Psyllid ID: psy10531

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCPQEK
ccEEEEEEccccccEEEEEcccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEccccccccccccccccccccEEEcccccHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHcHHcccHHHHHHHHcccccccHHHHHcccccccccccccHHHHHHccccccccccHHHccccccccccccccccHHHHHHHccccccccEEEccHHHHHHHHHccccccccccccccccEEEEEcccEEEEEEccccccccccEEccccccccccEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHcccccccccccEEEcccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHccccEEccccc
ccEEEEEcccccccEEEEEcccccEEEHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccHHHHEEEEEccccEEEEEEEcEEEEEEccccccEEEEEEEEccccHHHHHHHHHcccHHHHcccEEEEccccHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHccccEcccccHcHHHHHcHHcccccHHHHHHccccHHcccHHHHHccccccccEEEEEcccccccccccccccEcEEccccHHHHHHHHHHHccccccEEccccccEEEEEccccccEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHccccccEEEEEEEccccccccccHccEEEEEEccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHccHHHHHHHHHccccccccEEEEEEEccccccccHHHHccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccEEEEccHHHHHHHHHHHHHHHHccccEccccc
MEYLLSVDVGTSSVRAALVStrgkvspiavrpialwcpkpqlyeqsseDIWNSVCLAIRDvtkdvnpaqikgvgvdaTCSLValdtnhqpltisptgddsrnVLLWMDhravseadqinatkhsvldtvggkispemetpkllwlkknlpdtcwrraglffdlpdfltwkltgdetqsLCSLVCkwtydaydrrwnedyfekiglgdlkqngwraigntvknpgqpighgVSTEVARalglnpgtpvsvSMIDAHAGALALLatsapgipedidsklglicgtstchmalsakkvqvpgvwgpyyevilpnthllesgqsaTGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIdtqhsteltadfhvwpdfhgnrspladadmKGMIcgltldsseTSLVTLYLATIQALADVtkdvnpaqikgvgvdaTCSLValdtnhqpltisptdtrhsteltadfhvwpdfhgnrspladvdmKGMIcgltldsseTSLVTLYLATIQALAYGTRHIMDAmhaagktpaISTLLvsgglaknplyvqthadvtgcnvlcpqek
MEYLLSVDVGTSSVRAALvstrgkvspiavrPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTnhqpltisptgddsrNVLLWMDHRAVSeadqinatkhsvldtvggkispemetpklLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTvknpgqpigHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCPQEK
MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCPQEK
****LSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPT*TRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLC****
MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKK***EELAPVIQYLN**I******ELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCP***
MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCPQEK
*EYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGNRSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTGCNVLCPQEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query564 2.2.26 [Sep-21-2011]
A2AJL3552 FGGY carbohydrate kinase yes N/A 0.744 0.760 0.498 1e-120
Q6DCD1550 FGGY carbohydrate kinase N/A N/A 0.742 0.761 0.495 1e-120
Q96C11551 FGGY carbohydrate kinase yes N/A 0.75 0.767 0.493 1e-118
Q6NUW9545 FGGY carbohydrate kinase yes N/A 0.75 0.776 0.468 1e-110
Q04585715 Uncharacterized sugar kin yes N/A 0.753 0.594 0.349 5e-76
P53583542 Protein MPA43 OS=Saccharo no N/A 0.671 0.699 0.280 2e-33
Q49V87542 Ribulokinase 2 OS=Staphyl yes N/A 0.702 0.730 0.283 2e-32
Q5WL06561 Ribulokinase OS=Bacillus yes N/A 0.710 0.714 0.288 4e-32
Q2YSA9545 Ribulokinase OS=Staphyloc yes N/A 0.700 0.724 0.293 2e-31
A6QEK4545 Ribulokinase OS=Staphyloc yes N/A 0.700 0.724 0.293 2e-31
>sp|A2AJL3|FGGY_MOUSE FGGY carbohydrate kinase domain-containing protein OS=Mus musculus GN=Fggy PE=2 SV=1 Back     alignment and function desciption
 Score =  433 bits (1113), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/431 (49%), Positives = 281/431 (65%), Gaps = 11/431 (2%)

Query: 2   EYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDV 61
            Y + +DVGT SVRAALV  RG +   A +PI  W P+   +EQSSEDIW + CL  ++V
Sbjct: 11  RYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEV 70

Query: 62  TKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINAT 121
            + ++  +I+G+G DATCSLV LD    PL ++  GD SRNV++W+DHRAVS+  +IN T
Sbjct: 71  VQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRAVSQVHRINET 130

Query: 122 KHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCS 181
           KH VL  VGG +S EM+ PKLLWLK+NL + CW +AG FFDLPDFL+WK TG   +SLCS
Sbjct: 131 KHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCS 190

Query: 182 LVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGL 241
           LVCKWTY A ++ W++ +++ IGL DL  + +  IGN V  PG  +G G++ E AR LGL
Sbjct: 191 LVCKWTYSA-EKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGL 249

Query: 242 NPGTPVSVSMIDAHAGALALLATSAPG-----IPEDIDSKLGLICGTSTCHMALSAKKVQ 296
             G  V+ S+IDAHAG L ++     G       + + S+L +ICGTS+CHM +S   V 
Sbjct: 250 PSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGISKDPVF 309

Query: 297 VPGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLN 356
           VPGVWGPYY  ++P   L E GQS TGKL+DH++  HPA   +  K  T     +  YLN
Sbjct: 310 VPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQGHPAFPELQAK-ATARCQSIYAYLN 368

Query: 357 HVIDTQHSTE----LTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLAT 412
             +D     +    LT D HVWPDFHGNRSPLAD  +KGM+ GLTL      L  LYLAT
Sbjct: 369 SHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLAT 428

Query: 413 IQALADVTKDV 423
           +QA+A  T+ +
Sbjct: 429 VQAIAFGTRFI 439

Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: -
>sp|Q6DCD1|FGGY_XENLA FGGY carbohydrate kinase domain-containing protein OS=Xenopus laevis GN=fggy PE=2 SV=2 Back     alignment and function description
>sp|Q96C11|FGGY_HUMAN FGGY carbohydrate kinase domain-containing protein OS=Homo sapiens GN=FGGY PE=1 SV=2 Back     alignment and function description
>sp|Q6NUW9|FGGY_DANRE FGGY carbohydrate kinase domain-containing protein OS=Danio rerio GN=fggy PE=2 SV=2 Back     alignment and function description
>sp|Q04585|YDR09_YEAST Uncharacterized sugar kinase YDR109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR109C PE=1 SV=1 Back     alignment and function description
>sp|P53583|MPA43_YEAST Protein MPA43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPA43 PE=1 SV=1 Back     alignment and function description
>sp|Q49V87|ARAB2_STAS1 Ribulokinase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=araB2 PE=3 SV=1 Back     alignment and function description
>sp|Q5WL06|ARAB_BACSK Ribulokinase OS=Bacillus clausii (strain KSM-K16) GN=araB PE=3 SV=1 Back     alignment and function description
>sp|Q2YSA9|ARAB_STAAB Ribulokinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=araB PE=3 SV=1 Back     alignment and function description
>sp|A6QEK4|ARAB_STAAE Ribulokinase OS=Staphylococcus aureus (strain Newman) GN=araB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
383863961550 PREDICTED: FGGY carbohydrate kinase doma 0.744 0.763 0.542 1e-137
66509122547 PREDICTED: FGGY carbohydrate kinase doma 0.744 0.767 0.540 1e-135
156553151543 PREDICTED: FGGY carbohydrate kinase doma 0.744 0.773 0.549 1e-134
380025863547 PREDICTED: FGGY carbohydrate kinase doma 0.744 0.767 0.531 1e-133
91090686538 PREDICTED: similar to ribitol kinase [Tr 0.751 0.788 0.552 1e-133
350411000545 PREDICTED: FGGY carbohydrate kinase doma 0.748 0.774 0.524 1e-129
307201773543 FGGY carbohydrate kinase domain-containi 0.748 0.777 0.524 1e-129
332027068543 FGGY carbohydrate kinase domain-containi 0.792 0.823 0.496 1e-128
118787306556 AGAP005956-PA [Anopheles gambiae str. PE 0.746 0.757 0.517 1e-125
307187381543 FGGY carbohydrate kinase domain-containi 0.700 0.727 0.534 1e-125
>gi|383863961|ref|XP_003707448.1| PREDICTED: FGGY carbohydrate kinase domain-containing protein-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 310/433 (71%), Gaps = 13/433 (3%)

Query: 1   MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRD 60
           M+Y + VDVGT S RAALVS++GK+  +A  P+ ++ P P  YEQSS++IW++VC  ++ 
Sbjct: 1   MDYFVGVDVGTGSARAALVSSKGKIVKLATCPLEIFHPAPNFYEQSSDNIWSAVCHVVKS 60

Query: 61  VTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINA 120
           V  D++   +KG+G DATCS+VA+D    P+T+SPTG+D +NV+LWMDHRA  EAD INA
Sbjct: 61  VVADISADNVKGIGFDATCSMVAIDKTGSPVTVSPTGEDKQNVILWMDHRAQEEADFINA 120

Query: 121 TKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLC 180
             H +L+ VGGK+S EM+TPK+LWLKKNLP + W RA L FDLPDFLTWK T  E++SLC
Sbjct: 121 QGHEMLEYVGGKVSLEMQTPKMLWLKKNLPSS-WNRATLLFDLPDFLTWKATDSESRSLC 179

Query: 181 SLVCKWTYDA---YDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVAR 237
           SLVCKW Y A    + +W ED+FE+I L DLK++ WR IGN V+ PG P+ HG+S + A 
Sbjct: 180 SLVCKWNYSAGPDGNNKWKEDFFEQIHLKDLKKDNWRKIGNDVRTPGDPVDHGLSAKAAS 239

Query: 238 ALGLNPGTPVSVSMIDAHAGALALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQV 297
            LGL  GT V  S+IDAHAG L ++  S PG+P ++ ++L LICGTSTCHM ++ KK+ V
Sbjct: 240 ELGLLKGTAVGTSLIDAHAGGLGMIGCSVPGVPVNLQTRLALICGTSTCHMIVNEKKLFV 299

Query: 298 PGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNH 357
            GVWGPY+  ++P   L E GQSATGKLLDHII+ HPAT  I+K L+  +   + QYL+ 
Sbjct: 300 NGVWGPYFSAMIPGLWLNEGGQSATGKLLDHIIDTHPATPGILKSLSGNK--HIQQYLSE 357

Query: 358 VIDT-------QHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYL 410
           ++ T       ++ + LT D HVWPDFHGNRSPLAD  +KGMI GL+L   + +L  LYL
Sbjct: 358 LLQTMADQRNLKNVSYLTKDLHVWPDFHGNRSPLADPALKGMISGLSLSVDQENLALLYL 417

Query: 411 ATIQALADVTKDV 423
           AT+QAL   TK +
Sbjct: 418 ATVQALTYGTKYI 430

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|66509122|ref|XP_394574.2| PREDICTED: FGGY carbohydrate kinase domain-containing protein-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|156553151|ref|XP_001601900.1| PREDICTED: FGGY carbohydrate kinase domain-containing protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380025863|ref|XP_003696683.1| PREDICTED: FGGY carbohydrate kinase domain-containing protein-like [Apis florea] Back     alignment and taxonomy information
>gi|91090686|ref|XP_974615.1| PREDICTED: similar to ribitol kinase [Tribolium castaneum] gi|270013302|gb|EFA09750.1| hypothetical protein TcasGA2_TC011889 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350411000|ref|XP_003489208.1| PREDICTED: FGGY carbohydrate kinase domain-containing protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307201773|gb|EFN81446.1| FGGY carbohydrate kinase domain-containing protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332027068|gb|EGI67164.1| FGGY carbohydrate kinase domain-containing protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|118787306|ref|XP_315996.3| AGAP005956-PA [Anopheles gambiae str. PEST] gi|116126734|gb|EAA11715.3| AGAP005956-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307187381|gb|EFN72504.1| FGGY carbohydrate kinase domain-containing protein [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
UNIPROTKB|F2Z2V1507 FGGY "FGGY carbohydrate kinase 0.732 0.814 0.5 4.9e-142
UNIPROTKB|Q96C11551 FGGY "FGGY carbohydrate kinase 0.732 0.749 0.5 4.9e-142
UNIPROTKB|E1BNF8550 FGGY "Uncharacterized protein" 0.739 0.758 0.5 3.6e-112
MGI|MGI:1922828552 Fggy "FGGY carbohydrate kinase 0.739 0.755 0.502 3.6e-112
UNIPROTKB|E1C771519 FGGY "Uncharacterized protein" 0.746 0.811 0.486 7.6e-112
UNIPROTKB|F1LSP9552 Fggy "Protein Fggy" [Rattus no 0.739 0.755 0.495 2e-111
UNIPROTKB|F1PLD3552 FGGY "Uncharacterized protein" 0.739 0.755 0.485 1.6e-109
ZFIN|ZDB-GENE-040426-2461545 fggy "FGGY carbohydrate kinase 0.765 0.792 0.467 1.5e-106
FB|FBgn0035484548 CG11594 [Drosophila melanogast 0.734 0.755 0.456 1.6e-102
TAIR|locus:2118761579 AT4G30310 [Arabidopsis thalian 0.487 0.474 0.421 3.8e-91
UNIPROTKB|F2Z2V1 FGGY "FGGY carbohydrate kinase domain-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 1087 (387.7 bits), Expect = 4.9e-142, Sum P(2) = 4.9e-142
 Identities = 212/424 (50%), Positives = 277/424 (65%)

Query:     3 YLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVT 62
             Y + VDVGT SVRAALV   G +   A +PI  W P+   +EQSSEDIW + C+  + V 
Sbjct:    11 YYVGVDVGTGSVRAALVDQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVV 70

Query:    63 KDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATK 122
             + ++  QI+G+G DATCSLV LD    PL ++  GD  RNV++W+DHRAVS+ ++IN TK
Sbjct:    71 QGIDLNQIRGLGFDATCSLVVLDKQFHPLPVNQEGDSHRNVIMWLDHRAVSQVNRINETK 130

Query:   123 HSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLCSL 182
             HSVL  VGG +S EM+ PKLLWLK+NL + CW +AG FFDLPDFL+WK TG   +SLCSL
Sbjct:   131 HSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSL 190

Query:   183 VCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALGLN 242
             VCKWTY A ++ W++ +++ IGL D   + +  IGN V  PG  +G+G++ E AR LGL 
Sbjct:   191 VCKWTYSA-EKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLL 249

Query:   243 PGTPVSVSMIDAHAGALALLATSAPG---IPED--IDSKLGLICGTSTCHMALSAKKVQV 297
             PG  V+ S+IDAHAG L ++     G   I E   + S+L +ICGTS+CHM +S   + V
Sbjct:   250 PGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFV 309

Query:   298 PGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNH 357
             PGVWGPY+  ++P   L E GQS TGKL+DH++  H A   +  K  T     +  YLN 
Sbjct:   310 PGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKA-TARCQSIYAYLNS 368

Query:   358 VIDTQHSTE----LTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATI 413
              +D     +    LT D HVWPDFHGNRSPLAD  +KGM+ GL L      L  LYLAT+
Sbjct:   369 HLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATV 428

Query:   414 QALA 417
             QA+A
Sbjct:   429 QAIA 432
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
UNIPROTKB|Q96C11 FGGY "FGGY carbohydrate kinase domain-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNF8 FGGY "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1922828 Fggy "FGGY carbohydrate kinase domain containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C771 FGGY "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSP9 Fggy "Protein Fggy" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLD3 FGGY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2461 fggy "FGGY carbohydrate kinase domain containing" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0035484 CG11594 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2118761 AT4G30310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2AJL3FGGY_MOUSE2, ., 7, ., 1, ., -0.49880.74460.7608yesN/A
Q6NUW9FGGY_DANRE2, ., 7, ., 1, ., -0.46880.750.7761yesN/A
Q96C11FGGY_HUMAN2, ., 7, ., 1, ., -0.49300.750.7676yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
cd07782536 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotubercu 0.0
TIGR01315541 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose ki 1e-161
COG1069544 COG1069, AraB, Ribulose kinase [Energy production 1e-161
cd07768465 cd07768, FGGY_RBK_like, Ribulokinase-like carbohyd 4e-99
cd07783484 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase 4e-79
cd00366435 cd00366, FGGY, FGGY family of carbohydrate kinases 1e-69
cd07781498 cd07781, FGGY_RBK, Ribulokinases; belongs to the F 9e-67
PRK04123548 PRK04123, PRK04123, ribulokinase; Provisional 1e-57
cd07804492 cd07804, FGGY_XK_like_1, uncharacterized xylulose 4e-55
cd07782536 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotubercu 9e-51
COG1070502 COG1070, XylB, Sugar (pentulose and hexulose) kina 6e-47
cd07805514 cd07805, FGGY_XK_like_2, uncharacterized xylulose 3e-41
TIGR01234536 TIGR01234, L-ribulokinase, L-ribulokinase 2e-40
cd07779488 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like 8e-33
COG1069544 COG1069, AraB, Ribulose kinase [Energy production 3e-32
cd07808482 cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xyl 4e-32
TIGR01315541 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose ki 9e-32
cd07802447 cd07802, FGGY_L-XK, L-xylulose kinases; a subfamil 7e-31
pfam00370245 pfam00370, FGGY_N, FGGY family of carbohydrate kin 6e-29
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 2e-28
cd07803482 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup 3e-28
cd07770440 cd07770, FGGY_GntK, Gluconate kinases; a subfamily 4e-26
pfam02782193 pfam02782, FGGY_C, FGGY family of carbohydrate kin 2e-24
pfam02782193 pfam02782, FGGY_C, FGGY family of carbohydrate kin 5e-24
cd07768465 cd07768, FGGY_RBK_like, Ribulokinase-like carbohyd 6e-21
cd07811493 cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup 1e-20
cd07809487 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 2e-20
cd07775452 cd07775, FGGY_AI-2K, Autoinducer-2 kinases; a subf 2e-19
TIGR01314505 TIGR01314, gntK_FGGY, gluconate kinase, FGGY type 1e-18
cd00366435 cd00366, FGGY, FGGY family of carbohydrate kinases 5e-18
PRK04123548 PRK04123, PRK04123, ribulokinase; Provisional 9e-18
cd07781498 cd07781, FGGY_RBK, Ribulokinases; belongs to the F 2e-17
PRK10939520 PRK10939, PRK10939, autoinducer-2 (AI-2) kinase; P 6e-16
cd07783484 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase 1e-15
cd07774430 cd07774, FGGY_1, uncharacterized subgroup; belongs 1e-15
TIGR01311493 TIGR01311, glycerol_kin, glycerol kinase 2e-15
cd07769484 cd07769, FGGY_GK, Glycerol kinases; a subfamily of 5e-15
COG0554499 COG0554, GlpK, Glycerol kinase [Energy production 2e-14
cd07810490 cd07810, FGGY_D-XK_2, D-xylulose kinases, subgroup 3e-14
TIGR01234536 TIGR01234, L-ribulokinase, L-ribulokinase 5e-14
cd07804492 cd07804, FGGY_XK_like_1, uncharacterized xylulose 1e-13
cd07786486 cd07786, FGGY_EcGK_like, Escherichia coli glycerol 8e-13
cd07791484 cd07791, FGGY_GK2_bacteria, bacterial glycerol kin 2e-12
cd07792504 cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kin 5e-12
TIGR01311493 TIGR01311, glycerol_kin, glycerol kinase 4e-11
PRK15027484 PRK15027, PRK15027, xylulokinase; Provisional 7e-11
COG1070502 COG1070, XylB, Sugar (pentulose and hexulose) kina 3e-10
cd07769484 cd07769, FGGY_GK, Glycerol kinases; a subfamily of 3e-10
cd07789495 cd07789, FGGY_CsGK_like, Cellulomonas sp 5e-10
PTZ00294504 PTZ00294, PTZ00294, glycerol kinase-like protein; 6e-10
cd07793504 cd07793, FGGY_GK5_metazoa, metazoan glycerol kinas 8e-10
cd07782 536 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotubercu 9e-10
cd10427487 cd10427, FGGY_GK_1, Uncharacterized subgroup; belo 2e-09
cd07786486 cd07786, FGGY_EcGK_like, Escherichia coli glycerol 3e-09
cd07808482 cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xyl 8e-09
cd07803482 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup 1e-08
COG0554499 COG0554, GlpK, Glycerol kinase [Energy production 1e-08
cd07805514 cd07805, FGGY_XK_like_2, uncharacterized xylulose 2e-08
cd07792504 cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kin 2e-07
PRK00047498 PRK00047, glpK, glycerol kinase; Provisional 3e-07
cd07796503 cd07796, FGGY_NHO1_plant, Arabidopsis NHO1 and rel 4e-07
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 1e-06
PTZ00294504 PTZ00294, PTZ00294, glycerol kinase-like protein; 2e-06
PRK00047498 PRK00047, glpK, glycerol kinase; Provisional 2e-06
PLN02295512 PLN02295, PLN02295, glycerol kinase 4e-06
COG1069 544 COG1069, AraB, Ribulose kinase [Energy production 5e-06
cd10427487 cd10427, FGGY_GK_1, Uncharacterized subgroup; belo 6e-06
TIGR01315 541 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose ki 1e-05
cd07789495 cd07789, FGGY_CsGK_like, Cellulomonas sp 1e-05
cd07795496 cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisi 2e-05
cd07809487 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 3e-05
cd07772419 cd07772, FGGY_NaCK_like, Novosphingobium aromatici 3e-05
cd07795496 cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisi 6e-05
cd07773448 cd07773, FGGY_FK, L-fuculose kinases; a subfamily 9e-05
PLN02295512 PLN02295, PLN02295, glycerol kinase 2e-04
cd07779488 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like 3e-04
cd07791484 cd07791, FGGY_GK2_bacteria, bacterial glycerol kin 6e-04
cd07802447 cd07802, FGGY_L-XK, L-xylulose kinases; a subfamil 7e-04
PRK10331470 PRK10331, PRK10331, L-fuculokinase; Provisional 8e-04
cd07768 465 cd07768, FGGY_RBK_like, Ribulokinase-like carbohyd 0.002
cd07774430 cd07774, FGGY_1, uncharacterized subgroup; belongs 0.002
PRK15027484 PRK15027, PRK15027, xylulokinase; Provisional 0.002
PRK10331470 PRK10331, PRK10331, L-fuculokinase; Provisional 0.002
cd07798437 cd07798, FGGY_AI-2K_like, Autoinducer-2 kinase-lik 0.003
cd07771440 cd07771, FGGY_RhuK, L-rhamnulose kinases; a subfam 0.004
>gnl|CDD|212663 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotuberculosis carbohydrate kinase-like subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information 
 Score =  639 bits (1651), Expect = 0.0
 Identities = 235/430 (54%), Positives = 301/430 (70%), Gaps = 11/430 (2%)

Query: 3   YLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVT 62
           Y + VDVGT S RA L   +G++   AVRPI +W P+P   EQSS+DIW +VC A++   
Sbjct: 2   YYIGVDVGTGSARAGLFDAKGRLLARAVRPIQIWHPQPDFVEQSSDDIWQAVCQAVKAAI 61

Query: 63  K--DVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINA 120
               V+P Q+KG+G DATCSLV LD   QPL++SP+GD+ +N+++WMDHRA+SEA++INA
Sbjct: 62  AGAGVDPEQVKGIGFDATCSLVVLDKEGQPLSVSPSGDNEQNIIVWMDHRAISEAERINA 121

Query: 121 TKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLC 180
           T H VL  VGG ISPEMETPKLLWLK+NLP+T W RAG FFDLPDFLTW+ TG ET+SLC
Sbjct: 122 TGHPVLKYVGGVISPEMETPKLLWLKENLPET-WSRAGKFFDLPDFLTWRATGSETRSLC 180

Query: 181 SLVCKWTYDAYD-RRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARAL 239
           +LVCKWTY A++ + W++D+ E IGL DL +  +  IG  V  PG+P+G+G++ E A  L
Sbjct: 181 TLVCKWTYLAHEKKGWDDDFLEAIGLEDLVEENFAKIGEDVLPPGEPLGNGLTAEAAAEL 240

Query: 240 GLNPGTPVSVSMIDAHAGALALLATSAPG-IPEDIDSKLGLICGTSTCHMALSAKKVQVP 298
           GL PGTPV   +IDAHAG + +L     G   +D+ S+L LICGTSTCHMALS   V VP
Sbjct: 241 GLPPGTPVGAGLIDAHAGGIGVLGADLSGCEADDLTSRLALICGTSTCHMALSPDPVFVP 300

Query: 299 GVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHV 358
           GVWGPY+  ++P   L E GQSATG LLDHII +HPA   + K+   E    +  YLN  
Sbjct: 301 GVWGPYFSAMVPGLWLNEGGQSATGALLDHIIQSHPAFPEL-KEQAGESGISIYAYLNAR 359

Query: 359 IDT-----QHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATI 413
           ++           LT D HV PDFHGNRSPLAD +++G+I GLTLD+S   L  LYLAT+
Sbjct: 360 LEELAAEKGSVAYLTRDLHVLPDFHGNRSPLADPNLRGVISGLTLDTSLDDLARLYLATL 419

Query: 414 QALADVTKDV 423
           QA+A  T+ +
Sbjct: 420 QAIAYGTRHI 429

This subgroup is composed of the uncharacterized Yersinia Pseudotuberculosis carbohydrate kinase that has been named glyerol/xylulose kinase and similar uncharacterized proteins from bacteria and eukaryota. Carbohydrate kinases catalyze the ATP-dependent phosphorylation of their carbohydrate substrate to produce phosphorylated sugar and ADP. The presence of Mg2+ is required for catalytic activity. This subgroup shows high homology to characterized ribulokinases and belongs to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Length = 536
>gnl|CDD|233356 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose kinase Back     alignment and domain information
>gnl|CDD|223995 COG1069, AraB, Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|198346 cd07768, FGGY_RBK_like, Ribulokinase-like carbohydrate kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198360 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase and ribulose-phosphate 3-epimerase fusion proteins-like; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212658 cd00366, FGGY, FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198358 cd07781, FGGY_RBK, Ribulokinases; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|235221 PRK04123, PRK04123, ribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|198372 cd07804, FGGY_XK_like_1, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212663 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotuberculosis carbohydrate kinase-like subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223996 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|198373 cd07805, FGGY_XK_like_2, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|130301 TIGR01234, L-ribulokinase, L-ribulokinase Back     alignment and domain information
>gnl|CDD|212662 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins Back     alignment and domain information
>gnl|CDD|223995 COG1069, AraB, Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|198374 cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xylulokinase-like D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233356 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose kinase Back     alignment and domain information
>gnl|CDD|212666 cd07802, FGGY_L-XK, L-xylulose kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|215880 pfam00370, FGGY_N, FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|198371 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212659 cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|217229 pfam02782, FGGY_C, FGGY family of carbohydrate kinases, C-terminal domain Back     alignment and domain information
>gnl|CDD|217229 pfam02782, FGGY_C, FGGY family of carbohydrate kinases, C-terminal domain Back     alignment and domain information
>gnl|CDD|198346 cd07768, FGGY_RBK_like, Ribulokinase-like carbohydrate kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198377 cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup 3; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198353 cd07775, FGGY_AI-2K, Autoinducer-2 kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|130381 TIGR01314, gntK_FGGY, gluconate kinase, FGGY type Back     alignment and domain information
>gnl|CDD|212658 cd00366, FGGY, FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|235221 PRK04123, PRK04123, ribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|198358 cd07781, FGGY_RBK, Ribulokinases; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|182853 PRK10939, PRK10939, autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>gnl|CDD|198360 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase and ribulose-phosphate 3-epimerase fusion proteins-like; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198352 cd07774, FGGY_1, uncharacterized subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233353 TIGR01311, glycerol_kin, glycerol kinase Back     alignment and domain information
>gnl|CDD|198347 cd07769, FGGY_GK, Glycerol kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223628 COG0554, GlpK, Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|198376 cd07810, FGGY_D-XK_2, D-xylulose kinases, subgroup 2; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|130301 TIGR01234, L-ribulokinase, L-ribulokinase Back     alignment and domain information
>gnl|CDD|198372 cd07804, FGGY_XK_like_1, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198361 cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198363 cd07791, FGGY_GK2_bacteria, bacterial glycerol kinase 2-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212664 cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kinase 1 and 3-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233353 TIGR01311, glycerol_kin, glycerol kinase Back     alignment and domain information
>gnl|CDD|184987 PRK15027, PRK15027, xylulokinase; Provisional Back     alignment and domain information
>gnl|CDD|223996 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|198347 cd07769, FGGY_GK, Glycerol kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198362 cd07789, FGGY_CsGK_like, Cellulomonas sp Back     alignment and domain information
>gnl|CDD|240348 PTZ00294, PTZ00294, glycerol kinase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|212665 cd07793, FGGY_GK5_metazoa, metazoan glycerol kinase 5-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212663 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotuberculosis carbohydrate kinase-like subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198378 cd10427, FGGY_GK_1, Uncharacterized subgroup; belongs to the glycerol kinases subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198361 cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198374 cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xylulokinase-like D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198371 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223628 COG0554, GlpK, Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|198373 cd07805, FGGY_XK_like_2, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212664 cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kinase 1 and 3-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|234594 PRK00047, glpK, glycerol kinase; Provisional Back     alignment and domain information
>gnl|CDD|198368 cd07796, FGGY_NHO1_plant, Arabidopsis NHO1 and related proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|240348 PTZ00294, PTZ00294, glycerol kinase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234594 PRK00047, glpK, glycerol kinase; Provisional Back     alignment and domain information
>gnl|CDD|215166 PLN02295, PLN02295, glycerol kinase Back     alignment and domain information
>gnl|CDD|223995 COG1069, AraB, Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|198378 cd10427, FGGY_GK_1, Uncharacterized subgroup; belongs to the glycerol kinases subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233356 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose kinase Back     alignment and domain information
>gnl|CDD|198362 cd07789, FGGY_CsGK_like, Cellulomonas sp Back     alignment and domain information
>gnl|CDD|198367 cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisiae Gut1p and related proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198350 cd07772, FGGY_NaCK_like, Novosphingobium aromaticivorans carbohydrate kinase-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198367 cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisiae Gut1p and related proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198351 cd07773, FGGY_FK, L-fuculose kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|215166 PLN02295, PLN02295, glycerol kinase Back     alignment and domain information
>gnl|CDD|212662 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins Back     alignment and domain information
>gnl|CDD|198363 cd07791, FGGY_GK2_bacteria, bacterial glycerol kinase 2-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212666 cd07802, FGGY_L-XK, L-xylulose kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|182383 PRK10331, PRK10331, L-fuculokinase; Provisional Back     alignment and domain information
>gnl|CDD|198346 cd07768, FGGY_RBK_like, Ribulokinase-like carbohydrate kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198352 cd07774, FGGY_1, uncharacterized subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|184987 PRK15027, PRK15027, xylulokinase; Provisional Back     alignment and domain information
>gnl|CDD|182383 PRK10331, PRK10331, L-fuculokinase; Provisional Back     alignment and domain information
>gnl|CDD|198369 cd07798, FGGY_AI-2K_like, Autoinducer-2 kinase-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198349 cd07771, FGGY_RhuK, L-rhamnulose kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 564
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 100.0
PRK15027484 xylulokinase; Provisional 100.0
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 100.0
PRK04123548 ribulokinase; Provisional 100.0
PRK00047498 glpK glycerol kinase; Provisional 100.0
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 100.0
PLN02295512 glycerol kinase 100.0
PTZ00294504 glycerol kinase-like protein; Provisional 100.0
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 100.0
PRK10331470 L-fuculokinase; Provisional 100.0
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 100.0
COG0554499 GlpK Glycerol kinase [Energy production and conver 100.0
COG1069544 AraB Ribulose kinase [Energy production and conver 100.0
TIGR01311493 glycerol_kin glycerol kinase. This model describes 100.0
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 100.0
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 100.0
PLN02669556 xylulokinase 100.0
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 100.0
PRK10640471 rhaB rhamnulokinase; Provisional 100.0
KOG2517|consensus516 100.0
PF00370245 FGGY_N: FGGY family of carbohydrate kinases, N-ter 100.0
KOG2531|consensus545 100.0
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 99.95
COG1069544 AraB Ribulose kinase [Energy production and conver 98.97
KOG2517|consensus516 98.93
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 98.72
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 98.69
PRK00047498 glpK glycerol kinase; Provisional 98.64
PRK04123548 ribulokinase; Provisional 98.64
TIGR01311493 glycerol_kin glycerol kinase. This model describes 98.61
PLN02295512 glycerol kinase 98.56
PTZ00294504 glycerol kinase-like protein; Provisional 98.52
PRK15027484 xylulokinase; Provisional 98.51
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 98.49
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 98.47
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 98.46
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 98.44
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 98.34
COG0554499 GlpK Glycerol kinase [Energy production and conver 98.01
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 98.01
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 97.99
PRK10640471 rhaB rhamnulokinase; Provisional 97.93
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 97.89
PRK10331470 L-fuculokinase; Provisional 97.72
COG1940314 NagC Transcriptional regulator/sugar kinase [Trans 97.61
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF 97.22
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 97.15
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 97.11
PRK13311256 N-acetyl-D-glucosamine kinase; Provisional 97.0
PRK09698302 D-allose kinase; Provisional 96.98
COG2971301 Predicted N-acetylglucosamine kinase [Carbohydrate 96.9
PRK09557301 fructokinase; Reviewed 96.9
PF00480179 ROK: ROK family; InterPro: IPR000600 A family of b 96.88
PRK13310303 N-acetyl-D-glucosamine kinase; Provisional 96.82
TIGR00744318 ROK_glcA_fam ROK family protein (putative glucokin 96.71
PRK00292316 glk glucokinase; Provisional 96.7
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 96.68
PLN02669556 xylulokinase 96.42
PRK13321256 pantothenate kinase; Reviewed 96.39
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 96.34
PF14574412 DUF4445: Domain of unknown function (DUF4445); PDB 96.3
PF05378176 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal r 96.22
PRK13318258 pantothenate kinase; Reviewed 96.16
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 96.15
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 96.07
PRK05082291 N-acetylmannosamine kinase; Provisional 95.84
PRK12408336 glucokinase; Provisional 95.33
PRK14101638 bifunctional glucokinase/RpiR family transcription 95.27
PF00349206 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo 94.71
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 94.69
PRK13317277 pantothenate kinase; Provisional 94.64
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 93.31
KOG1794|consensus336 91.7
PRK13317277 pantothenate kinase; Provisional 91.68
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 91.53
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 91.32
TIGR02707351 butyr_kinase butyrate kinase. This model represent 91.29
PRK15080267 ethanolamine utilization protein EutJ; Provisional 90.96
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 90.89
PTZ00288405 glucokinase 1; Provisional 90.88
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 90.77
PRK09472420 ftsA cell division protein FtsA; Reviewed 90.4
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 90.28
PRK13320244 pantothenate kinase; Reviewed 89.67
TIGR00749316 glk glucokinase, proteobacterial type. This model 89.36
PF03702364 UPF0075: Uncharacterised protein family (UPF0075); 88.76
PF13941457 MutL: MutL protein 88.69
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 88.49
PLN02914490 hexokinase 88.47
PRK09585365 anmK anhydro-N-acetylmuramic acid kinase; Reviewed 87.99
PLN02362509 hexokinase 86.63
COG2377371 Predicted molecular chaperone distantly related to 86.22
COG0145 674 HyuA N-methylhydantoinase A/acetone carboxylase, b 86.04
PRK13326262 pantothenate kinase; Reviewed 85.82
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 85.72
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 85.31
COG4820277 EutJ Ethanolamine utilization protein, possible ch 85.09
PRK15080267 ethanolamine utilization protein EutJ; Provisional 84.94
PLN02596490 hexokinase-like 84.83
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 84.47
PLN02405497 hexokinase 84.29
PTZ00107464 hexokinase; Provisional 84.18
PRK13324258 pantothenate kinase; Reviewed 84.11
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 83.13
PRK03011358 butyrate kinase; Provisional 83.12
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 82.94
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 82.75
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 82.59
TIGR00671243 baf pantothenate kinase, type III. This model desc 80.73
CHL00094 621 dnaK heat shock protein 70 80.58
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information 
Probab=100.00  E-value=8.3e-83  Score=704.39  Aligned_cols=464  Identities=43%  Similarity=0.802  Sum_probs=386.8

Q ss_pred             EEEEEEeCccceEEEEEeCCCCEEEEEEeeccccCCCCCccccCHHHHHHHHHHHHHHHHh--cCCCCCeEEEEEeCCCc
Q psy10531          3 YLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTK--DVNPAQIKGVGVDATCS   80 (564)
Q Consensus         3 ~~LgIDiGTTsvKa~l~d~~G~il~~~~~~~~~~~~~~g~~eqd~~~~~~~i~~~l~~l~~--~~~~~~I~aIgis~q~s   80 (564)
                      .+||||+|||++|++|||.+|+++++.+.++++.+|.+||+||||++||+++++++++++.  +.+.++|.+||||+|++
T Consensus         1 ~~lgID~GTts~Ka~l~d~~G~i~~~~~~~~~~~~~~~g~~eqdp~~~~~~~~~~i~~~~~~~~~~~~~I~~Igis~~~s   80 (541)
T TIGR01315         1 HYIGVDVGTGSARACIIDSTGDILALAAQNIKTWTPSSGLEGQSSVYIWQAICNCVKQVLAESKVDPNSVKGIGFDATCS   80 (541)
T ss_pred             CEEEEEecCcCEEEEEEcCCCCEEEEEEeeeeeccCCCCcccCCHHHHHHHHHHHHHHHHHHcCCChhheEEEEeccccc
Confidence            3799999999999999999999999999999988999999999999999999999999984  34567899999999999


Q ss_pred             eEEEcCCCCccccCCCCCCCCCcccccCcchHHHHHHHHhchhHHHHHhCCCCCCcChHHHHHHHHHhCChhHHhhhccc
Q psy10531         81 LVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLF  160 (564)
Q Consensus        81 ~v~~D~~G~pl~~~~~~~~~~p~i~W~D~Ra~~~~~~l~~~~~~i~~~tG~~~~~~~~~~kl~Wl~~~~~Pe~~~~~~~~  160 (564)
                      +++||++|+||...+++.+.+|+|+|+|+|+.++++++++...+++++||+++++.++++||+|+++|+ ||+|+|+++|
T Consensus        81 ~v~~D~~g~pl~~~~~~~~~~~~i~W~D~Ra~~~~~~l~~~~~~~~~~tG~~~~~~~~~~kl~Wl~~~~-Pe~~~~~~~~  159 (541)
T TIGR01315        81 LVVLTHDGEPLPVSKNGGADQNIILWMDHRALAEAEKINATNHNLLRYVGGKMSVEMEIPKVLWLKNNM-PPELFARCKF  159 (541)
T ss_pred             ceEEcCCCCeeecCCCCCcccceeEeecCcHHHHHHHHHHHHHHHHHHhCCeeCcchhHHHHHHHHHhC-hHHHHHhhhh
Confidence            999999999996666667778999999999999999997654578999999999999999999999999 9999999999


Q ss_pred             cchhhHHHHhhhCCccccccccccccccc---cccCCCCHHHHHHcCCCccccccccccCCcccCCCcccCCC-CCHHHH
Q psy10531        161 FDLPDFLTWKLTGDETQSLCSLVCKWTYD---AYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHG-VSTEVA  236 (564)
Q Consensus       161 l~~~dyl~~~LTG~~~~s~as~s~~~l~d---~~~~~W~~ell~~~gi~~~~~~~~~~Lpp~i~~~~~~~G~~-v~~~~a  236 (564)
                      ++++|||.|+|||+.+++.++++.+++||   +++++||+++++.+||++...+++..++|+++++++++| + |++++|
T Consensus       160 l~~~dyl~~~LTG~~~~d~~~as~~~~~d~~d~~~~~W~~ell~~~Gi~~~~~~~l~~~lp~i~~~~~~~G-~~v~~~~A  238 (541)
T TIGR01315       160 FDLTDFLTWRATGKEIRSFCSVVCKWGFVPVDGSNKGWQEDFYETIGLGELVTDNFIRMGGSWMSPGELVG-GGLTAEAA  238 (541)
T ss_pred             cchhhhheeeeecchhHhHhHHhHhhhccccccccCCCCHHHHHHcCChhhhhccccccCCcccCCCcccc-cccCHHHH
Confidence            99999999999999887777777667887   699999999999999984110000022368999999999 9 999999


Q ss_pred             HHcCCCCCCcEEeccchhHhhHhhhhc---cCCCCCCCcCCCcEEEEEccchhhhcccCCCccCCCceecccccccCCee
Q psy10531        237 RALGLNPGTPVSVSMIDAHAGALALLA---TSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTH  313 (564)
Q Consensus       237 ~~~Gl~~g~pV~~g~~D~~aaa~g~g~---~~~~G~~~~~~~~~~~s~GTs~~~~~~~~~p~~~~~~~~~~~~~~~~~~~  313 (564)
                      +++||++|+||++|++|++|+++|+|+   .. +|....-...+++++|||+++..+.++|..+++.+.+++.+..++.|
T Consensus       239 ~~~GL~~g~pV~~g~~D~~aa~lG~g~~~~~~-~g~~~~~~~~~~~~~GTs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (541)
T TIGR01315       239 QELGLPAGTAVGSGLIDAHAGWIGTVGAKVAE-NGDVSQAFTRLAAVAGTSTCHMAMTKGPVFVPGVWGPYRDALIPGYW  317 (541)
T ss_pred             HHhCCCCCCeEeechHhhhccccccccccccc-cccccCCCCcEEEEecCceEEEEecCCCccCCceeecccCccCCCce
Confidence            999999999999999999999999976   55 66200000128899999999888888877666655433345568899


Q ss_pred             EeccccCchhHHHHHHHhhCCChHHHHHhhccCCchhHHHHHHHHHhhcccCCCCCceEEccCCCCCCCCCCCCCcccce
Q psy10531        314 LLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMI  393 (564)
Q Consensus       314 ~~~~~~~~~G~~l~w~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~  393 (564)
                      ..+++++++|.+++|+++.+....+..+...+.+ ...|++|++.+++..     ..                       
T Consensus       318 ~~~~~~~~~G~~l~W~~~~~~~~~~~~~~~~~~~-~~~~~~l~~~~~~~~-----~~-----------------------  368 (541)
T TIGR01315       318 LAEGGQSAAGELMDHMLETHVAYDETVKEAEAAG-KNIYDYLNEHLKEMA-----AK-----------------------  368 (541)
T ss_pred             EEecCccchhHHHHHHHHhCccchHHHHHHHhcc-CcHHHHHHHHHHHhh-----hh-----------------------
Confidence            9999999999999999997642222222222212 245777766544332     00                       


Q ss_pred             eccCCCCCchhHHHHHHHHHHHHHhhhcccCccEEeccccchhhhhhhhhcCCcceeeCCCCCCcccccCcceEEeeccc
Q psy10531        394 CGLTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFH  473 (564)
Q Consensus       394 ~~~~~~~~~~~l~~~~~~~i~~l~~~~~~~~~~~~~ggg~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~gl~~~P~~~  473 (564)
                                                                               .+   ++.++.+++|++|+|||.
T Consensus       369 ---------------------------------------------------------~~---~~~~~~~~~gl~flP~l~  388 (541)
T TIGR01315       369 ---------------------------------------------------------TN---APSISYLVRHFHVYPDLW  388 (541)
T ss_pred             ---------------------------------------------------------cc---cCccccCCCceEEccccc
Confidence                                                                     00   111122358999999999


Q ss_pred             CCCCCCCCCCccccEecCCCCCCh---hhHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCEEEEEcCCcccHHHHHHH
Q psy10531        474 GNRSPLADVDMKGMICGLTLDSSE---TSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTH  550 (564)
Q Consensus       474 G~r~P~~~~~~~g~~~Gl~~~~~~---~~~~~~~~A~~Egva~~~~~~~~~l~~~g~~~~~~~i~~~GG~a~s~~~~q~~  550 (564)
                      |+|+|+|||++||+|+||+.+|++   +||   +||++|||||++|+++|.|++.|.+  +++|+++||++||++|+||+
T Consensus       389 G~r~P~~dp~arG~~~Gl~~~~~~~~~~~~---~rAvlEgiaf~~r~~~e~l~~~g~~--~~~i~~~GGga~s~~w~Qi~  463 (541)
T TIGR01315       389 GNRSPIADPNMRGVIIGLSMDRSKDGLALL---YYATMEFIAYGTRQIVEAMNTAGHT--IKSIFMSGGQCQNPLLMQLI  463 (541)
T ss_pred             cCcCCCCCCCCceEEECCCCCCChHHHHHH---HHHHHHHHHHHHHHHHHHHHHcCCC--ccEEEEecCcccCHHHHHHH
Confidence            999999999999999999999999   777   9999999999999999999988877  89999999999999999999


Q ss_pred             hhhcCCeeeccCC
Q psy10531        551 ADVTGCNVLCPQE  563 (564)
Q Consensus       551 Adv~g~~v~~~~~  563 (564)
                      |||||+||+++++
T Consensus       464 ADvlg~pV~~~~~  476 (541)
T TIGR01315       464 ADACDMPVLIPYV  476 (541)
T ss_pred             HHHHCCeeEecCh
Confidence            9999999998864

This model represents a subfamily of the FGGY family of carbohydrate kinases. This subfamily is closely related to a set of ribulose kinases, and many members are designated ribitol kinase. However, the member from Klebsiella pneumoniae, from a ribitol catabolism operon, accepts D-ribulose and to a lesser extent D-arabinitol and ribitol (PubMed:9639934 and JW Lengeler, personal communication); its annotation in GenBank as ribitol kinase is imprecise and may have affected public annotation of related proteins.
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>KOG2531|consensus Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>PF00480 ROK: ROK family; InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames [] Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) Back     alignment and domain information
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X Back     alignment and domain information
>PF05378 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal region; InterPro: IPR008040 This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 from INTERPRO family Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>PRK12408 glucokinase; Provisional Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>KOG1794|consensus Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>TIGR02707 butyr_kinase butyrate kinase Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PTZ00288 glucokinase 1; Provisional Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PRK13320 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR00749 glk glucokinase, proteobacterial type Back     alignment and domain information
>PF03702 UPF0075: Uncharacterised protein family (UPF0075); InterPro: IPR005338 Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P Back     alignment and domain information
>PF13941 MutL: MutL protein Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PLN02914 hexokinase Back     alignment and domain information
>PRK09585 anmK anhydro-N-acetylmuramic acid kinase; Reviewed Back     alignment and domain information
>PLN02362 hexokinase Back     alignment and domain information
>COG2377 Predicted molecular chaperone distantly related to HSP70-fold metalloproteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13326 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PLN02596 hexokinase-like Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PLN02405 hexokinase Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>TIGR00671 baf pantothenate kinase, type III Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
3gg4_A554 The Crystal Structure Of Glycerol Kinase From Yersi 1e-116
3gg4_A554 The Crystal Structure Of Glycerol Kinase From Yersi 2e-21
3qdk_A572 Structural Insight On Mechanism And Diverse Substra 6e-26
3qdk_A572 Structural Insight On Mechanism And Diverse Substra 6e-09
2zf5_O497 Crystal Structure Of Highly Thermostable Glycerol K 7e-12
2zf5_O497 Crystal Structure Of Highly Thermostable Glycerol K 5e-06
3h45_X506 Glycerol Kinase H232e With Ethylene Glycol Length = 8e-12
3h45_X506 Glycerol Kinase H232e With Ethylene Glycol Length = 1e-06
3flc_O518 Crystal Structure Of The His-Tagged H232r Mutant Of 1e-11
3flc_O518 Crystal Structure Of The His-Tagged H232r Mutant Of 1e-06
3h3n_X506 Glycerol Kinase H232r With Glycerol Length = 506 1e-11
3h3n_X506 Glycerol Kinase H232r With Glycerol Length = 506 1e-06
2dpn_A495 Crystal Structure Of The Glycerol Kinase From Therm 1e-11
2dpn_A495 Crystal Structure Of The Glycerol Kinase From Therm 3e-06
3g25_A501 1.9 Angstrom Crystal Structure Of Glycerol Kinase ( 3e-10
3g25_A501 1.9 Angstrom Crystal Structure Of Glycerol Kinase ( 1e-05
1xup_O487 Enterococcus Casseliflavus Glycerol Kinase Complexe 2e-09
1xup_O487 Enterococcus Casseliflavus Glycerol Kinase Complexe 1e-06
4e1j_A520 Crystal Structure Of Glycerol Kinase In Complex Wit 2e-09
1r59_O505 Enterococcus Casseliflavus Glycerol Kinase Length = 2e-09
1r59_O505 Enterococcus Casseliflavus Glycerol Kinase Length = 1e-06
3d7e_O505 Enterococcus Casseliflavus Glycerol Kinase Mutant H 2e-09
3d7e_O505 Enterococcus Casseliflavus Glycerol Kinase Mutant H 1e-06
2itm_A484 Crystal Structure Of The E. Coli Xylulose Kinase Co 3e-09
3hz6_A511 Crystal Structure Of Xylulokinase From Chromobacter 4e-09
2d4w_A504 Crystal Structure Of Glycerol Kinase From Cellulomo 5e-07
3ezw_A526 Crystal Structure Of A Hyperactive Escherichia Coli 1e-05
1bwf_Y501 Escherichia Coli Glycerol Kinase Mutant With Bound 1e-05
1gla_G501 Structure Of The Regulatory Complex Of Escherichia 1e-05
1bu6_O501 Crystal Structures Of Escherichia Coli Glycerol Kin 1e-05
3gbt_A504 Crystal Structure Of Gluconate Kinase From Lactobac 9e-05
3ifr_A508 The Crystal Structure Of Xylulose Kinase From Rhodo 2e-04
>pdb|3GG4|A Chain A, The Crystal Structure Of Glycerol Kinase From Yersinia Pseudotuberculosis Length = 554 Back     alignment and structure 
Iteration: 1

 Score =  416 bits (1068), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 279/429 (65%), Gaps = 10/429 (2%)
Query: 3   YLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVT 62
           Y + VDVGT S RA +   +G+    A R I  + PK    EQSSE+IW +VC A+RD  
Sbjct: 6   YFIGVDVGTGSARAGVFDLQGRXVGQASREITXFKPKADFVEQSSENIWQAVCNAVRDAV 65
Query: 63  K--DVNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINA 120
              D+NP Q+KG+G DATCSLV LD    PLT+SP+G + +NV++W DHRA+++A++INA
Sbjct: 66  NQADINPIQVKGLGFDATCSLVVLDKEGNPLTVSPSGRNEQNVIVWXDHRAITQAERINA 125
Query: 121 TKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQSLC 180
           TKH VL+ VGG ISPE +TPKLLWLK++ P+T W   G  FDLPDFLTW+ T DET+SLC
Sbjct: 126 TKHPVLEFVGGVISPEXQTPKLLWLKQHXPNT-WSNVGHLFDLPDFLTWRATKDETRSLC 184
Query: 181 SLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARALG 240
           S VCKWTY  ++ RW+  YF+ +GL DL  N    IG TVK  G P+GHG+S   A   G
Sbjct: 185 STVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAKIGATVKPXGAPLGHGLSQRAASEXG 244
Query: 241 LNPGTPVSVSMIDAHAGALALL-ATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPG 299
           L PGT VSVS+IDAHAG + +L A+   G   + D ++ LI GTST H A S     + G
Sbjct: 245 LIPGTAVSVSIIDAHAGTIGILGASGVTGENANFDRRIALIGGTSTAHXAXSRSAHFISG 304
Query: 300 VWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVI 359
           +WGPYY  ILP   L E GQSATG L+DHII +HP   +++++   +    + + LN+++
Sbjct: 305 IWGPYYSAILPEYWLNEGGQSATGALIDHIIQSHPCYPALLEQAKNKG-ETIYEALNYIL 363
Query: 360 -----DTQHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLATIQ 414
                + ++   LT D H  P FHGNRSP A+ ++ G+I GL L ++       YLATIQ
Sbjct: 364 RQXAGEPENIAFLTNDIHXLPYFHGNRSPRANPNLTGIITGLKLSTTPEDXALRYLATIQ 423
Query: 415 ALADVTKDV 423
           ALA  T+ +
Sbjct: 424 ALALGTRHI 432
>pdb|3GG4|A Chain A, The Crystal Structure Of Glycerol Kinase From Yersinia Pseudotuberculosis Length = 554 Back     alignment and structure
>pdb|3QDK|A Chain A, Structural Insight On Mechanism And Diverse Substrate Selection Strategy Of Ribulokinase Length = 572 Back     alignment and structure
>pdb|3QDK|A Chain A, Structural Insight On Mechanism And Diverse Substrate Selection Strategy Of Ribulokinase Length = 572 Back     alignment and structure
>pdb|2ZF5|O Chain O, Crystal Structure Of Highly Thermostable Glycerol Kinase From A Hyperthermophilic Archaeon Length = 497 Back     alignment and structure
>pdb|2ZF5|O Chain O, Crystal Structure Of Highly Thermostable Glycerol Kinase From A Hyperthermophilic Archaeon Length = 497 Back     alignment and structure
>pdb|3H45|X Chain X, Glycerol Kinase H232e With Ethylene Glycol Length = 506 Back     alignment and structure
>pdb|3H45|X Chain X, Glycerol Kinase H232e With Ethylene Glycol Length = 506 Back     alignment and structure
>pdb|3FLC|O Chain O, Crystal Structure Of The His-Tagged H232r Mutant Of Glycerol Kinase From Enterococcus Casseliflavus With Glycerol Length = 518 Back     alignment and structure
>pdb|3FLC|O Chain O, Crystal Structure Of The His-Tagged H232r Mutant Of Glycerol Kinase From Enterococcus Casseliflavus With Glycerol Length = 518 Back     alignment and structure
>pdb|3H3N|X Chain X, Glycerol Kinase H232r With Glycerol Length = 506 Back     alignment and structure
>pdb|3H3N|X Chain X, Glycerol Kinase H232r With Glycerol Length = 506 Back     alignment and structure
>pdb|2DPN|A Chain A, Crystal Structure Of The Glycerol Kinase From Thermus Thermophilus Hb8 Length = 495 Back     alignment and structure
>pdb|2DPN|A Chain A, Crystal Structure Of The Glycerol Kinase From Thermus Thermophilus Hb8 Length = 495 Back     alignment and structure
>pdb|3G25|A Chain A, 1.9 Angstrom Crystal Structure Of Glycerol Kinase (Glpk) From Staphylococcus Aureus In Complex With Glycerol. Length = 501 Back     alignment and structure
>pdb|3G25|A Chain A, 1.9 Angstrom Crystal Structure Of Glycerol Kinase (Glpk) From Staphylococcus Aureus In Complex With Glycerol. Length = 501 Back     alignment and structure
>pdb|1XUP|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Complexed With Glycerol Length = 487 Back     alignment and structure
>pdb|1XUP|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Complexed With Glycerol Length = 487 Back     alignment and structure
>pdb|4E1J|A Chain A, Crystal Structure Of Glycerol Kinase In Complex With Glycerol From Sinorhizobium Meliloti 1021 Length = 520 Back     alignment and structure
>pdb|1R59|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Length = 505 Back     alignment and structure
>pdb|1R59|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Length = 505 Back     alignment and structure
>pdb|3D7E|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Mutant His232ala Complexed With Glycerol Length = 505 Back     alignment and structure
>pdb|3D7E|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Mutant His232ala Complexed With Glycerol Length = 505 Back     alignment and structure
>pdb|2ITM|A Chain A, Crystal Structure Of The E. Coli Xylulose Kinase Complexed With Xylulose Length = 484 Back     alignment and structure
>pdb|3HZ6|A Chain A, Crystal Structure Of Xylulokinase From Chromobacterium Violaceum Length = 511 Back     alignment and structure
>pdb|2D4W|A Chain A, Crystal Structure Of Glycerol Kinase From Cellulomonas Sp. Nt3060 Length = 504 Back     alignment and structure
>pdb|3EZW|A Chain A, Crystal Structure Of A Hyperactive Escherichia Coli Glycerol Kinase Mutant Gly230 --> Asp Obtained Using Microfluidic Crystallization Devices Length = 526 Back     alignment and structure
>pdb|1BWF|Y Chain Y, Escherichia Coli Glycerol Kinase Mutant With Bound Atp Analog Showing Substantial Domain Motion Length = 501 Back     alignment and structure
>pdb|1GLA|G Chain G, Structure Of The Regulatory Complex Of Escherichia Coli Iiiglc With Glycerol Kinase Length = 501 Back     alignment and structure
>pdb|1BU6|O Chain O, Crystal Structures Of Escherichia Coli Glycerol Kinase And The Mutant A65t In An Inactive Tetramer: Conformational Changes And Implications For Allosteric Regulation Length = 501 Back     alignment and structure
>pdb|3GBT|A Chain A, Crystal Structure Of Gluconate Kinase From Lactobacillus Acidophilus Length = 504 Back     alignment and structure
>pdb|3IFR|A Chain A, The Crystal Structure Of Xylulose Kinase From Rhodospirillum Rubrum Length = 508 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 1e-170
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 3e-34
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 7e-09
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 1e-144
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 8e-30
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 2e-07
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 4e-63
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 7e-14
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 4e-04
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 2e-57
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 3e-13
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 2e-52
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 1e-13
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 5e-04
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 3e-48
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 1e-13
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 4e-38
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 2e-10
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 2e-31
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 5e-05
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 5e-28
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 4e-10
2w40_A503 Glycerol kinase, putative; closed conformation, ma 7e-11
2w40_A503 Glycerol kinase, putative; closed conformation, ma 1e-10
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 2e-10
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 7e-09
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 1e-09
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 1e-08
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 1e-09
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 4e-09
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 2e-09
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 4e-09
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 3e-09
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 5e-09
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 4e-09
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 5e-09
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 6e-09
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Length = 554 Back     alignment and structure
 Score =  491 bits (1267), Expect = e-170
 Identities = 211/425 (49%), Positives = 282/425 (66%), Gaps = 10/425 (2%)

Query: 1   MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRD 60
             Y + VDVGT S RA +   +G++   A R I ++ PK    EQSSE+IW +VC A+RD
Sbjct: 4   ASYFIGVDVGTGSARAGVFDLQGRMVGQASREITMFKPKADFVEQSSENIWQAVCNAVRD 63

Query: 61  VTKD--VNPAQIKGVGVDATCSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQI 118
                 +NP Q+KG+G DATCSLV LD    PLT+SP+G + +NV++WMDHRA+++A++I
Sbjct: 64  AVNQADINPIQVKGLGFDATCSLVVLDKEGNPLTVSPSGRNEQNVIVWMDHRAITQAERI 123

Query: 119 NATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAGLFFDLPDFLTWKLTGDETQS 178
           NATKH VL+ VGG ISPEM+TPKLLWLK+++P+T W   G  FDLPDFLTW+ T DET+S
Sbjct: 124 NATKHPVLEFVGGVISPEMQTPKLLWLKQHMPNT-WSNVGHLFDLPDFLTWRATKDETRS 182

Query: 179 LCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHGVSTEVARA 238
           LCS VCKWTY  ++ RW+  YF+ +GL DL  N    IG TVK  G P+GHG+S   A  
Sbjct: 183 LCSTVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAKIGATVKPMGAPLGHGLSQRAASE 242

Query: 239 LGLNPGTPVSVSMIDAHAGAL-ALLATSAPGIPEDIDSKLGLICGTSTCHMALSAKKVQV 297
           +GL PGT VSVS+IDAHAG +  L A+   G   + D ++ LI GTST HMA+S     +
Sbjct: 243 MGLIPGTAVSVSIIDAHAGTIGILGASGVTGENANFDRRIALIGGTSTAHMAMSRSAHFI 302

Query: 298 PGVWGPYYEVILPNTHLLESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNH 357
            G+WGPYY  ILP   L E GQSATG L+DHII +HP   +++++   +      + LN+
Sbjct: 303 SGIWGPYYSAILPEYWLNEGGQSATGALIDHIIQSHPCYPALLEQAKNKGETI-YEALNY 361

Query: 358 VIDT-----QHSTELTADFHVWPDFHGNRSPLADADMKGMICGLTLDSSETSLVTLYLAT 412
           ++       ++   LT D H+ P FHGNRSP A+ ++ G+I GL L ++   +   YLAT
Sbjct: 362 ILRQMAGEPENIAFLTNDIHMLPYFHGNRSPRANPNLTGIITGLKLSTTPEDMALRYLAT 421

Query: 413 IQALA 417
           IQALA
Sbjct: 422 IQALA 426
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Length = 554 Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Length = 554 Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Length = 508 Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Length = 508 Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Length = 508 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Length = 504 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Length = 504 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Length = 482 Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Length = 482 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Length = 489 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Length = 489 Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Length = 503 Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Length = 503 Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Length = 495 Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Length = 495 Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Length = 504 Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Length = 504 Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Length = 501 Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Length = 501 Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Length = 506 Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Length = 506 Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Length = 520 Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Length = 520 Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Length = 497 Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 100.0
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 100.0
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 100.0
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 100.0
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 100.0
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 100.0
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 100.0
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 100.0
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 100.0
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 100.0
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 100.0
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 100.0
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 100.0
2w40_A503 Glycerol kinase, putative; closed conformation, ma 100.0
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 100.0
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 100.0
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 100.0
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 100.0
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 100.0
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 99.38
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 98.83
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 98.82
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 98.82
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 98.81
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 98.81
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 98.76
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 98.76
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 98.74
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 98.72
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 98.69
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 98.67
2w40_A503 Glycerol kinase, putative; closed conformation, ma 98.63
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 98.63
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 98.6
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 98.59
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 98.5
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 98.21
2qm1_A326 Glucokinase; alpha-beta structure, putative helix- 98.1
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 98.04
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 97.91
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 97.91
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 97.91
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 97.9
1z05_A429 Transcriptional regulator, ROK family; structural 97.89
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 97.89
1z6r_A406 MLC protein; transcriptional repressor, ROK family 97.84
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 97.83
2yhw_A343 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N 97.75
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 97.65
4htl_A297 Beta-glucoside kinase; structural genomics, sugar 97.53
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structur 97.49
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 97.47
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 97.34
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MC 97.32
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase 97.17
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; tran 97.1
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 97.05
1zbs_A291 Hypothetical protein PG1100; alpha-beta protein., 97.05
2ap1_A327 Putative regulator protein; zinc binding protein, 96.99
2gup_A292 ROK family protein; sugar kinase, streptococcus pn 96.97
3mcp_A366 Glucokinase; structural genomics, joint center for 96.93
2q2r_A373 Glucokinase 1, putative; ATPase hexose kinase fami 96.67
3djc_A266 Type III pantothenate kinase; structural genomics, 96.54
1zxo_A291 Conserved hypothetical protein Q8A1P1; NESG, BTR25 96.48
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 96.47
1sz2_A332 Glucokinase, glucose kinase; ATP-dependent, glucos 96.31
3lm2_A226 Putative kinase; structural genomics, joint center 96.16
1saz_A381 Probable butyrate kinase 2; askha (acetate and sug 96.08
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 95.8
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 95.52
3bex_A249 Type III pantothenate kinase; actin-like fold, ATP 95.52
1cza_N 917 Hexokinase type I; structurally homologous domains 95.42
3zyy_X631 Iron-sulfur cluster binding protein; iron-sulfur-b 95.38
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 94.67
2h3g_X268 Biosynthetic protein; pantothenate kinase, anthrax 94.2
1cza_N917 Hexokinase type I; structurally homologous domains 93.7
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 93.31
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 92.58
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 92.4
3qbx_A371 Anhydro-N-acetylmuramic acid kinase; acetate and s 90.79
1vhx_A150 Putative holliday junction resolvase; structural g 90.38
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 90.35
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 89.07
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 88.75
3cqy_A370 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 88.65
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 88.14
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 88.12
3nuw_A295 2-OXO-3-deoxygalactonate kinase; structural genomi 87.72
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 86.53
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 86.32
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 85.96
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 85.91
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 84.77
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 84.42
3t69_A330 Putative 2-dehydro-3-deoxygalactonokinase; structu 84.26
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 83.48
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 83.4
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 83.07
2f9w_A271 Pantothenate kinase; COAA, transferase; HET: PAU; 82.86
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 82.71
4ijn_A398 Acetate kinase, acetokinase; proprionate kinase, A 82.21
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 81.37
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 80.87
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 80.13
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-86  Score=733.15  Aligned_cols=467  Identities=50%  Similarity=0.887  Sum_probs=408.0

Q ss_pred             CcEEEEEEeCccceEEEEEeCCCCEEEEEEeeccccCCCCCccccCHHHHHHHHHHHHHHHHh--cCCCCCeEEEEEeCC
Q psy10531          1 MEYLLSVDVGTSSVRAALVSTRGKVSPIAVRPIALWCPKPQLYEQSSEDIWNSVCLAIRDVTK--DVNPAQIKGVGVDAT   78 (564)
Q Consensus         1 M~~~LgIDiGTTsvKa~l~d~~G~il~~~~~~~~~~~~~~g~~eqd~~~~~~~i~~~l~~l~~--~~~~~~I~aIgis~q   78 (564)
                      |+|+||||+||||+|++|||.+|+++++.++++++.+|++||+||||++||+++++++++++.  ++.+.+|.+||||+|
T Consensus         4 ~~~~lgIDiGtts~ka~l~d~~G~il~~~~~~~~~~~p~~g~~eqdp~~~~~~~~~~i~~~~~~~~~~~~~I~~Igis~~   83 (554)
T 3l0q_A            4 ASYFIGVDVGTGSARAGVFDLQGRMVGQASREITMFKPKADFVEQSSENIWQAVCNAVRDAVNQADINPIQVKGLGFDAT   83 (554)
T ss_dssp             CCEEEEEEECSSEEEEEEEETTSCEEEEEEEECCCEEEETTEEEECHHHHHHHHHHHHHHHHHHHTCCGGGEEEEEEEEC
T ss_pred             CcEEEEEEECcccEEEEEECCCCCEEEEEEEecccccCCCCccccCHHHHHHHHHHHHHHHHHHcCCCHhHEEEEEEcCC
Confidence            569999999999999999999999999999999999999999999999999999999999983  455678999999999


Q ss_pred             CceEEEcCCCCccccCCCCCCCCCcccccCcchHHHHHHHHhchhHHHHHhCCCCCCcChHHHHHHHHHhCChhHHhhhc
Q psy10531         79 CSLVALDTNHQPLTISPTGDDSRNVLLWMDHRAVSEADQINATKHSVLDTVGGKISPEMETPKLLWLKKNLPDTCWRRAG  158 (564)
Q Consensus        79 ~s~v~~D~~G~pl~~~~~~~~~~p~i~W~D~Ra~~~~~~l~~~~~~i~~~tG~~~~~~~~~~kl~Wl~~~~~Pe~~~~~~  158 (564)
                      +++|+||++|+||...+.+.+.+|+|+|+|+|+.++++++++..++++++||+++++.++++||+|+++|+ |++|+|++
T Consensus        84 ~~~v~~D~~G~pl~~~~~~~~~~~ai~W~D~Ra~~~~~~l~~~~~~~~~~tG~~~~~~~~~~Kl~Wl~~~~-Pe~~~~~~  162 (554)
T 3l0q_A           84 CSLVVLDKEGNPLTVSPSGRNEQNVIVWMDHRAITQAERINATKHPVLEFVGGVISPEMQTPKLLWLKQHM-PNTWSNVG  162 (554)
T ss_dssp             SCEEEEETTSCBCCCSTTCCTTCCEECTTCCTTHHHHHHHHHHTCGGGGGBTTCCCTTSHHHHHHHHHHHC-HHHHHHEE
T ss_pred             CceEEECCCCCEeeccCCCCCCCCcEEecccchHHHHHHHHHhHHHHHHHhCCCCChhhHHHHHHHHHHhC-hHHHHHhc
Confidence            99999999999996666667778999999999999999998766678999999999999999999999999 99999999


Q ss_pred             cccchhhHHHHhhhCCccccccccccccccccccCCCCHHHHHHcCCCccccccccccCCcccCCCcccCCC-CCHHHHH
Q psy10531        159 LFFDLPDFLTWKLTGDETQSLCSLVCKWTYDAYDRRWNEDYFEKIGLGDLKQNGWRAIGNTVKNPGQPIGHG-VSTEVAR  237 (564)
Q Consensus       159 ~~l~~~dyl~~~LTG~~~~s~as~s~~~l~d~~~~~W~~ell~~~gi~~~~~~~~~~Lpp~i~~~~~~~G~~-v~~~~a~  237 (564)
                      +|++++|||.|+|||+...+.++.+++++||.++++||+++|+.+||++..+..+++|||+++++++++| . |++++|+
T Consensus       163 ~~~~~~dyl~~~LTG~~~~s~as~t~~~~~d~~~~~W~~~ll~~~gi~~~~~~~~~~Lp~~i~~~~~~~G-~~lt~~~A~  241 (554)
T 3l0q_A          163 HLFDLPDFLTWRATKDETRSLCSTVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAKIGATVKPMGAPLG-HGLSQRAAS  241 (554)
T ss_dssp             EEEEHHHHHHHHHHSCCCEEHHHHHHHSCCBTTTTBCCHHHHHHHTCGGGGHHHHTTTCSCEECTTCBCT-TSSCHHHHH
T ss_pred             eEEcHHHHHHHHHhCCccccccchhhccccccccCCCCHHHHHHcCCccccchhHHhCCCcccCCcCeeC-cccCHHHHH
Confidence            9999999999999999987877877767799999999999999999985210000157767999999999 4 9999999


Q ss_pred             HcCCCCCCcEEeccchhHhhHhhh-hcc-CCCCCCCcCCCcEEEEEccchhhhcccCCCccCCCceecccccccCCeeEe
Q psy10531        238 ALGLNPGTPVSVSMIDAHAGALAL-LAT-SAPGIPEDIDSKLGLICGTSTCHMALSAKKVQVPGVWGPYYEVILPNTHLL  315 (564)
Q Consensus       238 ~~Gl~~g~pV~~g~~D~~aaa~g~-g~~-~~~G~~~~~~~~~~~s~GTs~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  315 (564)
                      ++||++|+||++|++|++|+++|+ |+. . ||+.++.++.+++++|||+++.+++++|..+++.+.+++++..++.|.+
T Consensus       242 ~~GL~~g~pV~~g~gD~~aa~lg~~G~~~~-~G~~~~~~~~~~~~~GTs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (554)
T 3l0q_A          242 EMGLIPGTAVSVSIIDAHAGTIGILGASGV-TGENANFDRRIALIGGTSTAHMAMSRSAHFISGIWGPYYSAILPEYWLN  320 (554)
T ss_dssp             HHTCCTTCEEBCCEEHHHHHHHHHTTCCCT-TSCCCCTTTEEEEECSSSEEEEEEESSCCCCTTSEEEEETSSSTTCEEE
T ss_pred             HhCCCCCCeEEEeChHHHhHHhhccccccC-CCccccccceEEEEecchheeeeecCCccccCCcceeecccccCCceEe
Confidence            999999999999999999999997 655 5 7741111124889999999999999999888888876677777999999


Q ss_pred             ccccCchhHHHHHHHhhCCChHHHHHhhccCCchhHHHHHHHHHhhcccCCCCCceEEccCCCCCCCCCCCCCcccceec
Q psy10531        316 ESGQSATGKLLDHIINNHPATQSIMKKLNTEELAPVIQYLNHVIDTQHSTELTADFHVWPDFHGNRSPLADADMKGMICG  395 (564)
Q Consensus       316 ~~~~~~~G~~l~w~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  395 (564)
                      +++++++|.+++|+++.+...+++.+.++..+ .+.|+.|++++++.+     ++                         
T Consensus       321 ~g~~~~~G~~~~W~~~~~~~~~~~~~~a~~~~-~~~~~~l~~~~~~~~-----~~-------------------------  369 (554)
T 3l0q_A          321 EGGQSATGALIDHIIQSHPCYPALLEQAKNKG-ETIYEALNYILRQMA-----GE-------------------------  369 (554)
T ss_dssp             EEEESCSHHHHHHHHHTSTTHHHHHHHHHHTT-CCHHHHHHHHHHHHH-----SS-------------------------
T ss_pred             cchhhhhHHHHHHHHHhcccchHHHHHHHhcC-CCHHHHHHHHHHhcC-----CC-------------------------
Confidence            99999999999999998765455545454444 568999988887664     11                         


Q ss_pred             cCCCCCchhHHHHHHHHHHHHHhhhcccCccEEeccccchhhhhhhhhcCCcceeeCCCCCCcccccCcceEEeecccCC
Q psy10531        396 LTLDSSETSLVTLYLATIQALADVTKDVNPAQIKGVGVDATCSLVALDTNHQPLTISPTDTRHSTELTADFHVWPDFHGN  475 (564)
Q Consensus       396 ~~~~~~~~~l~~~~~~~i~~l~~~~~~~~~~~~~ggg~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~gl~~~P~~~G~  475 (564)
                                                                                  ......+++|++|+|||+|+
T Consensus       370 ------------------------------------------------------------~~~~~~~~~gl~flP~~~Ge  389 (554)
T 3l0q_A          370 ------------------------------------------------------------PENIAFLTNDIHMLPYFHGN  389 (554)
T ss_dssp             ------------------------------------------------------------GGGGGGGGTTCCEECCTTCB
T ss_pred             ------------------------------------------------------------CCccccccCceEEcccccCC
Confidence                                                                        00001137899999999999


Q ss_pred             CCCCCCCCccccEecCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCEEEEEcCCcccHHHHHHHhhhcC
Q psy10531        476 RSPLADVDMKGMICGLTLDSSETSLVTLYLATIQALAYGTRHIMDAMHAAGKTPAISTLLVSGGLAKNPLYVQTHADVTG  555 (564)
Q Consensus       476 r~P~~~~~~~g~~~Gl~~~~~~~~~~~~~~A~~Egva~~~~~~~~~l~~~g~~~~~~~i~~~GG~a~s~~~~q~~Adv~g  555 (564)
                      |+|+|||++||+|+||+.+|+++|++|+|||++||+||++|+++|.|++.|.+  +++|+++||++||++|+||+|||||
T Consensus       390 r~P~~d~~arg~~~Gl~~~~~~~~l~r~~rAvlEgia~~~r~~~e~l~~~g~~--~~~i~~~GG~aks~~~~Qi~ADv~g  467 (554)
T 3l0q_A          390 RSPRANPNLTGIITGLKLSTTPEDMALRYLATIQALALGTRHIIETMNQNGYN--IDTMMASGGGTKNPIFVQEHANATG  467 (554)
T ss_dssp             CSSSCBTTCCCEECSCCSCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCC--CCEEEEESGGGGCHHHHHHHHHHHC
T ss_pred             CCCCCCCCCcEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCC--CCEEEEeCccccCHHHHHHHHHhhC
Confidence            99999999999999999999999998889999999999999999999988888  8999999999999999999999999


Q ss_pred             CeeeccCC
Q psy10531        556 CNVLCPQE  563 (564)
Q Consensus       556 ~~v~~~~~  563 (564)
                      +||++++.
T Consensus       468 ~pV~~~~~  475 (554)
T 3l0q_A          468 CAMLLPEE  475 (554)
T ss_dssp             CEEEEESC
T ss_pred             CeEEecCC
Confidence            99998753
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, shewanella one MR-1, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3t69_A Putative 2-dehydro-3-deoxygalactonokinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.55A {Sinorhizobium meliloti} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2f9w_A Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A {Pseudomonas aeruginosa} SCOP: c.55.1.13 c.55.1.13 PDB: 2f9t_A* Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>4ijn_A Acetate kinase, acetokinase; proprionate kinase, ATP-dependent, metabolic intermediate biosynthesis, acetyl-COA biosynthesis, hydrolysis; HET: AMP; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 564
d2p3ra1252 c.55.1.4 (A:2-253) Glycerol kinase {Escherichia co 3e-29
d1r59o1252 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus c 5e-29
d1zc6a1114 c.55.1.5 (A:8-121) Probable N-acetylglucosamine ki 2e-08
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Length = 252 Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
d2p3ra1252 Glycerol kinase {Escherichia coli [TaxId: 562]} 100.0
d1r59o1252 Glycerol kinase {Enterococcus casseliflavus [TaxId 100.0
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 99.97
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 99.97
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 99.25
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 98.89
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 98.83
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 98.42
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [T 98.28
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 98.25
d1z05a3128 Transcriptional regulator VC2007 {Vibrio cholerae 98.25
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 98.07
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 98.02
d1z6ra2129 Mlc protein {Escherichia coli [TaxId: 562]} 97.94
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 97.87
d1xc3a1118 Putative fructokinase YhdR {Bacillus subtilis [Tax 97.73
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 97.55
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 96.84
d1sz2a1319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 96.8
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 96.23
d1bdga1208 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 94.71
d1ig8a1207 Hexokinase {Baker's yeast (Saccharomyces cerevisia 94.29
d1czan3205 Mammalian type I hexokinase {Human (Homo sapiens) 93.83
d1v4sa1205 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 93.7
d1zbsa2107 Hypothetical protein PG1100 {Porphyromonas gingiva 93.56
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 93.33
d1czan1207 Mammalian type I hexokinase {Human (Homo sapiens) 93.09
d1saza1172 butyrate kinase 2 {Thermotoga maritima [TaxId: 233 92.97
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 92.41
d3bexa1118 Type III pantothenate kinase, CoaX {Thermotoga mar 90.96
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 89.78
d1t6ca1126 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 88.44
d1u6za2124 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 88.27
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 88.07
d2e1za1189 Propionate kinase {Salmonella typhimurium [TaxId: 87.43
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 86.65
d1nbwa2239 ATPase domain of the glycerol dehydratase reactiva 85.57
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 82.97
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 81.0
d1g99a1197 Acetate kinase {Archaeon Methanosarcina thermophil 80.3
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2e1za1 c.55.1.2 (A:4-192) Propionate kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure