Psyllid ID: psy1043

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------
MVTLKQGWAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVMEGRERSRGQPTTNEGNERSREQPRTSEGNERSREQPRTNKENGRSRDRQADTESETQPNKVPKALSKLFAKRLPEQKTPKKGLEGTTKYKLSDMFRKKLYWGKSHEGKQ
ccccccccEEEccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccHHHHHHHHccccccccEEEEEcccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccEEEccccEEccccccccccccccccccccccEEEEEccEEEEEEEEccccEEEEEEEEEccEEEEEEEccEEEEEcccccHHHHHHHcccccHHHHHHcccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccEEEEEccccHHHHHHccccccccccEEEEEEcccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEcccHHHHHHHHccccccccEEEEEccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHcccccccccccHHHHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccEEEccEEEcccccEEEcccccccccccccccEEEEcccEEEEEEEccccccccEEEEEEEEEccEEEEEEEEccEEEEEccccccccEEEccccccccccccccccccccEEEEEcccccccccccEEEcccccccHHHHHHHccccccccEEEEEEccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccc
ccEEccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHccccccEEEEccEHHHHHHHHHHHHcccccEEEEccccccccHcHHHHHHHHHcccccccEEEEccccccHHcccccccccccccEEcccHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccccHHHHHHcHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHcEccHHHHHHHcccccEcccccEEEEcHccccEEEEEEcccEEEcccccccHHHHHHHHHcccccccccccHHHHHHHccHHHcccccccccccccccEEEEEcccccccccHHHHHHccccHHHHHHHcccccccccEEEEEEEccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccEEcccEEEEEccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccHHHcccccEEEEcccHHHHHHHHHHccccccEEEEEEcccccccHcHHHHHHHHHccccccccEEEcccccHHHcccccccccccccEEcccHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHcccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccccccccEEcccccEccHHHHHHcHHHcccccEEEEEcEEEEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEEEEcccccccHHHEccccccHHHcccccccccccccccccccccccccccEEcccccccccHHHHHcccccccccEEEEEccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccEccccEEcccEcEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccc
mvtlkqgwavklgcwgpkkgatgrqmsgvaeTIPSLAASAVSNVAWFAPLLAATVAFFQygvkdsapesmnkaeplypeydfivVGAGSAGAVVANRLSEIENWKILLLEaggdetdisdvPVLAAYLQLSgldwsyktepsstsclamehnrcnwprgkvvggsSVLNYMLYVRGnrndynhweslgnpgwgaAEALYYFKKsednrnqylaetpyhnsggyltvqeapwhtpLAEAFVRggeelgyenrdingeyqTGFMVAqgtvrngarcstskaflqpvktrpnlhisLHSHVTKvlidpknrmaIGVEFVKNHQRHVIRARKEVIlsggavnspqilmlsgigpkdhltdmgIKTIQDLKvgynlqdhvglggftfLINQPISLVQDRLESVQSVLNYAmmgngpltvmggdrLESVQSVLNYAmmgngpltvmgGVEGLAFVNtkyasdggnqirkahglredfydevygpinnkdvwsaipmllrprsrgriklrsrnpldypriqpeyfsdhHDMLTLIEGVKIILELSKTRSFRQyesrfhnipfpncthipmytDAYYECMIRHYSVtiyhpvgtckmgpetdseavvdprlrvhgignlrvidasimptivsgntnapvimigekgsdMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISqyrpdvedlehlipdvpleemypeydfVVVGGGSAGAVVARRLSEQKNWKVLLLEaggeesplsdipctypalqtspldwqyktepndraclglngrrsnwprgkviggSSVLNAMLYVRgnrrdydaweaagnegwsyrdtlpyfiksesvnisslvdspyhgtqgplsveefryyspVTEAFVESAGElgyevgdingerqtgftrahgtlknglrcstakaylrpiiarpnlhvslHSHAyrvhfepgpdgqmratgvvvkkgrkdpvlVRARREVILSagaigspqvylipnehthyqvdltdgpewpdiQLFFAsaadnddgglfnkrnnglkddyyagvfepilyrdsitlaplllrprsrgriklrtadpldhpmirpnylydekDLKTLVEGAKIGYAITRTKAMKrfnpvlhnvtipgcehttplsdayWECQVRHYTMtiyhpvgtckmgpdsdpgavvdprlrvrGVAGLRVidasimptivsgntnaptIMIAEKACDLIKEdwgvmegrersrgqpttnegnersreqprtsegnersreqprtnkengrsrdrqadtesetqpnkvpKALSKLFAkrlpeqktpkkglegttkykLSDMfrkklywgkshegkq
mvtlkqgwavklgcwgpkkgaTGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAflqpvktrpnlhiSLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGpinnkdvwsaipmllrprsrgriklrsrnpldypriQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESrfhnipfpncthIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLrvidasimptivsgntnaPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLglngrrsnwprgkviggssvLNAMLYVRGNRRDYDAWEaagnegwsyrDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTgftrahgtlknglrCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGvvvkkgrkdpvlvRARREVilsagaigspqvylIPNEHTHYQVDLTDGPEWPDIQLFFAsaadnddgglfnkrnnglkddYYAGVFEPILYrdsitlaplllrprsrgriklrtadpldhpmirpnYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGlrvidasimptivsgntnaPTIMIAEKACDLIKEDWGVmegrersrgqpttnegnersreqprtsegnersreqprtnkengrsrdrqadtesetqpnkvpkalsklfakrlpeqktpkkglegttkyklsdmfrkklywgkshegkq
MVTLKQGWAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIvvgagsagavvaNRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFvvvgggsagavvaRRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPrlrvrgvaglrvIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVMEGRERSRGQPTTNEGNERSREQPRTSEGNERSREQPRTNKENGRSRDRQADTESETQPNKVPKALSKLFAKRLPEQKTPKKGLEGTTKYKLSDMFRKKLYWGKSHEGKQ
****KQGWAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKD*********EPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVM********************************************************************************************DMFRKKLYW********
*******WAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVK***********PLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVED**********EEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWG***************************************************************PKALSKLFAKRLPE*K***KGLEGTTKYKLSDMFRKKLY*********
MVTLKQGWAVKLGCWGPKK********GVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVME**********************************************************KVPKALSKLFAKRLPEQKTPKKGLEGTTKYKLSDMFRKKLYW********
MVTLKQGWAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVMEG*ERSRGQPT**********************************************PNKVPKALSKLFAKRLPEQKTPKKGLEGTTKYKLSDMFRKKLYWGK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTLKQGWAVKLGCWGPKKGATGRQMSGVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGFILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWKVLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGSSVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLVDSPYHGTQGPLSVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPIIARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSPQVYLIPNEHTHYQVDLTDGPEWPDIQLFFASAADNDDGGLFNKRNNGLKDDYYAGVFEPILYRDSITLAPLLLRPRSRGRIKLRTADPLDHPMIRPNYLYDEKDLKTLVEGAKIGYAITRTKAMKRFNPVLHNVTIPGCEHTTPLSDAYWECQVRHYTMTIYHPVGTCKMGPDSDPGAVVDPRLRVRGVAGLRVIDASIMPTIVSGNTNAPTIMIAEKACDLIKEDWGVMEGRERSRGQPTTNEGNERSREQPRTSEGNERSREQPRTNKENGRSRDRQADTESETQPNKVPKALSKLFAKRLPEQKTPKKGLEGTTKYKLSDMFRKKLYWGKSHEGKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1306 2.2.26 [Sep-21-2011]
P18173625 Glucose dehydrogenase [ac no N/A 0.412 0.862 0.425 1e-124
P18172625 Glucose dehydrogenase [ac no N/A 0.411 0.860 0.421 1e-124
Q00593558 Alcohol dehydrogenase [ac N/A N/A 0.396 0.928 0.372 3e-86
Q9WWW2552 Alcohol dehydrogenase [ac yes N/A 0.386 0.914 0.373 1e-85
Q6UPE0599 Choline dehydrogenase, mi yes N/A 0.399 0.871 0.369 6e-84
Q8BJ64596 Choline dehydrogenase, mi yes N/A 0.399 0.875 0.364 4e-82
Q8NE62594 Choline dehydrogenase, mi yes N/A 0.399 0.878 0.368 4e-80
P64264528 Uncharacterized GMC-type yes N/A 0.392 0.969 0.350 2e-77
P64263528 Uncharacterized GMC-type yes N/A 0.392 0.969 0.350 2e-77
Q985M5550 Choline dehydrogenase OS= no N/A 0.381 0.905 0.347 3e-76
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function desciption
 Score =  447 bits (1149), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 250/587 (42%), Positives = 343/587 (58%), Gaps = 48/587 (8%)

Query: 72  KAEPLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLS 131
           ++EP Y EYDFIV+G GSAG+VVA+RLSE+  WK+LL+EAGGDE   + +P +      S
Sbjct: 58  RSEPDY-EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGS 116

Query: 132 GLDWSYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPG 191
            +D+ Y TEP   +CL+    RC WPRGKV+GG+SVLN M+YVRGNR DY+ W + GNPG
Sbjct: 117 DIDYRYNTEPEPMACLSSMEQRCYWPRGKVLGGTSVLNGMMYVRGNREDYDDWAADGNPG 176

Query: 192 WGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENR 251
           W   + L +FKKSEDN +     T YH  GG L V + P++ PL+ A ++ GEELG+   
Sbjct: 177 WAYNDVLPFFKKSEDNLDLDEVGTEYHAKGGLLPVGKFPYNPPLSYAILKAGEELGFSVH 236

Query: 252 DINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAI 311
           D+NG+  TGFM+AQ T RNG R S+++AFL+P + R NLHI L++  TK+LI P  +  +
Sbjct: 237 DLNGQNSTGFMIAQMTARNGIRYSSARAFLRPARMRNNLHILLNTTATKILIHPHTKNVL 296

Query: 312 GVEFVKNH-QRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLK-VGY 369
           GVE          I  +KEV+LS GAVNSP IL+LSG+GPKD L  + ++T+ +L  VG 
Sbjct: 297 GVEVSDQFGSTRKILVKKEVVLSAGAVNSPHILLLSGVGPKDELQQVNVRTVHNLPGVGK 356

Query: 370 NLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNY 429
           NL +HV     T+  N  I       ++  + LN+A                   + + Y
Sbjct: 357 NLHNHV-----TYFTNFFID------DADTAPLNWA-------------------TAMEY 386

