEEECSCTTCEECTTCEEEEEECSSCEEEEECCSCEEEEEESSCTTCCSEETTCEEEEE
T ss_pred             CCCCCEEEECCCCCCCccEEEEEEEEeCCCCEEecCccEEEEEcCcEEEEEecCCcEEEEEEEEccCCEEEcCCCEEEEE
Confidence            46789999999999999999999999999999999999999999999999999999999999999997339999999999


Q ss_pred             eecCccc
Q psy10439        119 VEEGEDW  125 (219)
Q Consensus       119 ~~~~~~~  125 (219)
                      ...+++.
T Consensus        81 ~~~~~~~   87 (102)
T d1y8ob1          81 VEKEADI   87 (102)
T ss_dssp             ESSGGGG
T ss_pred             ecCCccc
Confidence            7665543



>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Anabaena sp., strain PCC 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure