Psyllid ID: psy10440
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 328697856 | 592 | PREDICTED: dihydrolipoyllysine-residue a | 1.0 | 0.108 | 0.812 | 2e-22 | |
| 242011723 | 539 | Lipoamide acyltransferase component of b | 1.0 | 0.118 | 0.812 | 3e-21 | |
| 321479230 | 474 | hypothetical protein DAPPUDRAFT_299977 [ | 1.0 | 0.135 | 0.75 | 1e-20 | |
| 322790253 | 618 | hypothetical protein SINV_09465 [Solenop | 0.921 | 0.095 | 0.813 | 3e-20 | |
| 332024671 | 585 | Dihydrolipoyllysine-residue acetyltransf | 0.921 | 0.100 | 0.779 | 1e-19 | |
| 350417800 | 601 | PREDICTED: dihydrolipoyllysine-residue a | 0.921 | 0.098 | 0.762 | 6e-19 | |
| 307183310 | 588 | Dihydrolipoyllysine-residue acetyltransf | 0.921 | 0.100 | 0.745 | 9e-19 | |
| 391342826 | 464 | PREDICTED: pyruvate dehydrogenase protei | 0.875 | 0.120 | 0.767 | 1e-18 | |
| 380019888 | 621 | PREDICTED: LOW QUALITY PROTEIN: dihydrol | 0.921 | 0.095 | 0.762 | 1e-18 | |
| 340729384 | 597 | PREDICTED: LOW QUALITY PROTEIN: dihydrol | 0.921 | 0.098 | 0.745 | 2e-18 |
| >gi|328697856|ref|XP_001945646.2| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 109 bits (272), Expect = 2e-22, Method: Compositional matrix adjust.
Identities = 52/64 (81%), Positives = 58/64 (90%)
Query: 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTT 60
MPSLSPTMTEG IVKWLKKEGD ++ GDVLCEIQTDKAVMSFETEEEG+LAKILVP++
Sbjct: 50 MPSLSPTMTEGNIVKWLKKEGDKISAGDVLCEIQTDKAVMSFETEEEGVLAKILVPDDAK 109
Query: 61 DGKV 64
+ KV
Sbjct: 110 EIKV 113
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242011723|ref|XP_002426596.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Pediculus humanus corporis] gi|212510745|gb|EEB13858.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321479230|gb|EFX90186.1| hypothetical protein DAPPUDRAFT_299977 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|322790253|gb|EFZ15252.1| hypothetical protein SINV_09465 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332024671|gb|EGI64864.1| Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350417800|ref|XP_003491601.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307183310|gb|EFN70179.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|391342826|ref|XP_003745716.1| PREDICTED: pyruvate dehydrogenase protein X component-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|380019888|ref|XP_003693833.1| PREDICTED: LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340729384|ref|XP_003402984.1| PREDICTED: LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| UNIPROTKB|Q0C0R7 | 470 | pdhB "Pyruvate dehydrogenase c | 1.0 | 0.136 | 0.656 | 1.1e-17 | |
| UNIPROTKB|E9PLU0 | 151 | PDHX "Pyruvate dehydrogenase p | 0.921 | 0.390 | 0.677 | 1.2e-17 | |
| TIGR_CMR|SPO_2242 | 437 | SPO_2242 "pyruvate dehydrogena | 1.0 | 0.146 | 0.656 | 2.5e-17 | |
| SGD|S000005015 | 482 | LAT1 "Dihydrolipoamide acetylt | 0.953 | 0.126 | 0.639 | 6.9e-17 | |
| UNIPROTKB|E9PB14 | 486 | PDHX "Pyruvate dehydrogenase p | 0.921 | 0.121 | 0.677 | 7.1e-17 | |
| UNIPROTKB|F1SGT3 | 500 | PDHX "Uncharacterized protein" | 0.921 | 0.118 | 0.677 | 7.6e-17 | |
| UNIPROTKB|P22439 | 501 | PDHX "Pyruvate dehydrogenase p | 0.921 | 0.117 | 0.677 | 7.6e-17 | |
| UNIPROTKB|E2RM20 | 501 | PDHX "Uncharacterized protein" | 0.921 | 0.117 | 0.677 | 7.6e-17 | |
| UNIPROTKB|O00330 | 501 | PDHX "Pyruvate dehydrogenase p | 0.921 | 0.117 | 0.677 | 7.6e-17 | |
| TAIR|locus:2020173 | 539 | AT1G54220 [Arabidopsis thalian | 1.0 | 0.118 | 0.640 | 9e-17 |
| UNIPROTKB|Q0C0R7 pdhB "Pyruvate dehydrogenase complex, E1 component, pyruvate dehydrogenase, beta subunit" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
Score = 222 (83.2 bits), Expect = 1.1e-17, P = 1.1e-17
Identities = 42/64 (65%), Positives = 51/64 (79%)
Query: 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTT 60
MP+LSPTM EGT+ KWLKKEGDA+ GDV+ EI+TDKA M E +EG+LAKI+VPE T
Sbjct: 7 MPALSPTMEEGTLSKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKIVVPEGTE 66
Query: 61 DGKV 64
+ KV
Sbjct: 67 NVKV 70
|
|
| UNIPROTKB|E9PLU0 PDHX "Pyruvate dehydrogenase protein X component, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2242 SPO_2242 "pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005015 LAT1 "Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PB14 PDHX "Pyruvate dehydrogenase protein X component, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGT3 PDHX "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22439 PDHX "Pyruvate dehydrogenase protein X component" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RM20 PDHX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00330 PDHX "Pyruvate dehydrogenase protein X component, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020173 AT1G54220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 3e-30 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 3e-29 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 1e-26 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 9e-26 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 5e-25 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 1e-21 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 9e-18 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 2e-14 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 7e-14 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 1e-13 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 4e-12 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 2e-09 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 4e-09 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-08 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 3e-08 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-07 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 7e-07 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 4e-06 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 2e-05 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 6e-05 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 7e-05 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 4e-04 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 4e-04 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 7e-04 | |
| pfam02749 | 88 | pfam02749, QRPTase_N, Quinolinate phosphoribosyl t | 0.001 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 0.002 | |
| cd01572 | 268 | cd01572, QPRTase, Quinolinate phosphoribosyl trans | 0.003 |
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
Score = 108 bits (273), Expect = 3e-30
Identities = 42/64 (65%), Positives = 47/64 (73%)
Query: 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTT 60
MP+LSPTM EGT+ KWLKKEGD V GDV+ EI+TDKA M E +EG L KILVPE T
Sbjct: 7 MPALSPTMEEGTLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAVDEGTLGKILVPEGTE 66
Query: 61 DGKV 64
KV
Sbjct: 67 GVKV 70
|
Length = 464 |
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217214 pfam02749, QRPTase_N, Quinolinate phosphoribosyl transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|238806 cd01572, QPRTase, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.79 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 99.79 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.77 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.74 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.74 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.7 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.7 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 99.7 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.69 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 99.68 | |
| KOG0557|consensus | 470 | 99.66 | ||
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.65 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.61 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.59 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.59 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.59 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 99.59 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 99.59 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.57 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.54 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 99.53 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.53 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 99.52 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.51 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.51 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.48 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.48 | |
| KOG0559|consensus | 457 | 99.46 | ||
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.45 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.4 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.4 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.4 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.38 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.38 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.38 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.35 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.35 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.33 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 99.3 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.29 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 99.2 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 99.17 | |
| KOG0558|consensus | 474 | 99.13 | ||
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 99.12 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 99.1 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 99.1 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 99.01 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.99 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 98.95 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 98.85 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 98.82 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 98.73 | |
| KOG0369|consensus | 1176 | 98.68 | ||
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 98.67 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 98.4 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 98.39 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 98.39 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 98.36 | |
| KOG0238|consensus | 670 | 98.36 | ||
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 98.35 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 98.35 | |
| KOG0368|consensus | 2196 | 98.27 | ||
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 98.15 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 98.13 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 98.12 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 98.08 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 98.06 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 98.03 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.87 | |
| KOG3373|consensus | 172 | 97.76 | ||
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.63 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 97.62 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 97.5 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.36 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 97.35 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 97.33 | |
| PRK06748 | 83 | hypothetical protein; Validated | 97.3 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 97.27 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 97.23 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 97.2 | |
| PRK07051 | 80 | hypothetical protein; Validated | 97.2 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 97.18 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.15 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 97.14 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 97.12 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 97.1 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 97.1 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 97.02 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 96.98 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 96.95 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 96.93 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 96.87 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 96.81 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 96.81 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 96.77 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 96.7 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.66 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 96.61 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 96.58 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 96.58 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.52 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 96.46 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.24 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.2 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 96.16 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.06 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 95.78 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 95.65 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 95.64 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 95.53 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 95.51 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 95.46 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 95.44 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 95.39 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 95.35 | |
| PF02749 | 88 | QRPTase_N: Quinolinate phosphoribosyl transferase, | 95.15 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 94.97 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 94.84 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 94.58 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 94.33 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 93.98 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 93.95 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 93.94 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 93.94 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 93.75 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 93.72 | |
| KOG0559|consensus | 457 | 93.39 | ||
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 93.23 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 93.03 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 93.01 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 92.59 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 92.25 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 91.8 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 91.6 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 91.42 | |
| COG0157 | 280 | NadC Nicotinate-nucleotide pyrophosphorylase [Coen | 91.35 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 91.32 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 91.31 | |
| PRK02597 | 1331 | rpoC2 DNA-directed RNA polymerase subunit beta'; P | 91.06 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 90.44 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 90.32 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 89.98 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 89.96 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 89.77 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 89.76 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 89.31 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 89.25 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 89.12 | |
| cd01572 | 268 | QPRTase Quinolinate phosphoribosyl transferase (QA | 88.96 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 88.89 | |
| PF01551 | 96 | Peptidase_M23: Peptidase family M23; InterPro: IPR | 88.73 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 87.77 | |
| PRK06543 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 87.73 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 87.73 | |
| PRK06096 | 284 | molybdenum transport protein ModD; Provisional | 87.56 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 87.54 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 87.49 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 87.39 | |
| PRK09016 | 296 | quinolinate phosphoribosyltransferase; Validated | 87.3 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 87.19 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 87.01 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 86.98 | |
| CHL00117 | 1364 | rpoC2 RNA polymerase beta'' subunit; Reviewed | 86.98 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 86.78 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.76 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.74 | |
| PRK06106 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.35 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 86.18 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.12 | |
| PLN02716 | 308 | nicotinate-nucleotide diphosphorylase (carboxylati | 86.02 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.01 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 85.94 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 85.69 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 85.2 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 85.19 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 85.11 | |
| TIGR02643 | 437 | T_phosphoryl thymidine phosphorylase. Thymidine ph | 84.83 | |
| PRK05820 | 440 | deoA thymidine phosphorylase; Reviewed | 84.6 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 84.17 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 83.99 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 83.95 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 83.79 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 83.78 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 83.77 | |
| TIGR02645 | 493 | ARCH_P_rylase putative thymidine phosphorylase. Me | 83.72 | |
| TIGR02644 | 405 | Y_phosphoryl pyrimidine-nucleoside phosphorylase. | 83.48 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 83.3 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 83.01 | |
| PRK06078 | 434 | pyrimidine-nucleoside phosphorylase; Reviewed | 82.97 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 82.68 | |
| TIGR02876 | 382 | spore_yqfD sporulation protein YqfD. YqfD is part | 82.55 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 82.46 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 82.23 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 81.79 | |
| TIGR02388 | 1227 | rpoC2_cyan DNA-directed RNA polymerase, beta'' sub | 81.2 | |
| PRK10871 | 319 | nlpD lipoprotein NlpD; Provisional | 80.96 | |
| PRK04350 | 490 | thymidine phosphorylase; Provisional | 80.31 |
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
Probab=99.79 E-value=3.3e-19 Score=96.35 Aligned_cols=62 Identities=48% Similarity=0.686 Sum_probs=58.3
Q ss_pred CCCCCCCCCeEEEEEEEcCCCCEEcCCCeEEEEecCceEEEEecCCCeEEEEEecCCCCcccc
Q psy10440 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDGK 63 (64)
Q Consensus 1 ~p~~~~~~~~g~i~~w~v~~G~~V~~g~~l~~ie~~k~~~~i~ap~~G~i~~~~~~~g~~~v~ 63 (64)
+|.++....++++.+|++++|+.|++||+|+.+|++|+..+|+||.+|+|.++++++|+. |.
T Consensus 5 ~P~~G~~~~~~~i~~~~v~~G~~V~~G~~l~~iet~K~~~~v~a~~~G~i~~i~v~~G~~-V~ 66 (74)
T PF00364_consen 5 APMLGEVMEEGTITKWLVEEGDKVKKGDPLAEIETMKMEMEVEAPVSGIIKEILVEEGDT-VE 66 (74)
T ss_dssp ESSSSEEEEEEEEEEESSSTTEEESTTSEEEEEESSSEEEEEEBSSSEEEEEESSTTTEE-EE
T ss_pred CCCCccEEEecceeEEEECCCCEEEcCceEEEEEcCccceEEECCCCEEEEEEEECCCCE-EC
Confidence 588888888899999999999999999999999999999999999999999999999984 64
|
Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme []. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group []. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus).; PDB: 2EJG_D 2D5D_A 2EJF_C 2EVB_A 1IYV_A 1IYU_A 1LAC_A 1LAB_A 1DCZ_A 1DD2_A .... |
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >KOG0557|consensus | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG0558|consensus | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG3373|consensus | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK02597 rpoC2 DNA-directed RNA polymerase subunit beta'; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF01551 Peptidase_M23: Peptidase family M23; InterPro: IPR016047 Members of this family are zinc metallopeptidases with a range of specificities | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PRK06096 molybdenum transport protein ModD; Provisional | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
| >PRK09016 quinolinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >TIGR02643 T_phosphoryl thymidine phosphorylase | Back alignment and domain information |
|---|
| >PRK05820 deoA thymidine phosphorylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02645 ARCH_P_rylase putative thymidine phosphorylase | Back alignment and domain information |
|---|
| >TIGR02644 Y_phosphoryl pyrimidine-nucleoside phosphorylase | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR02876 spore_yqfD sporulation protein YqfD | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >TIGR02388 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit | Back alignment and domain information |
|---|
| >PRK10871 nlpD lipoprotein NlpD; Provisional | Back alignment and domain information |
|---|
| >PRK04350 thymidine phosphorylase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 64 | ||||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 3e-18 | ||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 8e-18 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 6e-16 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 7e-16 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 3e-15 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 1e-14 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 5e-09 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 6e-09 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 7e-07 | ||
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 9e-06 | ||
| 1k8o_A | 93 | Solution Structure Of The Lipoic Acid-Bearing Domai | 5e-05 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 3e-04 |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
|
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
| >pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 | Back alignment and structure |
| >pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-34 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 7e-34 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-33 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 8e-32 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 4e-29 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-16 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 4e-14 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 4e-14 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 1e-13 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 3e-13 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 5e-07 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 1e-06 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 4e-04 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 4e-04 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 6e-04 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 7e-04 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 7e-04 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 7e-04 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 7e-04 |
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
Score = 112 bits (281), Expect = 2e-34
Identities = 37/64 (57%), Positives = 49/64 (76%)
Query: 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTT 60
+P+LSPTMT GT+ +W KK G+ ++ GD+L EI+TDKA + FE +EEG LAKILVPE T
Sbjct: 32 LPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTR 91
Query: 61 DGKV 64
D +
Sbjct: 92 DVPL 95
|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Length = 285 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Length = 287 | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Length = 320 | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Length = 273 | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Length = 300 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.79 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.78 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.78 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.77 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.76 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.75 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.73 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.71 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.69 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.67 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.67 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.66 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.66 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.56 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.54 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.51 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.49 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.47 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.47 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.44 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.44 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.43 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.43 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.38 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.35 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.29 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 99.24 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 99.17 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 99.17 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 99.14 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 99.13 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 99.12 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 99.12 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 98.98 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 98.91 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 98.87 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 98.81 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 98.52 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 98.52 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.49 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 98.42 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 98.28 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.9 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 97.75 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 97.64 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 97.55 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 97.19 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 97.16 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 96.81 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 96.71 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.59 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 96.53 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 96.44 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 96.43 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 96.22 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 96.2 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.09 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 96.06 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 95.83 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 95.61 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 95.51 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 95.42 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 95.37 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 95.2 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 95.2 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 94.97 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 94.49 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 94.48 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 94.43 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 94.28 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 93.98 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 93.68 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 93.6 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 92.93 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 92.87 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 92.16 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 91.8 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 91.72 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 91.51 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 91.06 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 90.83 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 90.82 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 90.68 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 90.44 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 90.37 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 89.82 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 89.58 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 89.54 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 89.49 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 89.43 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 88.96 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 88.8 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 88.75 | |
| 3gnn_A | 298 | Nicotinate-nucleotide pyrophosphorylase; decode bi | 88.58 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 88.26 | |
| 3it5_A | 182 | Protease LASA; metallopeptidase, beta-protein, cel | 88.18 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 88.12 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 87.71 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 86.29 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 86.29 | |
| 1brw_A | 433 | PYNP, protein (pyrimidine nucleoside phosphorylase | 84.7 | |
| 2dsj_A | 423 | Pyrimidine-nucleoside (thymidine) phosphorylase; p | 84.43 | |
| 3tuf_B | 245 | Stage II sporulation protein Q; intercellular sign | 84.39 | |
| 2hsi_A | 282 | Putative peptidase M23; structural genomics, PSI, | 83.77 | |
| 3lu0_D | 1407 | DNA-directed RNA polymerase subunit beta'; E. coli | 83.65 | |
| 1uou_A | 474 | Thymidine phosphorylase; transferase, glycosyltran | 83.11 | |
| 3h5q_A | 436 | PYNP, pyrimidine-nucleoside phosphorylase; structu | 83.04 | |
| 1qwy_A | 291 | Peptidoglycan hydrolase; LYTM lysostaphin metallop | 82.98 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 80.73 | |
| 3nyy_A | 252 | Putative glycyl-glycine endopeptidase LYTM; struct | 80.54 |
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
Probab=99.79 E-value=1e-18 Score=95.72 Aligned_cols=59 Identities=59% Similarity=0.973 Sum_probs=57.6
Q ss_pred CCCCCCCCCeEEEEEEEcCCCCEEcCCCeEEEEecCceEEEEecCCCeEEEEEecCCCC
Q psy10440 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENT 59 (64)
Q Consensus 1 ~p~~~~~~~~g~i~~w~v~~G~~V~~g~~l~~ie~~k~~~~i~ap~~G~i~~~~~~~g~ 59 (64)
+|.++.++.+|+|.+|++++||.|++||.|+++|++|+..+|+||++|+|.++++++|+
T Consensus 10 ~P~lg~~~~~G~v~~~~v~~Gd~V~~G~~l~~ie~~k~~~~i~Ap~~G~v~~~~v~~G~ 68 (87)
T 3crk_C 10 LPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDXATIGFEVQEEGYLAKILVPEGT 68 (87)
T ss_dssp CCCSSTTCCEEEEEEECSCTTCEECTTCEEEEEECSSCEEEEECCSCEEEEEESSCTTC
T ss_pred CCCCCCCCCcEEEEEEEcCCCCEEcCCCEEEEEECCcccceeecCcCcEEEEEEECCCC
Confidence 68999999999999999999999999999999999999999999999999999999997
|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell out membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa} PDB: 3it7_A* | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 | Back alignment and structure |
|---|
| >2dsj_A Pyrimidine-nucleoside (thymidine) phosphorylase; pyrimidine-nucleoside phosphorylase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tuf_B Stage II sporulation protein Q; intercellular signalling, intercellular channel, sporulation engulfment and signalling, intercellular space; 2.26A {Bacillus subtilis} PDB: 3uz0_B | Back alignment and structure |
|---|
| >2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* | Back alignment and structure |
|---|
| >1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A | Back alignment and structure |
|---|
| >3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-17 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 3e-17 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-16 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 6e-16 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-15 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-12 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 7e-11 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-10 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 1e-09 | |
| d1vf7a_ | 237 | f.46.1.1 (A:) Multidrug resistance protein MexA do | 0.004 |
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Lipoyl domain of the 2-oxoglutarate dehydrogenase complex species: Escherichia coli [TaxId: 562]
Score = 66.7 bits (163), Expect = 2e-17
Identities = 25/60 (41%), Positives = 35/60 (58%)
Query: 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTT 60
+P L ++ + T+ W KK GDAV +VL EI+TDK V+ +GIL +L E TT
Sbjct: 7 VPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTT 66
|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 237 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.87 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.87 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.86 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.86 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.81 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.72 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.55 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 98.73 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 98.67 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 98.09 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 97.58 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.49 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 97.46 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.4 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 97.31 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 97.01 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.96 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.79 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 96.54 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.84 | |
| d1qpoa2 | 115 | Quinolinic acid phosphoribosyltransferase (Nicotin | 95.39 | |
| d1qapa2 | 122 | Quinolinic acid phosphoribosyltransferase (Nicotin | 94.78 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 94.62 | |
| d1o4ua2 | 103 | Quinolinic acid phosphoribosyltransferase (Nicotin | 94.08 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 93.75 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 92.95 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 92.64 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 92.55 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 92.45 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 92.3 | |
| d1e2wa2 | 64 | Cytochrome f, small domain {Chlamydomonas reinhard | 90.58 | |
| d1ci3m2 | 62 | Cytochrome f, small domain {Phormidium laminosum [ | 88.97 | |
| d1hcza2 | 63 | Cytochrome f, small domain {Turnip (Brassica rapa) | 83.88 | |
| d1tu2b2 | 66 | Cytochrome f, small domain {Anabaena sp., strain P | 83.29 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 81.9 |
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Lipoyl domain of dihydrolipoamide acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=3.2e-22 Score=112.15 Aligned_cols=64 Identities=58% Similarity=0.930 Sum_probs=60.8
Q ss_pred CCCCCCCCCeEEEEEEEcCCCCEEcCCCeEEEEecCceEEEEecCCCeEEEEEecCCCCccccC
Q psy10440 1 MPSLSPTMTEGTIVKWLKKEGDAVAPGDVLCEIQTDKAVMSFETEEEGILAKILVPENTTDGKV 64 (64)
Q Consensus 1 ~p~~~~~~~~g~i~~w~v~~G~~V~~g~~l~~ie~~k~~~~i~ap~~G~i~~~~~~~g~~~v~v 64 (64)
||++++++.+|+|.+|++++||.|++||+|+++|++|+..+|.||.+|+|.++++.+|+..|++
T Consensus 10 mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vETdK~~~ei~a~~~G~l~~i~v~eGd~~v~v 73 (102)
T d1y8ob1 10 LPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPL 73 (102)
T ss_dssp CCCSSTTCSEEEEEEECSCTTCEECTTCEEEEEECSSCEEEEECCSCEEEEEESSCTTCCSEET
T ss_pred CCCCCCCccEEEEEEEEeCCCCEEecCccEEEEEcCcEEEEEecCCcEEEEEEEEccCCEEEcC
Confidence 7999999999999999999999999999999999999999999999999999999999744654
|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} | Back information, alignment and structure |
|---|
| >d1hcza2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]} | Back information, alignment and structure |
|---|
| >d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Anabaena sp., strain PCC 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|