Query: 430 AMMGNGPLTVMGGVEGLAFVNTKYASD----------GGNQIRKAHGLREDFYDEVYGPI 479
            +  +G ++  G  +  A + T+YA            GG     A   R     E+    
Sbjct: 387 LLFRDGLMSGTGISDVTAKLATRYADSPERPDLQLYFGGYLASCA---RTGQVGELLS-- 441

Query: 480 NNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSK 539
           NN       P +L PRSRG I LRS +PL+ PRI   Y +   D+ TL+EG+K ++ LS+
Sbjct: 442 NNSRSIQIFPAVLNPRSRGFIGLRSADPLEPPRIVANYLTHEQDVKTLVEGIKFVIRLSQ 501

Query: 540 TRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVV 599
           T   +QY  R        C      +DAY+EC +R  +    H  G+CKMGP  D  AVV
Sbjct: 502 TTPLKQYGMRLDKTVVKGCEAHAFGSDAYWECAVRQNTGPENHQAGSCKMGPSHDPMAVV 561

Query: 600 DPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDW 646
           +  LRVHGI  LRV+D SIMP + SGNT+AP +MI EKG+ ++K+ W
Sbjct: 562 NHELRVHGIRGLRVMDTSIMPKVSSGNTHAPAVMIAEKGAYLLKRAW 608
Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function description
>sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 Back     alignment and function description
>sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 Back     alignment and function description
>sp|Q6UPE0|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2 Back     alignment and function description
>sp|P64264|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1 Back     alignment and function description
>sp|P64263|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1 Back     alignment and function description
>sp|Q985M5|BETA_RHILO Choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1306
3576316991227 glucose dehydrogenase [Danaus plexippus] 0.682 0.726 0.504 0.0
340720639622 PREDICTED: glucose dehydrogenase [accept 0.456 0.958 0.633 0.0
383860460622 PREDICTED: glucose dehydrogenase [accept 0.456 0.958 0.633 0.0
307191038623 Glucose dehydrogenase [acceptor] [Campon 0.456 0.956 0.628 0.0
48094611629 PREDICTED: glucose dehydrogenase [accept 0.456 0.947 0.620 0.0
156551740622 PREDICTED: glucose dehydrogenase [accept 0.455 0.956 0.612 0.0
91085207624 PREDICTED: similar to alcohol dehydrogen 0.456 0.955 0.620 0.0
332028793623 Glucose dehydrogenase [Acromyrmex echina 0.450 0.945 0.615 0.0
322796413631 hypothetical protein SINV_12131 [Solenop 0.441 0.912 0.621 0.0
307206061627 Glucose dehydrogenase [acceptor] [Harpeg 0.458 0.955 0.616 0.0
>gi|357631699|gb|EHJ79168.1| glucose dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/965 (50%), Positives = 648/965 (67%), Gaps = 74/965 (7%)

Query: 36  LAASAVSNVA----WFAPLLAATVAFFQYGVKDSAPESMNKAEPLYPEYDFIVVGAGSAG 91
           LA++A+ +V+    W  PLL     +  Y   D  PES    +    EYDF+VVG GSAG
Sbjct: 7   LASTALKSVSVTGLWLIPLLLGAFTYHNYNSYD--PESKVLEKEPKREYDFVVVGGGSAG 64

Query: 92  AVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEH 151
           AVVANRL+EI++W +LLLE+G DE +I+DVP LAAYLQL+ LDW YKTEP+  +CL  ++
Sbjct: 65  AVVANRLTEIKDWNLLLLESGPDENEITDVPSLAAYLQLTKLDWQYKTEPTPYACLGFKN 124

Query: 152 NRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQY 211
           NRC+WPRGK++GGSSVLNYM+YVRGN+ DY+ WES GNPGWG  + L YF KSEDNRN Y
Sbjct: 125 NRCSWPRGKLLGGSSVLNYMIYVRGNKYDYDQWESFGNPGWGYRDVLKYFIKSEDNRNPY 184

Query: 212 LAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNG 271
           LA+  YH  GGYLTVQEAPW TPL  AFV  G E+GY+NRDING  QTGFM+AQGT+R G
Sbjct: 185 LAKNQYHGQGGYLTVQEAPWKTPLVAAFVEAGVEIGYDNRDINGAIQTGFMMAQGTIRRG 244

Query: 272 ARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVIRARKEVI 331
           +RCST+KAFL+PV+TR NL ISLHSHVTK+LI+P    A GVE+VK+  + V+ ARKEVI
Sbjct: 245 SRCSTAKAFLRPVRTRKNLDISLHSHVTKILINPMTMKAYGVEYVKHGIKKVVYARKEVI 304

Query: 332 LSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLINQPISLV 391
           LS GA+NSPQ+LMLSGIGPKDHL  +GIK ++DL VG NL DHVG+GG TFL+++P+ +V
Sbjct: 305 LSAGAINSPQLLMLSGIGPKDHLQSVGIKVLKDLPVGENLMDHVGVGGLTFLVDKPVGIV 364

Query: 392 QDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNT 451
           Q+RL++    +NY +   G                         P+T +GG+EG+AFVNT
Sbjct: 365 QNRLQAFPVTMNYVLNERG-------------------------PMTTLGGLEGIAFVNT 399

Query: 452 KY-------------------ASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLL 492
           KY                   ASD G  ++K  GL+++ YD V+ PI NKD W+ +P+LL
Sbjct: 400 KYANSSGLWPDIQFHMAPATFASDNGQTVKKVLGLKDEIYDTVFKPIANKDGWTIMPLLL 459

Query: 493 RPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHN 552
           RP +RG ++L+S NP +YP + P Y  D  D+  L+EG+KI L+++    F+Q+ SR + 
Sbjct: 460 RPNTRGYVRLKSSNPFEYPIMNPRYHEDPLDVSRLVEGIKIALKVANASPFKQFGSRLYM 519

Query: 553 IPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLR 612
            P PNC      +D Y EC +R  S+TIYH  GT KMGP  D  AVVDPRLRV GI  LR
Sbjct: 520 KPLPNCKQHKFMSDEYIECQVRSISMTIYHQCGTAKMGPSWDKGAVVDPRLRVFGIEGLR 579

Query: 613 VIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYIYSSFSTARIAMSYGPSIGF--- 669
           VIDASIMPTIVSGNTNAPVIMIGEKGSDMIK+DW             ++ Y P   F   
Sbjct: 580 VIDASIMPTIVSGNTNAPVIMIGEKGSDMIKEDWLN-----------SLCYFPLATFGRD 628

Query: 670 -ILLFRYMISQYRPDVEDLEHLIPDVPLEEMYPEYDFVVVGGGSAGAVVARRLSEQKNWK 728
            IL     I+ +  D  ++ +  P    + + P+YDF++VG G+AG +++ RL+E   +K
Sbjct: 629 TIL---DGIAGFLRDAAEIHNGEP-AETDFILPKYDFIIVGAGTAGCILSNRLTEVDKFK 684

Query: 729 VLLLEAGGEESPLSDIPCTYPALQTSPLDWQYKTEPNDRACLGLNGRRSNWPRGKVIGGS 788
           VLL+EAGG E    DIP     LQ +  +W+Y+TEP    C+G+  +R  WPRGKV+GGS
Sbjct: 685 VLLIEAGGAEQVFMDIPVLATMLQFTEANWKYRTEPQKAGCMGMRDKRCAWPRGKVVGGS 744

Query: 789 SVLNAMLYVRGNRRDYDAWEAAGNEGWSYRDTLPYFIKSESVNISSLV-DSPYHGTQGPL 847
           SVL++M++ RGN+RDYD W A+GN GW Y   L YF KSE++ I  LV D  YH TQGP+
Sbjct: 745 SVLHSMMHTRGNKRDYDTWAASGNPGWDYDSVLKYFKKSENIEIPHLVNDKKYHSTQGPM 804

Query: 848 SVEEFRYYSPVTEAFVESAGELGYEVGDINGERQTGFTRAHGTLKNGLRCSTAKAYLRPI 907
           +++E R+ +P+++AF+++  E+G  + D NG+ Q G++    T+KNG R S ++A+L PI
Sbjct: 805 TIQEPRWRTPLSDAFLDAGVEIGGNINDYNGKTQIGYSIIQFTMKNGTRMSVSRAFLHPI 864

Query: 908 IARPNLHVSLHSHAYRVHFEPGPDGQMRATGVVVKKGRKDPVLVRARREVILSAGAIGSP 967
             R N H+  ++   +V  +     + RA GV  +K  K  ++VRA+REVILSAG++ SP
Sbjct: 865 KKRRNFHIIKNALVTKVLID---HKKKRAYGVQFEKDGKQ-IVVRAKREVILSAGSVNSP 920

Query: 968 QVYLI 972
           Q+ ++
Sbjct: 921 QLLML 925

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340720639|ref|XP_003398741.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383860460|ref|XP_003705707.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307191038|gb|EFN74792.1| Glucose dehydrogenase [acceptor] [Camponotus floridanus] Back     alignment and taxonomy information
>gi|48094611|ref|XP_394224.1| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera] Back     alignment and taxonomy information
>gi|156551740|ref|XP_001601943.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91085207|ref|XP_972126.1| PREDICTED: similar to alcohol dehydrogenase [Tribolium castaneum] gi|270009077|gb|EFA05525.1| hypothetical protein TcasGA2_TC015712 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332028793|gb|EGI68822.1| Glucose dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322796413|gb|EFZ18947.1| hypothetical protein SINV_12131 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307206061|gb|EFN84154.1| Glucose dehydrogenase [acceptor] [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1306
FB|FBgn0030598626 CG9503 [Drosophila melanogaste 0.468 0.977 0.590 3.4e-203
FB|FBgn0030590703 CG9518 [Drosophila melanogaste 0.465 0.864 0.546 1e-185
FB|FBgn0030591865 CG9517 [Drosophila melanogaste 0.442 0.668 0.527 1e-171
FB|FBgn0030592726 CG9514 [Drosophila melanogaste 0.473 0.851 0.486 5.9e-160
FB|FBgn0039415616 CG6142 [Drosophila melanogaste 0.429 0.910 0.461 7e-141
FB|FBgn0030596633 CG12398 [Drosophila melanogast 0.434 0.897 0.423 1.9e-122
FB|FBgn0030588621 CG9521 [Drosophila melanogaste 0.447 0.940 0.434 6.5e-122
FB|FBgn0030589622 CG9519 [Drosophila melanogaste 0.431 0.905 0.424 4.2e-118
FB|FBgn0001112625 Gld "Glucose dehydrogenase" [D 0.261 0.547 0.446 8.2e-111
FB|FBgn0030587616 CG9522 [Drosophila melanogaste 0.428 0.907 0.403 4.9e-108
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1966 (697.1 bits), Expect = 3.4e-203, P = 3.4e-203
 Identities = 369/625 (59%), Positives = 467/625 (74%)

Query:    28 GVAETIPSLAASAVSNVAWFAPLLAATVAFFQYGV---KDSAPESMNKAEPLYPEYDFIX 84
             G A  I     +A SN +WF P+L A VA+FQY      +S P  +   + +   YDFI 
Sbjct:     7 GAASAIGGAVTAATSN-SWFIPMLMAAVAYFQYEEIIDPESKPSDVG-GDDILDHYDFIV 64

Query:    85 XXXXXXXXXXXNRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSST 144
                        NRL+E+ENW +LLLEAGGDET+++DVP++A YLQLS +DW YKTEPS T
Sbjct:    65 IGAGSAGAVVANRLTEVENWNVLLLEAGGDETELTDVPLMAGYLQLSKIDWQYKTEPSGT 124

Query:   145 SCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKS 204
             SCLAM+  RCNWPRGKV+GGSSVLNYMLY+RG+++DY++WE++GNP W   +ALYYFKKS
Sbjct:   125 SCLAMQGGRCNWPRGKVLGGSSVLNYMLYLRGSKHDYDNWEAMGNPSWSYRDALYYFKKS 184

Query:   205 EDNRNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYENRDINGEYQTGFMVA 264
             EDN NQYLA TPYH +GGYLTV EAP+HTPLA +FV  G E+GYENRD+NGE  TGFM+A
Sbjct:   185 EDNTNQYLANTPYHATGGYLTVGEAPYHTPLAASFVEAGVEMGYENRDLNGEKMTGFMIA 244

Query:   265 QGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIGVEFVKNHQRHVI 324
             QGT R G+RCSTSKAFL+P + RPNLHIS++SHVT+++IDP  ++A GVEFVK+ + + +
Sbjct:   245 QGTTRRGSRCSTSKAFLRPARLRPNLHISMNSHVTRIMIDPVTKLAFGVEFVKDQKLYHV 304

Query:   325 RARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVGYNLQDHVGLGGFTFLI 384
             RA KEV+LSGG+VNSPQ+LMLSG+GP+  L    I  I++L VG NLQDH+GLGG TFL+
Sbjct:   305 RATKEVVLSGGSVNSPQLLMLSGVGPRKELAKHRIPLIKELSVGENLQDHIGLGGLTFLV 364

Query:   385 NQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSV-LNYAMMGNGPLTVMGGV 443
             NQP+S+V++R  ++ +VL Y + G GPLT++GG  +E +  V   YA   N  L     +
Sbjct:   365 NQPVSIVENRFHTMSTVLQYVVFGQGPLTILGG--VEGLAYVNTKYA---NSSLD-WPDI 418

Query:   444 EGLAFVNTKYASDGGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLR 503
             E   FV+    SDGG+Q+RKAHGL + FY  V+ PINN+D WS IPMLLRPRS G I+LR
Sbjct:   419 E-FHFVSGSTNSDGGSQLRKAHGLTDAFYRAVFEPINNRDAWSIIPMLLRPRSVGNIRLR 477

Query:   504 SRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPM 563
             S NP DYP I P Y +D  DM TLIEGVKI + LS T++ +++ SR  +I +P C  +P+
Sbjct:   478 SGNPFDYPYIFPNYLTDDFDMKTLIEGVKIAVALSLTKAMQRFGSRISSIRWPGCEQVPL 537

Query:   564 YTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIV 623
             +TDA++ECM+R Y+ TIYHPVGTCKMGP  D +AVVD +LRV+GI  LRVIDASIMP +V
Sbjct:   538 FTDAFWECMVRRYTSTIYHPVGTCKMGPYWDKDAVVDAKLRVYGIRGLRVIDASIMPKLV 597

Query:   624 SGNTNAPVIMIGEKGSDMIKQDWRK 648
             S NTNAPVIMI EKGSDMIK+ W K
Sbjct:   598 SANTNAPVIMIAEKGSDMIKEFWIK 622
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0008812 "choline dehydrogenase activity" evidence=IEA
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1306
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 1e-120
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 1e-112
TIGR01810532 TIGR01810, betA, choline dehydrogenase 1e-109
TIGR01810532 TIGR01810, betA, choline dehydrogenase 1e-100
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 2e-93
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 1e-86
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 6e-77
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 9e-50
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 1e-49
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 1e-48
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 9e-48
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 5e-47
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 2e-41
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 2e-36
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 5e-27
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 3e-22
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 2e-10
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 9e-07
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 2e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 0.001
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 0.002
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.002
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  385 bits (990), Expect = e-120
 Identities = 194/577 (33%), Positives = 277/577 (48%), Gaps = 55/577 (9%)

Query: 78  PEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGG-DETDISDVPVLAAYLQLSG-LDW 135
            EYD+++VG+GSAG+V+A RLS+     +L+LEAGG D   +  +P   A+L      DW
Sbjct: 6   MEYDYVIVGSGSAGSVLAARLSDAGL-SVLVLEAGGPDRRPLIQMPAAYAFLMNGPRYDW 64

Query: 136 SYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESL-GNPGWGA 194
            ++TEP       +      WPRGKV+GGSS +N M+YVRG+  D++ W    G PGW  
Sbjct: 65  GFRTEPEP----HLRGRELAWPRGKVLGGSSSINGMVYVRGHPEDFDAWAQESGAPGWPY 120

Query: 195 AEALYYFKKSEDNRNQYLAETP-YHNSGGYLTVQEAPWHTPLAEAFVRGGEELGYE-NRD 252
            + L YFK++ED       +   +H  GG L V       P+A AF+  GE+LG+    D
Sbjct: 121 DDVLPYFKRAEDLLGVGGQDLRTWHGGGGPLPVSPPRSPNPIARAFIEAGEQLGFPTTPD 180

Query: 253 INGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLIDPKNRMAIG 312
            NG  Q GF     T+ NG R S ++A+L+P   RPNL +   + V ++L++   R A+G
Sbjct: 181 PNGADQEGFGPYCVTICNGRRWSAARAYLKPALKRPNLTLLTGARVRRILLEGD-R-AVG 238

Query: 313 VEFVKNHQRH--VIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLK-VGY 369
           VE             A +EV+L+ GA+NSP++L+LSGIGP DHL + GI  +  L  VG 
Sbjct: 239 VEVEIGDGGTIETAVAAREVVLAAGAINSPKLLLLSGIGPADHLLEHGIDVVGRLPGVGQ 298

Query: 370 NLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNY 429
           NLQDH+ +                         N +++       +G DR         Y
Sbjct: 299 NLQDHLEIYVAF---------------EATEPTNDSVLSLFSKLGIGADR---------Y 334

Query: 430 AMMGNGPLTVMGGVEGLAFVNTKYAS-DGGNQIRKAHGLREDFYDEVYGPINNKDVWSAI 488
            +  +GP        G           DG                E +G       ++  
Sbjct: 335 LLTRDGPGATNHFEGGFVRSGPAGEYPDGQYHFAPLPLAIRAAGAE-HG-------FTLH 386

Query: 489 PMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILELSKTRSFRQYES 548
              +RP+SRG + LRS +P + P I P Y S   D      G+++  E+    +      
Sbjct: 387 VGPMRPKSRGSVTLRSPDPDNRPVIDPNYLSAEGDRAIFRAGIRLTREIIGQPALDARRK 446

Query: 549 RFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGI 608
                P P  T     TD      IR  + T YHP+GTC+MG    +  V DP LRVHG+
Sbjct: 447 -AELAPGPRVT-----TDEDISAAIRFLARTAYHPMGTCRMG-SDPAAVVDDPYLRVHGL 499

Query: 609 GNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQD 645
            NLRV+DAS+MPT    N N  +I + E+ +D I  D
Sbjct: 500 ENLRVVDASVMPTSTGVNPNLTIIALAERAADHILGD 536

Length = 542
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1306
KOG1238|consensus623 100.0
KOG1238|consensus623 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785587 Protein HOTHEAD 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785587 Protein HOTHEAD 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.97
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.96
PRK07121492 hypothetical protein; Validated 99.38
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.37
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.35
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.34
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.33
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.33
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.31
PRK07121492 hypothetical protein; Validated 99.3
PRK08274466 tricarballylate dehydrogenase; Validated 99.27
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.27
PRK06175433 L-aspartate oxidase; Provisional 99.26
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.26
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.23
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.22
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.22
PRK08274466 tricarballylate dehydrogenase; Validated 99.21
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.21
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.21
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.2
PRK07395553 L-aspartate oxidase; Provisional 99.2
COG2081408 Predicted flavoproteins [General function predicti 99.18
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PLN02815594 L-aspartate oxidase 99.17
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.17
PRK07804541 L-aspartate oxidase; Provisional 99.17
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.17
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.17
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.16
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.16
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.15
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.14
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.13
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.13
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.12
PRK06175433 L-aspartate oxidase; Provisional 99.12
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.11
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.11
PRK08626657 fumarate reductase flavoprotein subunit; Provision 99.1
PRK12839572 hypothetical protein; Provisional 99.1
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.1
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 99.1
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.09
PRK12842574 putative succinate dehydrogenase; Reviewed 99.09
PRK08071510 L-aspartate oxidase; Provisional 99.09
PRK07395553 L-aspartate oxidase; Provisional 99.08
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.08
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.08
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.08
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.06
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.06
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.06
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.05
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.05
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.05
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.04
PRK09077536 L-aspartate oxidase; Provisional 99.04
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.04
PRK07804541 L-aspartate oxidase; Provisional 99.03
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.02
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.02
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.01
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.01
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.01
PLN02815594 L-aspartate oxidase 99.0
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.0
PRK07512513 L-aspartate oxidase; Provisional 99.0
PRK12842574 putative succinate dehydrogenase; Reviewed 99.0
PRK08275554 putative oxidoreductase; Provisional 98.99
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 98.99
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.98
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.98
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.97
PRK12839572 hypothetical protein; Provisional 98.97
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.96
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.96
PRK08401466 L-aspartate oxidase; Provisional 98.96
KOG4254|consensus561 98.95
COG0579429 Predicted dehydrogenase [General function predicti 98.95
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.95
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.94
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.94
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.93
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.91
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.91
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.91
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.9
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.9
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.9
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.9
PLN02661357 Putative thiazole synthesis 98.9
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.89
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.89
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.88
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.88
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
PRK09077536 L-aspartate oxidase; Provisional 98.88
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.88
COG2081408 Predicted flavoproteins [General function predicti 98.87
PRK07512513 L-aspartate oxidase; Provisional 98.87
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.86
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.86
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.86
PRK08275554 putative oxidoreductase; Provisional 98.85
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.85
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.85
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.85
COG0579429 Predicted dehydrogenase [General function predicti 98.84
PRK08071510 L-aspartate oxidase; Provisional 98.84
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.83
PRK11728393 hydroxyglutarate oxidase; Provisional 98.83
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.83
PLN02464627 glycerol-3-phosphate dehydrogenase 98.82
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.82
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.82
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.81
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.8
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.8
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.79
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.78
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.78
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.78
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.77
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.77
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.76
PRK05257494 malate:quinone oxidoreductase; Validated 98.76
PRK05257494 malate:quinone oxidoreductase; Validated 98.76
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.74
PRK11728393 hydroxyglutarate oxidase; Provisional 98.74
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.73
PLN02661357 Putative thiazole synthesis 98.73
COG3573552 Predicted oxidoreductase [General function predict 98.73
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.72
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.71
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.7
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.7
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.69
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.68
KOG2820|consensus399 98.68
PRK08401466 L-aspartate oxidase; Provisional 98.68
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.67
PLN02464627 glycerol-3-phosphate dehydrogenase 98.66
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.65
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.65
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.64
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.64
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.63
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.61
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.61
PRK10157428 putative oxidoreductase FixC; Provisional 98.6
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.58
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.58
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.57
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.57
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.56
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.56
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.56
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.56
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.55
COG3573552 Predicted oxidoreductase [General function predict 98.54
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.54
PRK10015429 oxidoreductase; Provisional 98.53
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.53
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.49
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.49
KOG2844|consensus 856 98.46
PRK13977576 myosin-cross-reactive antigen; Provisional 98.45
KOG2404|consensus477 98.45
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.42
PRK10157428 putative oxidoreductase FixC; Provisional 98.41
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.4
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.35
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.34
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.34
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.33
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.33
PRK10015429 oxidoreductase; Provisional 98.27
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.26
PLN02697529 lycopene epsilon cyclase 98.26
KOG2415|consensus621 98.25
KOG2820|consensus399 98.24
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.22
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.21
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.2
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.2
PRK13977576 myosin-cross-reactive antigen; Provisional 98.19
KOG1298|consensus509 98.19
PRK07208479 hypothetical protein; Provisional 98.19
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.18
PRK06847375 hypothetical protein; Provisional 98.16
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.16
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.16
KOG0042|consensus680 98.15
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.15
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.15
KOG2415|consensus621 98.14
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.14
PRK06184502 hypothetical protein; Provisional 98.13
PRK09126392 hypothetical protein; Provisional 98.13
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 98.13
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.11
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.1
PRK06834488 hypothetical protein; Provisional 98.1
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.1
PLN02985514 squalene monooxygenase 98.09
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.08
KOG0042|consensus680 98.08
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.08
PRK06185407 hypothetical protein; Provisional 98.07
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.06
KOG1298|consensus509 98.06
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.06
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.06
PRK06185407 hypothetical protein; Provisional 98.06
KOG2844|consensus856 98.05
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.04
PLN02463447 lycopene beta cyclase 98.03
PRK07190487 hypothetical protein; Provisional 98.02
KOG2404|consensus477 98.01
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.01
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.0
PRK08013400 oxidoreductase; Provisional 97.99
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.99
PRK08244493 hypothetical protein; Provisional 97.99
PRK07045388 putative monooxygenase; Reviewed 97.98
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.98
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.97
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.96
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.96
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.96
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.96
PRK06126545 hypothetical protein; Provisional 97.96
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.96
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.95
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.94
PRK11445351 putative oxidoreductase; Provisional 97.94
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.94
PRK08244493 hypothetical protein; Provisional 97.93
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.91
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.91
KOG2853|consensus509 97.9
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.9
PRK07233434 hypothetical protein; Provisional 97.9
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.89
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.89
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.89
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 97.87
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.87
PLN02985514 squalene monooxygenase 97.86
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.86
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.86
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.85
PRK06126545 hypothetical protein; Provisional 97.85
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.85
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.85
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.84
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.84
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.84
KOG2665|consensus453 97.83
PRK06184502 hypothetical protein; Provisional 97.83
PRK08163396 salicylate hydroxylase; Provisional 97.83
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.82
PRK07588391 hypothetical protein; Provisional 97.82
PRK07236386 hypothetical protein; Provisional 97.81
PRK07190487 hypothetical protein; Provisional 97.8
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.8
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.8
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.79
PRK07208479 hypothetical protein; Provisional 97.78
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.78
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.78
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.77
PLN02507499 glutathione reductase 97.77
KOG4254|consensus561 97.75
KOG2311|consensus 679 97.74
PRK06753373 hypothetical protein; Provisional 97.74
KOG2853|consensus509 97.73
PRK06847375 hypothetical protein; Provisional 97.73
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.73
PLN02487569 zeta-carotene desaturase 97.73
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.72
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.71
PRK07045388 putative monooxygenase; Reviewed 97.71
PRK11445351 putative oxidoreductase; Provisional 97.7
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.68
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.68
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.67
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.65
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.61
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.61
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.6
KOG2665|consensus453 97.59
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.58
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.58
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.57
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.57
PRK06834488 hypothetical protein; Provisional 97.55
PRK05868372 hypothetical protein; Validated 97.54
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.53
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.52
PLN02612567 phytoene desaturase 97.52
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 97.51
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.51
PRK07538413 hypothetical protein; Provisional 97.5
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.5
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.47
PRK06996398 hypothetical protein; Provisional 97.46
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.46
PTZ00058561 glutathione reductase; Provisional 97.45
PRK07538413 hypothetical protein; Provisional 97.44
PRK06370463 mercuric reductase; Validated 97.43
KOG2960|consensus328 97.43
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.41
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.4
PRK06475400 salicylate hydroxylase; Provisional 97.37
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.35
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.35
KOG2852|consensus380 97.34
PTZ00058561 glutathione reductase; Provisional 97.34
PRK06116450 glutathione reductase; Validated 97.33
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.32
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.32
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.31
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.31
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.31
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.3
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.3
KOG1399|consensus448 97.3
PRK09897534 hypothetical protein; Provisional 97.26
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.26
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.25
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.22
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.21
PRK06370463 mercuric reductase; Validated 97.21
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.2
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.2
PRK06116450 glutathione reductase; Validated 97.19
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.17
PLN02546558 glutathione reductase 97.14
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 97.14
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.12
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.11
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.11
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.1
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.1
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.1
KOG1399|consensus448 97.1
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.1
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.1
KOG0029|consensus501 97.07
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.07
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.06
PRK09897534 hypothetical protein; Provisional 97.06
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.06
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.06
KOG0405|consensus478 97.05
PRK08013400 oxidoreductase; Provisional 97.04
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.03
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.03
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.03
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.03
PLN02463447 lycopene beta cyclase 97.02
PRK09126392 hypothetical protein; Provisional 97.02
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.02
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.02
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.0
PLN02546558 glutathione reductase 97.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.98
PRK13748561 putative mercuric reductase; Provisional 96.95
PLN02576496 protoporphyrinogen oxidase 96.94
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.94
TIGR02053463 MerA mercuric reductase. This model represents the 96.94
PTZ00367567 squalene epoxidase; Provisional 96.94
PTZ00153659 lipoamide dehydrogenase; Provisional 96.93
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.92
PLN02697529 lycopene epsilon cyclase 96.92
TIGR02053463 MerA mercuric reductase. This model represents the 96.91
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.9
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.89
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 96.88
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.88
PTZ00153659 lipoamide dehydrogenase; Provisional 96.88
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 96.87
PRK14694468 putative mercuric reductase; Provisional 96.87
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.86
PTZ00052499 thioredoxin reductase; Provisional 96.85
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.83
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.82
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.81
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.81
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.81
KOG2852|consensus380 96.81
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.8
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.8
KOG2311|consensus679 96.8
PLN02268435 probable polyamine oxidase 96.79
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.79
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.77
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.76
KOG0029|consensus501 96.76
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.76
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 96.73
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.72
PTZ00052499 thioredoxin reductase; Provisional 96.72
PTZ00367567 squalene epoxidase; Provisional 96.71
PRK13748561 putative mercuric reductase; Provisional 96.7
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.7
PRK14694468 putative mercuric reductase; Provisional 96.69
PRK08294634 phenol 2-monooxygenase; Provisional 96.69
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.67
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.64
PLN02507499 glutathione reductase 96.64
PLN02576496 protoporphyrinogen oxidase 96.62
PRK14727479 putative mercuric reductase; Provisional 96.61
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.61
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.61
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.6
COG3349485 Uncharacterized conserved protein [Function unknow 96.57
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.55
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.55
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.54
PLN02568539 polyamine oxidase 96.53
PRK06996398 hypothetical protein; Provisional 96.51
PLN02268435 probable polyamine oxidase 96.5
PRK08163396 salicylate hydroxylase; Provisional 96.5
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 96.5
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.49
PRK08294634 phenol 2-monooxygenase; Provisional 96.44
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.43
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.41
PRK07588391 hypothetical protein; Provisional 96.41
PRK07236386 hypothetical protein; Provisional 96.41
KOG2614|consensus420 96.39
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.39
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.37
PRK14727479 putative mercuric reductase; Provisional 96.36
PRK10262321 thioredoxin reductase; Provisional 96.36
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.34
PLN02676487 polyamine oxidase 96.33
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.33
PRK06753373 hypothetical protein; Provisional 96.32
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.31
PRK07233434 hypothetical protein; Provisional 96.29
PRK13512438 coenzyme A disulfide reductase; Provisional 96.27
KOG1335|consensus506 96.26
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.25
PRK07846451 mycothione reductase; Reviewed 96.23
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.22
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.21
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.2
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 96.2
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.2
PRK10262321 thioredoxin reductase; Provisional 96.18
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 96.14
PLN02568539 polyamine oxidase 96.11
PRK07846451 mycothione reductase; Reviewed 96.1
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 96.1
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.09
PRK12416463 protoporphyrinogen oxidase; Provisional 96.08
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.05
PLN02676487 polyamine oxidase 96.03
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 96.02
KOG4716|consensus503 96.02
COG3349485 Uncharacterized conserved protein [Function unknow 96.0
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 95.99
PRK05868372 hypothetical protein; Validated 95.95
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 95.94
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.88
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.88
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 95.88
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.87
KOG4716|consensus503 95.86
PRK12831464 putative oxidoreductase; Provisional 95.85
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 95.82
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 95.82
KOG0405|consensus478 95.8
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.77
KOG2614|consensus420 95.67
>KOG1238|consensus Back     alignment and domain information 
Probab=100.00  E-value=3e-104  Score=920.62  Aligned_cols=549  Identities=53%  Similarity=0.891  Sum_probs=501.5

Q ss_pred             CCCCCccEEEECCChhHHHHHHHHhCCCCCEEEEEcCCCCCCCCCcchhhHHhhhcCCCCCccccccCcccccccCCCee
Q psy1043          75 PLYPEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDISDVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRC  154 (1306)
Q Consensus        75 ~~~~~yDvIIVGsG~aG~~~A~rLae~~G~~VLvLE~G~~~~~~~~~p~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~  154 (1306)
                      +...+|||||||||+|||++|.||||++.++|||||||+.++...++|.+...++.+.++|.|.++|+...|+++.+++|
T Consensus        53 ~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~~ac~~m~~~~c  132 (623)
T KOG1238|consen   53 ELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQHACLAMSEDRC  132 (623)
T ss_pred             ccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccChhhhhhhcCCce
Confidence            34578999999999999999999999999999999999999888899988889999999999999999999999999999


Q ss_pred             eecCcccccCcccccceEEecCChhhHHHHHhcCCCCCChhhHHHHHHHhccCCCCCCCCCCCCCCCCceeeecCCCccH
Q psy1043         155 NWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESLGNPGWGAAEALYYFKKSEDNRNQYLAETPYHNSGGYLTVQEAPWHTP  234 (1306)
Q Consensus       155 ~~~~g~~lGGsS~~n~~~~~r~~~~d~~~w~~~g~~~w~~~~~~~y~~~~e~~~~~~~~~~~~~~~~g~l~~~~~~~~~~  234 (1306)
                      .|+|||+|||+|++|+|+|.|++..|||.|++.|+++|+|+++++||+++|+...+.....+||+..|++.+....+..+
T Consensus       133 ~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~~~~~  212 (623)
T KOG1238|consen  133 YWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGVYPNN  212 (623)
T ss_pred             ecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceeccccccCc
Confidence            99999999999999999999999999999999999999999999999999999888888888999999999999999999


Q ss_pred             HHHHHHHHHHHcCCCCCCCCCCCccceeeecccccCCcccchhhhccccccC-CCCeEEEeccEEEEEEecCCCCeEEEE
Q psy1043         235 LAEAFVRGGEELGYENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKT-RPNLHISLHSHVTKVLIDPKNRMAIGV  313 (1306)
Q Consensus       235 ~~~~~~~~~~~~G~~~~~~~~~~~~g~~~~~~~~~~g~r~s~~~~~l~~~~~-~~nl~I~~~~~V~~I~~d~~~~~~~GV  313 (1306)
                      +...|.++..++|.+..|+||..+.|+...+.+.++|.|+++..+|+.++.. |+|++|..++.|++|++|..++++.||
T Consensus       213 ~~~~~~~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~a~gv  292 (623)
T KOG1238|consen  213 LFTAFHRAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKRAKGV  292 (623)
T ss_pred             hhhHhHHhHHhcCCCccCCCCccccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCceEEEE
Confidence            9999999999999999999999999999999999999999999999999887 899999999999999999888899999


Q ss_pred             EEEeC-CeEEEEEEcceEEEccCCCCcHHHHHHhCCCCcccccccCCCceeccc-cccccccccCCceEEEEecCCcccc
Q psy1043         314 EFVKN-HQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLK-VGYNLQDHVGLGGFTFLINQPISLV  391 (1306)
Q Consensus       314 ~~~~~-g~~~~v~A~k~VVLaAGai~Sp~LLl~SGiG~~~~L~~~gI~~~~dlp-VG~nL~dH~~~~~~~~~~~~~~~~~  391 (1306)
                      ++.++ ++.++++|+||||||||||+||||||+|||||++||++.|||++.||| ||+|||||+...++.+..+ +....
T Consensus       293 ~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~~~~-~~~~~  371 (623)
T KOG1238|consen  293 EFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVFSTN-PVELS  371 (623)
T ss_pred             EEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeeecCC-Ccccc
Confidence            99988 799999999999999999999999999999999999999999999999 9999999998877665544 32222


Q ss_pred             hhhhhhHHHHHhhhhcCCCCccccCCcchhhHHHHHHHHHcCCCCcccCCcceEEEEeecCCCC---CCch---------
Q psy1043         392 QDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYAS---DGGN---------  459 (1306)
Q Consensus       392 ~~~~~~~~~~~~~~~~~~gp~~~~~~~~~~~~~~~~~~~~~~~G~l~~~~~~~~~~~~~~~~~~---~~~~---------  459 (1306)
                      ..++.                         ....+.+|+..+.|++.+.+ .+.++|+++....   +++.         
T Consensus       372 ~~~~~-------------------------~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~  425 (623)
T KOG1238|consen  372 LIRLV-------------------------GITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGS  425 (623)
T ss_pred             ccccc-------------------------cchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEecccc
Confidence            11111                         23556789999999998877 8899999987653   1110         


Q ss_pred             ----hhHhhcCCchhhhhcccCCcCCCCeEEEEeecCCcCceeEEEeccCCCCCCCeeecCCCCChhhHHHHHHHHHHHH
Q psy1043         460 ----QIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIIL  535 (1306)
Q Consensus       460 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~p~srg~v~l~~~d~~~~p~i~~~y~~~~~D~~~~~~~~~~~~  535 (1306)
                          .+........++++.++........+.+++.+++|.|||+|.|+++||++.|+|++||+.+|+|++.++++++.+.
T Consensus       426 ~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~  505 (623)
T KOG1238|consen  426 LSSDGLTALRKALGEIYQALFGELTNSDSFVIFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTII  505 (623)
T ss_pred             ccccchhhhhhhcchHHHHhhhhhhcCceeEEeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHH
Confidence                0011111122566667777766778999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCcchhhcccccccCCCCCCCCCCCCCHHHHHHHHHhccCCCccccccccccCCCCCCCccCCCCceeccCCcEEee
Q psy1043         536 ELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVHGIGNLRVID  615 (1306)
Q Consensus       536 ~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~t~~H~~GT~rMG~~~d~~sVVD~~~rV~gv~NL~V~D  615 (1306)
                      ++.++.+|++++.++...++|+|....+.+|+||+|++|+.+.|.||++|||+|||+.|+++|||+++||||++||||+|
T Consensus       506 ~l~~s~af~~~~~r~~~~~~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVD  585 (623)
T KOG1238|consen  506 RLSNSKAFQRFGARLWKKPVPGCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVD  585 (623)
T ss_pred             HHHcCHHHHHhcchhccccCCCcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCccchHHHHHHHHHHHHHHHHhHhhhh
Q psy1043         616 ASIMPTIVSGNTNAPVIMIGEKGSDMIKQDWRKYI  650 (1306)
Q Consensus       616 aSv~Pt~~~~NP~lTi~alAeraAd~I~~~~~~~~  650 (1306)
                      |||||.++++||++|+||||||+||+|+++|....
T Consensus       586 aSimP~~psgN~nA~v~MIgek~ad~Ik~~~~~~~  620 (623)
T KOG1238|consen  586 ASIMPESPSGNPNAPVMMIGEKAADMIKEEWLANK  620 (623)
T ss_pred             ccccCCCCCCCccHHHHHHHHHHHHHHHHHhhhcC
Confidence            99999999999999999999999999999997644

>KOG1238|consensus Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1306
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 3e-60
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 3e-24
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 3e-18
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 1e-55
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 4e-36
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 2e-55
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 2e-36
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 4e-55
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 1e-35
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 2e-45
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 4e-15
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 7e-08
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 1e-39
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 7e-35
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 1e-33
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 1e-12
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 2e-09
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 2e-29
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 6e-15
1naa_A541 Cellobiose Dehydrogenase Flavoprotein Fragment In C 4e-12
1kdg_A546 Crystal Structure Of The Flavin Domain Of Cellobios 5e-12
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 2e-10
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 6e-09
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 2e-10
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 7e-09
3red_A521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 3e-09
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure 
Iteration: 1

 Score =  230 bits (587), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 172/589 (29%), Positives = 292/589 (49%), Gaps = 47/589 (7%)
Query: 79  EYDFIXXXXXXXXXXXXNRLSEIENWKILLLEAGGDETDI--SDVPVLAAYLQLSGL-DW 135
           ++D++             RL+E  +  +L+LEAG  + ++  ++ P+LA  L  + + DW
Sbjct: 2   DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDW 61
Query: 136 SYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESL-GNPGWGA 194
           +Y T    T+          +PRG+++GGSS ++YM+ +RG+  D++ + ++ G+ GW  
Sbjct: 62  NYTT----TAQAGYNGRSIAYPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNW 117
Query: 195 AEALYYFKKSE------DNRNQYLAETP-YHNSGGYLTVQEAPWHTPLAEAFVRGGEELG 247
                + +K+E      DN N      P  H + G +++    + TPL +  +   +E  
Sbjct: 118 DNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLATTQEQS 177
Query: 248 YE---NRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLID 304
            E   N D+   +  G   +  +V NG R S+S A+L+P ++RPNL + +++ VTK++  
Sbjct: 178 EEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS 237
Query: 305 PKNRMAIGVEFVKNHQRH-----VIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGI 359
                      V+  ++       + A+KEV+LS G+V +P +L LSGIG ++ L+ +GI
Sbjct: 238 GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGI 297
Query: 360 KTI-QDLKVGYNLQDHVGLGGFTFL-INQPI-SLVQDRLESVQSVLNYAMMGNGPLTVMG 416
            TI  +  VG NL DH+ L    F+  NQ   ++ +D  E    +  +     GPLT + 
Sbjct: 298 DTIVNNPSVGRNLSDHLLLPAAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTALI 357
Query: 417 GDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASDGGNQIRKAHGLREDFYDEVY 476
            + L  ++   N ++    P    G     A   T +++             + F+  + 
Sbjct: 358 ANHLAWLRLPSNSSIFQTFPDPAAG--PNSAHWETIFSN-------------QWFHPAIP 402
Query: 477 GPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLIEGVKIILE 536
            P +     S    L+ P +RG IKL + NP D P I P+Y S   D+ T+I+ VK  L 
Sbjct: 403 RP-DTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNLR 461
Query: 537 LSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSE 596
               +++  +  R    PF      P   DA  E  IR  + TI+HPVGT  M P   S 
Sbjct: 462 FLSGQAWADFVIR----PFDPRLRDPT-DDAAIESYIRDNANTIFHPVGTASMSPRGASW 516
Query: 597 AVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQD 645
            VVDP L+V G+  LR++D SI+P   + +T  P+ ++G++G+D+IK D
Sbjct: 517 GVVDPDLKVKGVDGLRIVDGSILPFAPNAHTQGPIYLVGKQGADLIKAD 565
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 Back     alignment and structure
>pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1306
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 0.0
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 1e-125
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 4e-87
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 0.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 1e-114
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 3e-78
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 0.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 0.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 0.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 0.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 0.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 0.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 0.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 0.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 0.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 0.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-173
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 4e-91
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-60
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 1e-47
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 4e-38
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 8e-37
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 8e-16
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-11
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-36
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 7e-22
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 8e-07
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 4e-05
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 2e-05
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 2e-04
3atr_A453 Conserved archaeal protein; saturating double bond 3e-05
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 6e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 7e-05
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 8e-05
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 6e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 1e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 8e-04
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 1e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 2e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 3e-04
3dme_A369 Conserved exported protein; structural genomics, P 8e-04
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 9e-04
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
 Score =  751 bits (1942), Expect = 0.0
 Identities = 167/597 (27%), Positives = 280/597 (46%), Gaps = 63/597 (10%)

Query: 79  EYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDI--SDVPVLAAYLQLSG-LDW 135
           ++D++VVGAG+AG VVA RL+E  +  +L+LEAG  + ++  ++ P+LA  L  +   DW
Sbjct: 2   DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDW 61

Query: 136 SYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESL-GNPGWGA 194
           +Y T                +PRG+++GGSS ++YM+ +RG+  D++ + ++ G+ GW  
Sbjct: 62  NYTTTA----QAGYNGRSIAYPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNW 117

Query: 195 AEALYYFKKSEDN-------RNQYLAETPYHNSGGYLTVQEAPWHTPLAEAFVRGGEELG 247
                + +K+E                   H + G +++    + TPL +  +   +E  
Sbjct: 118 DNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLATTQEQS 177

Query: 248 YE---NRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLID 304
            E   N D+   +  G   +  +V NG R S+S A+L+P ++RPNL + +++ VTK++  
Sbjct: 178 EEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS 237

Query: 305 PKNRM-----AIGVEFVKNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGI 359
                      +     +      + A+KEV+LS G+V +P +L LSGIG ++ L+ +GI
Sbjct: 238 GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGI 297

Query: 360 KTIQDLK-VGYNLQDHVGLGGFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGD 418
            TI +   VG NL DH+ L    F +N   +         +    + +            
Sbjct: 298 DTIVNNPSVGRNLSDHLLLP-AAFFVNSNQTFD----NIFRDSSEFNVDL---------- 342

Query: 419 RLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYA----------SDGGNQIRKAHGLR 468
                     +     GPLT       LA++               + G N         
Sbjct: 343 --------DQWTNTRTGPLT-ALIANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETIFS 393

Query: 469 EDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLTLI 528
             ++       +     S    L+ P +RG IKL + NP D P I P+Y S   D+ T+I
Sbjct: 394 NQWFHPAIPRPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMI 453

Query: 529 EGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCK 588
           + VK  L     +++  +  R  +    + T      DA  E  IR  + TI+HPVGT  
Sbjct: 454 QAVKSNLRFLSGQAWADFVIRPFDPRLRDPT-----DDAAIESYIRDNANTIFHPVGTAS 508

Query: 589 MGPETDSEAVVDPRLRVHGIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQD 645
           M P   S  VVDP L+V G+  LR++D SI+P   + +T  P+ ++G++G+D+IK D
Sbjct: 509 MSPRGASWGVVDPDLKVKGVDGLRIVDGSILPFAPNAHTQGPIYLVGKQGADLIKAD 565
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1306
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.46
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.39
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.35
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.23
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.23
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 99.15
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.13
3dme_A369 Conserved exported protein; structural genomics, P 99.13
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.11
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.11
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.09
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.07
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.06
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.04
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.03
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.0
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.99
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.98
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.97
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.96
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.94
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.93
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.92
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.92
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.92
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.91
3dme_A369 Conserved exported protein; structural genomics, P 98.9
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.9
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.89
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.88
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.87
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.87
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.86
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.86
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.85
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.84
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.84
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.83
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.82
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.8
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.8
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.8
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.79
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.78
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.77
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.77
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.76
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.75
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.75
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.74
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.73
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.71
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.71
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.7
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.67
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.66
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.64
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.61
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.6
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.59
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.57
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.56
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.54
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.52
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.52
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.52
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.52
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.52
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.51
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.51
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.5
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.5
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.49
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.47
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.46
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.46
3atr_A453 Conserved archaeal protein; saturating double bond 98.45
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.45
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.44
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.42
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.42
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.42
2cul_A232 Glucose-inhibited division protein A-related PROT 98.42
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.41
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.4
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.39
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.38
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.36
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.36
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.35
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.32
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.3
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.28
3atr_A453 Conserved archaeal protein; saturating double bond 98.27
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.27
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.26
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.25
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.22
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.22
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.21
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.2
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.19
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.18
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.17
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.17
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.16
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.16
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.16
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.14
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.13
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.11
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.1
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.1
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.09
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.09
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.09
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.09
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.09
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.09
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.08
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.08
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.07
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.05
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.05
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.05
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.04
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.04
2bry_A497 NEDD9 interacting protein with calponin homology a 98.03
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.02
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.02
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.0
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.99
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.97
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.96
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.95
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.95
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.94
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.94
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.92
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.92
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.91
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.9
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.9
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.88
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.85
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.83
2bry_A497 NEDD9 interacting protein with calponin homology a 97.83
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.83
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.82
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.79
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.79
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.79
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.78
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.78
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.77
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.77
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.76
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.76
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.75
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.74
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.74
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.72
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.72
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.7
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.69
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.68
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.68
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.67
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.67
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.67
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.65
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.64
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.64
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.62
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.61
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.61
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.56
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.54
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.54
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.54
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.54
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.53
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.5
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.49
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.48
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.46
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.46
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.41
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.39
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.38
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.35
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.35
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.3
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.29
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.28
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.27
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.26
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.26
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.23
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.22
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.21
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.21
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.19
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.18
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.17
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.14
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.13
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.13
2cul_A232 Glucose-inhibited division protein A-related PROT 97.1
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.06
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.06
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.03
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.03
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.0
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.0
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 96.97
4dna_A463 Probable glutathione reductase; structural genomic 96.97
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 96.94
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 96.94
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.93
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.93
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.92
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.91
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.91
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 96.91
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.9
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.9
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.9
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.9
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.89
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.89
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.89
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.88
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.88
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.87
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.86
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.85
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.84
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.84
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.84
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.82
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.82
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 96.81
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.8
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 96.8
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.79
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.79
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.79
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.78
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.78
4dna_A463 Probable glutathione reductase; structural genomic 96.77
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.75
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.74
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.73
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.73
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.72
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.71
2ywl_A180 Thioredoxin reductase related protein; uncharacter 96.7
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.7
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.7
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.7
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.7
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.68
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.68
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.67
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.66
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.66
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.65
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.64
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.64
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.64
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.63
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.62
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.62
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.62
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.61
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.61
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.59
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.57
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.56
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.56
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.53
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.53
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.52
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.52
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.52
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.51
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.51
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.49
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.49
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.49
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.49
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.47
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.46
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.46
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.46
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.45
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.45
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.44
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.43
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.42
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.42
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.41
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.4
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.39
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.36
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.35
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.34
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.33
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.33
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.32
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.31
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.3
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.3
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.28
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.28
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.24
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.24
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.23
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.23
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.23
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.23
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.22
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.22
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.2
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.19
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.18
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.13
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.12
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.12
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.11
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.06
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.05
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.05
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.04
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.03
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.01
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.95
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.95
1fec_A490 Trypanothione reductase; redox-active center, oxid 95.93
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 95.91
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.89
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 95.86
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.83
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.83
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.81
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.8
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.78
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.78
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 95.73
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 95.72
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.72
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.72
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.64
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 95.62
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.61
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 95.57
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.56
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.56
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 95.51
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 95.5
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.41
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.4
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.39
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.36
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 95.31
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.29
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.28
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.27
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.26
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.25
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.18
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 95.1
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.93
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.87
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 94.79
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 94.78
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.76
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.63
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 94.6
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 94.5
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 94.5
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.5
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 94.19
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 94.04
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 93.89
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 93.83
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 93.79
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 93.77
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 93.4
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.35
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.1
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 92.94
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 92.65
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 92.58
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 92.17
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 91.98
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 86.3
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 85.55
1lss_A140 TRK system potassium uptake protein TRKA homolog; 85.41
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 85.41
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 84.85
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 84.46
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 84.41
1lss_A140 TRK system potassium uptake protein TRKA homolog; 84.3
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 82.4
1id1_A153 Putative potassium channel protein; RCK domain, E. 81.79
1id1_A153 Putative potassium channel protein; RCK domain, E. 80.57
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=5.6e-87  Score=821.86  Aligned_cols=532  Identities=32%  Similarity=0.536  Sum_probs=439.5

Q ss_pred             CccEEEECCChhHHHHHHHHhCCCCCEEEEEcCCCCC--CCCCcchhhHHhhh-cCCCCCccccccCcccccccCCCeee
Q psy1043          79 EYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDE--TDISDVPVLAAYLQ-LSGLDWSYKTEPSSTSCLAMEHNRCN  155 (1306)
Q Consensus        79 ~yDvIIVGsG~aG~~~A~rLae~~G~~VLvLE~G~~~--~~~~~~p~~~~~~~-~~~~~w~~~~~~~~~~~~~~~~~~~~  155 (1306)
                      +|||||||||+|||++|.||||+++++|||||+|+..  .....+|....... ++.++|.|.++|+..    +.++.+.
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~----~~~r~~~   77 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAG----YNGRSIA   77 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGG----GTTCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCC----CCCceEe
Confidence            6999999999999999999999889999999999865  23345666555444 478999999999975    6889999


Q ss_pred             ecCcccccCcccccceEEecCChhhHHHHHhc-CCCCCChhhHHHHHHHhccCCCCCC-------CCCCCCCCCCceeee
Q psy1043         156 WPRGKVVGGSSVLNYMLYVRGNRNDYNHWESL-GNPGWGAAEALYYFKKSEDNRNQYL-------AETPYHNSGGYLTVQ  227 (1306)
Q Consensus       156 ~~~g~~lGGsS~~n~~~~~r~~~~d~~~w~~~-g~~~w~~~~~~~y~~~~e~~~~~~~-------~~~~~~~~~g~l~~~  227 (1306)
                      |+||++|||+|++|+|+|.|+++.||+.|++. |+++|+|++++|||+++|++..+..       .+..+|+.+|++.+.
T Consensus        78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~  157 (566)
T 3fim_B           78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS  157 (566)
T ss_dssp             CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred             ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence            99999999999999999999999999999998 9999999999999999999875421       134678999999999


Q ss_pred             cCCCccHHHHHHHHHHHHc--CCC-CCCCCCCCccceeeecccccCCcccchhhhccccccCCCCeEEEeccEEEEEEec
Q psy1043         228 EAPWHTPLAEAFVRGGEEL--GYE-NRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKVLID  304 (1306)
Q Consensus       228 ~~~~~~~~~~~~~~~~~~~--G~~-~~~~~~~~~~g~~~~~~~~~~g~r~s~~~~~l~~~~~~~nl~I~~~~~V~~I~~d  304 (1306)
                      ...+..++...|.++++++  |++ ..|+|+....|++.++.++.+|.|+++..+||.++.+++|++|++++.|+||+++
T Consensus       158 ~~~~~~~~~~~~~~a~~~~~~G~~~~~d~n~~~~~G~~~~~~~~~~g~R~sa~~ayL~p~~~r~NL~Vlt~a~V~rIl~~  237 (566)
T 3fim_B          158 LPGFPTPLDDRVLATTQEQSEEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS  237 (566)
T ss_dssp             SCSSCCTHHHHHHHHHHHTHHHHCBCSCGGGSCCCEEEECCBSEETTEECCHHHHTHHHHTTCTTEEEESSCEEEEEECC
T ss_pred             cCCCCCHHHHHHHHHHHHHhcCCCccCCCCCCCcceEEeeeeecCCCEEcCHHHHHhhhhccCCCeEEECCCEEEEEEee
Confidence            9988899999999999999  998 5688888889999999888899999999999999989999999999999999998


Q ss_pred             ---CCCCeEEEEEEEeC-C-eEEEEEEcceEEEccCCCCcHHHHHHhCCCCcccccccCCCceeccc-cccccccccCCc
Q psy1043         305 ---PKNRMAIGVEFVKN-H-QRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLK-VGYNLQDHVGLG  378 (1306)
Q Consensus       305 ---~~~~~~~GV~~~~~-g-~~~~v~A~k~VVLaAGai~Sp~LLl~SGiG~~~~L~~~gI~~~~dlp-VG~nL~dH~~~~  378 (1306)
                         ++.++|+||++... + +.++|+|+||||||||+|+||+|||+|||||+++|+++||+++.||| ||+|||||+.+.
T Consensus       238 ~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH~~~~  317 (566)
T 3fim_B          238 GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDHLLLP  317 (566)
T ss_dssp             EEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCCEEEC
T ss_pred             cCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcCccce
Confidence               22248999999874 5 77889999999999999999999999999999999999999999999 999999998755


Q ss_pred             eEEEEecCCcccchhhhhhHHHHHhhhhcCCCCccccCCcchhhHHHHHHHHHcCCCCcccCCcceEEEEeecCCCCC--
Q psy1043         379 GFTFLINQPISLVQDRLESVQSVLNYAMMGNGPLTVMGGDRLESVQSVLNYAMMGNGPLTVMGGVEGLAFVNTKYASD--  456 (1306)
Q Consensus       379 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gp~~~~~~~~~~~~~~~~~~~~~~~G~l~~~~~~~~~~~~~~~~~~~--  456 (1306)
                      . .|..+.+..... .+...                     ......+.+|...+.||++..+ .+..+|.++.....  
T Consensus       318 ~-~~~~~~~~~~~~-~~~~~---------------------~~~~~~~~~~~~~~~G~l~~~~-~~~~~f~~~~~~~~~~  373 (566)
T 3fim_B          318 A-AFFVNSNQTFDN-IFRDS---------------------SEFNVDLDQWTNTRTGPLTALI-ANHLAWLRLPSNSSIF  373 (566)
T ss_dssp             C-EEEESCSCSSGG-GGTCH---------------------HHHHHHHHHHHHHSCSGGGCCS-CSEEEEECCCTTCGGG
T ss_pred             E-EEEeCCCcccch-hhcCh---------------------HHHHHHHHHHHhcCCCCcccCh-hhheeeeccccchhhh
Confidence            4 566655432110 00000                     0112345778889999998654 56778876542100  


Q ss_pred             ----------CchhhHhhcCCchhhhhcccCCcCCCCeEEEEeecCCcCceeEEEeccCCCCCCCeeecCCCCChhhHHH
Q psy1043         457 ----------GGNQIRKAHGLREDFYDEVYGPINNKDVWSAIPMLLRPRSRGRIKLRSRNPLDYPRIQPEYFSDHHDMLT  526 (1306)
Q Consensus       457 ----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~p~srg~v~l~~~d~~~~p~i~~~y~~~~~D~~~  526 (1306)
                                ....+...  +........+........+++...+++|.|||+|+|+++||++.|.|++||+.++.|++.
T Consensus       374 ~~~~~~~~~~~~pd~~~~--~~~~~~~~~~~~~~~~~~~~~~~~l~~P~SrG~V~L~s~dp~~~P~i~~~yl~~~~D~~~  451 (566)
T 3fim_B          374 QTFPDPAAGPNSAHWETI--FSNQWFHPAIPRPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFT  451 (566)
T ss_dssp             GTSCCCSSSTTSCSEEEE--EESSCCCTTSCCCSSCCEEEEEEEESSCSCCBEEECSSSCTTSCCEEECCTTCSHHHHHH
T ss_pred             hhhccccccCCCCCEEEE--ecccchhhcccCCCCCCEEEEEEeecCCccceEEEecCCCCCCCceeccccCCCccHHHH
Confidence                      00000000  000000000111122357788899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHcCcchhhcccccccCCCCCCCCCCCCCHHHHHHHHHhccCCCccccccccccCCCCCCCccCCCCcee
Q psy1043         527 LIEGVKIILELSKTRSFRQYESRFHNIPFPNCTHIPMYTDAYYECMIRHYSVTIYHPVGTCKMGPETDSEAVVDPRLRVH  606 (1306)
Q Consensus       527 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~t~~H~~GT~rMG~~~d~~sVVD~~~rV~  606 (1306)
                      ++++++.+++++++++++.+.....   .|++  ....+|++|+||+|....+.+|++||||||++++.++|||++||||
T Consensus       452 ~~~~~~~~~~i~~~~~~~~~~~~~~---~P~~--~~~~sd~~~~~~ir~~~~t~~H~~GTc~Mg~~~~~~~VVD~~lrV~  526 (566)
T 3fim_B          452 MIQAVKSNLRFLSGQAWADFVIRPF---DPRL--RDPTDDAAIESYIRDNANTIFHPVGTASMSPRGASWGVVDPDLKVK  526 (566)
T ss_dssp             HHHHHHHHHHHHTSGGGTTTEEEES---SGGG--SCTTCHHHHHHHHHHHCEECSCCBCTTCBCCTTCSSCSBCTTCBBT
T ss_pred             HHHHHHHHHHHHhCcccCCcccccc---CCCc--ccccchHHHHHHHhhcccccccccCccccCCcccCCccCCCCCeEc
Confidence            9999999999999999988754322   2321  2467999999999999999999999999998886559999999999


Q ss_pred             ccCCcEEeeccCCCCCCCccchHHHHHHHHHHHHHHHHh
Q psy1043         607 GIGNLRVIDASIMPTIVSGNTNAPVIMIGEKGSDMIKQD  645 (1306)
Q Consensus       607 gv~NL~V~DaSv~Pt~~~~NP~lTi~alAeraAd~I~~~  645 (1306)
                      |++||||||+||||+++++||++|+||||||+||+|+++
T Consensus       527 Gv~~LrVvDaSv~P~~~~~n~~~~~~~iaekaAd~I~~~  565 (566)
T 3fim_B          527 GVDGLRIVDGSILPFAPNAHTQGPIYLVGKQGADLIKAD  565 (566)
T ss_dssp             TCBSEEECSGGGCCSCCSSCTHHHHHHHHHHHHHHHHHT
T ss_pred             cCCCcEEcccccCCCCCCcCcHHHHHHHHHHHHHHHhhc
Confidence            999999999999999999999999999999999999975
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1306
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-65
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-52
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 3e-16
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-15
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 9e-63
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 7e-49
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 8e-22
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 2e-20
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 2e-61
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 4e-36
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 4e-49
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-45
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-14
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-13
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 3e-45
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 1e-41
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 9e-45
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 5e-34
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 6e-20
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 2e-19
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-39
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 3e-36
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 2e-27
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 1e-26
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 4e-27
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 9e-27
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 1e-21
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 3e-18
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 7e-15
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 2e-12
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 4e-07
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-06
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 4e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 6e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-05
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 4e-05
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 4e-04
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 5e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 0.004
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 9e-05
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 0.003
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 2e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-04
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.004
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 4e-04
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 4e-04
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 6e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 0.001
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.001
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.001
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.002
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 0.001
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.001
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 0.002
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.002
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 0.003
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.003
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 0.004
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 0.004
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]

 Score =  225 bits (574), Expect = 1e-65
 Identities = 84/320 (26%), Positives = 133/320 (41%), Gaps = 28/320 (8%)

Query: 79  EYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETD---ISDVPVLAAYLQLSGLDW 135
            YD+I+ G G  G  VA +L+E    K+L++E G  E++   I + P     +  + +D 
Sbjct: 24  TYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQ 83

Query: 136 SYKTEPSSTSCLAMEHNRCNWPRGKVVGGSSVLNYMLYVRGNRNDYNHWES-LGNPGWGA 194
           +Y T P       + +   N   GK +GGS+++N   + R ++   + WE   G  GW  
Sbjct: 84  NYLTVP------LINNRTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNW 137

Query: 195 AEALYYFKKSEDNRNQYLA--------ETPYHNSGGYLTV---QEAPWHTPLAEAFVRGG 243
                Y KK+E  R    A            H + G +           +P+ +A +   
Sbjct: 138 DNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGARDNGQPWSPIMKALMNTV 197

Query: 244 EELG--YENRDINGEYQTGFMVAQGTVRNGARCSTSKAFLQPVKTRPNLHISLHSHVTKV 301
             LG   +   + G  +   M+      N  R   ++A+L P   R NL I     V KV
Sbjct: 198 SALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPNYQRSNLEILTGQMVGKV 257

Query: 302 LIDPK--NRMAIGVEFVKNH-QRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMG 358
           L         A+GV F  N      + A+ EV+L+ G+  SP IL  SGIG K  L    
Sbjct: 258 LFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGLKSVLDQAN 317

Query: 359 IKTIQDLK--VGYNLQDHVG 376
           +  + DL   +   +   +G
Sbjct: 318 VTQLLDLPVGICSMMSRELG 337
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1306
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.98
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.97
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.96
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.56
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.52
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.49
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.49
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.44
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.4
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.38
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 99.38
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.36
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.36
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.35
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.35
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.32
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.32
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.3
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.27
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.26
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.21
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.2
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.2
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.2
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.19
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.18
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.17
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.16
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.13
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.1
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.1
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.09
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.07
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.05
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.03
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.01
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.98
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.94
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.89
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.87
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.78
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.78
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.62
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.6
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.52
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 98.51
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.41
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.35
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.24
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.17
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.13
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.08
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.03
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.99
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.97
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.95
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.92
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.91
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.9
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.89
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.88
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.86
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.85
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.85
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.85
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.84
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.78
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.78
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.78
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.76
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.75
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.74
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.74
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.73
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.72
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.68
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.68
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.67
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.66
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.62
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.6
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.6
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.57
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.53
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.51
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.5
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.48
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.48
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.47
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.46
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.44
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.44
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.43
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.43
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.43
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.42
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.42
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.37
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.36
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.35
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.34
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.32
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.31
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.29
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.28
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.27
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.26
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.24
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.24
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.23
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.22
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.21
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.21
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.2
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.18
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.18
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.18
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.16
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.13
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.13
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.13
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.12
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.08
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.08
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.07
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.05
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.05
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.04
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.02
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.98
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.97
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.92
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.84
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.83
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.82
d2f5va2198 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.7
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.7
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.69
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.61
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.58
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.55
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.46
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.25
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.1
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.08
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.96
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.77
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.75
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.48
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.42
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.22
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.21
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.15
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.13
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.11
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.93
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.92
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.8
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.68
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.63
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.32
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.07
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.0
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.98
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.96
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.39
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.37
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 93.34
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.29
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.06
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.88
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.17
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.98
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.83
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.44
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.33
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.98
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.95
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.75
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.46
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.36
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.08
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.93
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.55
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 88.48
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.12
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.99
d2f5va2198 Pyranose 2-oxidase {White-rot fungus (Peniophora s 87.92
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 87.76
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 87.56
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.01
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 86.68
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 86.56
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 85.6
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 85.51
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 84.39
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 82.57
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 82.2
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 81.98
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 81.79
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 81.04
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 80.6
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

Probab=100.00  E-value=7.3e-54  Score=507.23  Aligned_cols=286  Identities=29%  Similarity=0.451  Sum_probs=235.6

Q ss_pred             CCccEEEECCChhHHHHHHHHhCCCCCEEEEEcCCCCCCCCC---cchhhHHhhhcCCCCCccccccCcccccccCCCee
Q psy1043          78 PEYDFIVVGAGSAGAVVANRLSEIENWKILLLEAGGDETDIS---DVPVLAAYLQLSGLDWSYKTEPSSTSCLAMEHNRC  154 (1306)
Q Consensus        78 ~~yDvIIVGsG~aG~~~A~rLae~~G~~VLvLE~G~~~~~~~---~~p~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~  154 (1306)
                      ++|||||||||++||++|.||||+++++|||||||+......   ..|.....+..+..+|.|.+.++.     +.++.+
T Consensus        16 ~tyD~IIVGsG~aG~vlA~rLse~~~~~VLvLEaG~~~~~~~~~~~~~~~~~~~~~~~~dw~~~t~~~~-----~~~r~~   90 (385)
T d1cf3a1          16 RTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGPIIEDLNAYGDIFGSSVDHAYETVELA-----TNNQTA   90 (385)
T ss_dssp             CEEEEEEECCSHHHHHHHHHHTTSTTCCEEEEESSCCCTTSCHHHHBGGGTTTTTTSTTBCCEECCCCT-----TTSCCC
T ss_pred             CeEEEEEECcCHHHHHHHHHHHHCCCCeEEEECCCCCCCCCCccccCHhHHhhhcCCCCCcCccccCcC-----CCCcee
Confidence            579999999999999999999997679999999998644322   223344445567889999887653     578889


Q ss_pred             eecCcccccCcccccceEEecCChhhHHHHHhc-CCCCCChhhHHHHHHHhccCCCCC--------CCCCCCCCCCCcee
Q psy1043         155 NWPRGKVVGGSSVLNYMLYVRGNRNDYNHWESL-GNPGWGAAEALYYFKKSEDNRNQY--------LAETPYHNSGGYLT  225 (1306)
Q Consensus       155 ~~~~g~~lGGsS~~n~~~~~r~~~~d~~~w~~~-g~~~w~~~~~~~y~~~~e~~~~~~--------~~~~~~~~~~g~l~  225 (1306)
                      .|++|++|||+|.+|+|+|+|+.+.||+.|... +..+|+|++++|||+++|.+..+.        ..+..+++..+++.
T Consensus        91 ~~~~G~~lGGsS~in~~~~~R~~~~d~d~w~~~~~~~gw~~~~l~Pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~~~~  170 (385)
T d1cf3a1          91 LIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVH  170 (385)
T ss_dssp             EECCBCSTTGGGGTSCCBCCCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHHEEECCCCHHHHHHTCCCCGGGSCSSSSEE
T ss_pred             eecccccccccceeeeeeeeccChhhhcccccccCCCcCchhhhHHHHHHHHhhcCCCcccccccccccccccCCccccc
Confidence            999999999999999999999999999999986 678999999999999999886542        12345677777777


Q ss_pred             eecC---CCccHHHHHHHHHHHHcCCC-CCCCCCCCccceeeecccccC-CcccchhhhccccccCCCCeEEEeccEEEE
Q psy1043         226 VQEA---PWHTPLAEAFVRGGEELGYE-NRDINGEYQTGFMVAQGTVRN-GARCSTSKAFLQPVKTRPNLHISLHSHVTK  300 (1306)
Q Consensus       226 ~~~~---~~~~~~~~~~~~~~~~~G~~-~~~~~~~~~~g~~~~~~~~~~-g~r~s~~~~~l~~~~~~~nl~I~~~~~V~~  300 (1306)
                      +...   ....++.+.|.++++++|++ ..+.|+....+++.++..... ..+.++...|+.++.+++|++|++++.|++
T Consensus       171 ~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~d~n~~~~~~~~~~~~~~~~~~~~~~s~~~~~~p~~~~~nl~i~t~~~V~r  250 (385)
T d1cf3a1         171 AGPRDTGDDYSPIVKALMSAVEDRGVPTKKDFGCGDPHGVSMFPNTLHEDQVRSDAAREWLLPNYQRPNLQVLTGQYVGK  250 (385)
T ss_dssp             EBCCCCSSCBCTHHHHHHHHHHTTTCCBCCCTTSSCCCEEECCCBSBCTTCBBCCHHHHHTGGGTTCTTEEEEESCEEEE
T ss_pred             ccccccccccCHHHHHHHHHHHHcCCCCcCCcccccccccccccccccccccchhhhhhhcCchhcCCcccccCCceEEE
Confidence            6543   34468899999999999998 567887777777666555443 344456778898999999999999999999


Q ss_pred             EEecCCC--CeEEEEEEE-eCCeEEEEEEcceEEEccCCCCcHHHHHHhCCCCcccccccCCCceeccccc
Q psy1043         301 VLIDPKN--RMAIGVEFV-KNHQRHVIRARKEVILSGGAVNSPQILMLSGIGPKDHLTDMGIKTIQDLKVG  368 (1306)
Q Consensus       301 I~~d~~~--~~~~GV~~~-~~g~~~~v~A~k~VVLaAGai~Sp~LLl~SGiG~~~~L~~~gI~~~~dlpVG  368 (1306)
                      |++++++  .+++||++. .+++.++++|+||||||||+|+||+|||+|||||+++|+++||+++.|+|||
T Consensus       251 I~~~~~~~~~ra~GV~~~~~~g~~~~v~A~keVILsAGAi~SP~LLl~SGIGp~~~L~~~gI~~~~dlP~g  321 (385)
T d1cf3a1         251 VLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGMKSILEPLGIDTVVDLPVG  321 (385)
T ss_dssp             EEEECSSSSCEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTBSCHHHHGGGTCCCSBCCCTT
T ss_pred             EEEcCCCceeEEEEEEEEcCCCCEEEEEeCCEEEEcCchhhCHHHHHhcCCCcHHHHHHCCCCeEEECCcc
Confidence            9998653  389999986 4788899999999999999999999999999999999999988877776644
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f5va2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2f5va2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure