Psyllid ID: psy10538


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MIMLSKFFNKELSSHLFRGKISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLGRKDG
ccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHcHHHHHccccEEEccccccccccHHHHccccccEEEccccccccHHHHHHHHHcccccccHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccEEEccccccccccHHHHHHcccccEEccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHHHHccccc
cccHHHHHHHHHHcccccccHcHcHHHccHHcccccccccccHHHHHHcHHHHHHcHHHHHcHHHHHHHHcccccccccccHHHHHHHcccEEEccccccccccHHHcccccccccccHHHHHHHHHHcEEEcccccccHccHHHHHHHcccEEEccccccccccHHHHHHccccEEEccccccccccHHHcccccccccccHHHHHHHHHccEEEcccccccccccccHHHHHHccccEEEccccccccccHHHHHcccccEEEccccccccccHHHHHHHHHcccc
MIMLSKFFNKELSSHLfrgkisedtinslcdggdvtshtsrswsrnaSSIREYLCHKTYLAAEEAFNEWFHYynstkprgppeinedaayseRVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRlrklglsdneihrlppeiqnfENLVELdvsrngcnrqveyvdkrhcslpnvpeDVLRYFRSLEELLLDAnhirdlpknylDFFRLNRlrklglsdneihrlppeiqnfENLVELdvsrnapsnvdsSMVYLKLGRKDG
MIMLSKFFNKELSSHLFRGKISEDTINSlcdggdvtshtsrswsrnasSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLldanhirdlpknfFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEyvdkrhcslpnvPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELdvsrnapsnvdssmvylklgrkdg
MIMLSKFFNKELSSHLFRGKISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLGRKDG
**************HLFRGKISEDTINSLCDGGDV*******W**NASSIREYLCHKTYLAAEEAFNEWFHYYNS******************VLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVEL************************
*IMLSKFFNKELSSHLFRGKISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLGRKD*
MIMLSKFFNKELSSHLFRGKISEDTINSLCDGGD************ASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLGRKDG
MIMLSKFFNKELSSHLFRGKISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMLSKFFNKELSSHLFRGKISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRxxxxxxxxxxxxxxxxxxxxxVLRYFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKLGRKDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
Q7KRY7 1851 Protein lap4 OS=Drosophil yes N/A 0.336 0.052 0.75 6e-38
Q14160 1630 Protein scribble homolog yes N/A 0.333 0.058 0.666 5e-30
Q80U72 1612 Protein scribble homolog yes N/A 0.572 0.102 0.415 1e-29
Q4H4B6 1724 Protein scribble homolog yes N/A 0.531 0.088 0.421 1e-25
Q80VQ1 524 Leucine-rich repeat-conta no N/A 0.576 0.316 0.391 6e-25
Q9BTT6 524 Leucine-rich repeat-conta no N/A 0.576 0.316 0.391 1e-24
P70587 1490 Leucine-rich repeat-conta no N/A 0.527 0.102 0.345 7e-16
Q80TE7 1490 Leucine-rich repeat-conta no N/A 0.527 0.102 0.345 7e-16
Q96NW7 1537 Leucine-rich repeat-conta no N/A 0.527 0.098 0.345 8e-16
F1MCA7 1536 Leucine-rich repeat-conta no N/A 0.527 0.098 0.339 1e-15
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 3/100 (3%)

Query: 183 GCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLG 242
           GCNRQVE+VDKRHCSLP VPE++LRY R+LEEL LDANHIRDLPKN   FFRL+RLRKLG
Sbjct: 10  GCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKN---FFRLHRLRKLG 66

Query: 243 LSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLK 282
           LSDNEI RLPP+IQNFENLVELDVSRN   ++   + +L+
Sbjct: 67  LSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQ 106




Required for polarization of the embryonic, imaginal disk and follicular epithelia. Specifically restricts apical membrane determinants to the apical cell surface; acts to exclude crb from the basolateral domain and define adherens junction position. Regulates cellular growth and differentiation; acts as a tumor suppressor. Essential for odor guided behavior.
Drosophila melanogaster (taxid: 7227)
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
345489480 2178 PREDICTED: protein lap4-like [Nasonia vi 0.291 0.038 0.885 3e-38
332023058 2051 Protein lap4 [Acromyrmex echinatior] 0.291 0.040 0.896 4e-38
307180798 2056 Protein lap4 [Camponotus floridanus] 0.291 0.040 0.885 5e-38
340713142 2051 PREDICTED: protein lap4-like isoform 3 [ 0.291 0.040 0.873 1e-37
350417073 2050 PREDICTED: protein lap4-like isoform 1 [ 0.291 0.040 0.873 1e-37
380015498 2046 PREDICTED: LOW QUALITY PROTEIN: protein 0.291 0.041 0.873 1e-37
350417077 1835 PREDICTED: protein lap4-like isoform 3 [ 0.291 0.045 0.873 1e-37
270001100 1562 hypothetical protein TcasGA2_TC011397 [T 0.336 0.062 0.79 1e-37
350417075 1759 PREDICTED: protein lap4-like isoform 2 [ 0.291 0.047 0.873 2e-37
340713138 1599 PREDICTED: protein lap4-like isoform 1 [ 0.291 0.052 0.873 2e-37
>gi|345489480|ref|XP_001603194.2| PREDICTED: protein lap4-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/87 (88%), Positives = 82/87 (94%), Gaps = 3/87 (3%)

Query: 183 GCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLG 242
           GCNRQVEYVDKRHCSLP+VP+D+LRY RSLEELLLDANHIRDLPKN   FFRL RLRKLG
Sbjct: 10  GCNRQVEYVDKRHCSLPSVPDDILRYSRSLEELLLDANHIRDLPKN---FFRLTRLRKLG 66

Query: 243 LSDNEIHRLPPEIQNFENLVELDVSRN 269
           LSDNE+HRLPP+IQNFENLVELDVSRN
Sbjct: 67  LSDNELHRLPPDIQNFENLVELDVSRN 93




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332023058|gb|EGI63323.1| Protein lap4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307180798|gb|EFN68662.1| Protein lap4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340713142|ref|XP_003395107.1| PREDICTED: protein lap4-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417073|ref|XP_003491243.1| PREDICTED: protein lap4-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380015498|ref|XP_003691738.1| PREDICTED: LOW QUALITY PROTEIN: protein lap4-like [Apis florea] Back     alignment and taxonomy information
>gi|350417077|ref|XP_003491245.1| PREDICTED: protein lap4-like isoform 3 [Bombus impatiens] Back     alignment and taxonomy information
>gi|270001100|gb|EEZ97547.1| hypothetical protein TcasGA2_TC011397 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350417075|ref|XP_003491244.1| PREDICTED: protein lap4-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713138|ref|XP_003395105.1| PREDICTED: protein lap4-like isoform 1 [Bombus terrestris] gi|340713140|ref|XP_003395106.1| PREDICTED: protein lap4-like isoform 2 [Bombus terrestris] gi|340713144|ref|XP_003395108.1| PREDICTED: protein lap4-like isoform 4 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
FB|FBgn0263289 1851 scrib "scribbled" [Drosophila 0.336 0.052 0.75 3.7e-34
UNIPROTKB|F1N0Y1 1611 LOC100295316 "Uncharacterized 0.333 0.059 0.666 3.2e-27
UNIPROTKB|Q14160 1630 SCRIB "Protein scribble homolo 0.333 0.058 0.666 3.3e-27
MGI|MGI:2145950 1612 Scrib "scribbled homolog (Dros 0.333 0.059 0.666 4.1e-27
RGD|1565055 1617 Scrib "scribbled planar cell p 0.333 0.059 0.666 4.1e-27
UNIPROTKB|E1C0D6 1526 E1C0D6 "Uncharacterized protei 0.333 0.062 0.636 1.7e-26
ZFIN|ZDB-GENE-030616-572 1724 scrib "scribbled homolog (Dros 0.326 0.054 0.628 2.5e-26
MGI|MGI:2442313 524 Lrrc1 "leucine rich repeat con 0.625 0.343 0.400 8.7e-24
UNIPROTKB|Q9BTT6 524 LRRC1 "Leucine-rich repeat-con 0.625 0.343 0.400 1.9e-23
MGI|MGI:2676665 1490 Lrrc7 "leucine rich repeat con 0.565 0.109 0.338 4.4e-16
FB|FBgn0263289 scrib "scribbled" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 3.7e-34, P = 3.7e-34
 Identities = 75/100 (75%), Positives = 86/100 (86%)

Query:   183 GCNRQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLG 242
             GCNRQVE+VDKRHCSLP VPE++LRY R+LEEL LDANHIRDLPKN   FFRL+RLRKLG
Sbjct:    10 GCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKN---FFRLHRLRKLG 66

Query:   243 LSDNEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLK 282
             LSDNEI RLPP+IQNFENLVELDVSRN   ++   + +L+
Sbjct:    67 LSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQ 106


GO:0042048 "olfactory behavior" evidence=IMP
GO:0006963 "positive regulation of antibacterial peptide biosynthetic process" evidence=IMP
GO:0005918 "septate junction" evidence=NAS;IDA;TAS
GO:0016335 "morphogenesis of larval imaginal disc epithelium" evidence=IMP
GO:0016336 "establishment or maintenance of polarity of larval imaginal disc epithelium" evidence=IMP
GO:0016333 "morphogenesis of follicular epithelium" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0016327 "apicolateral plasma membrane" evidence=IDA
GO:0016328 "lateral plasma membrane" evidence=IDA
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=TAS
GO:0016331 "morphogenesis of embryonic epithelium" evidence=TAS
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=NAS;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0007391 "dorsal closure" evidence=IMP;TAS
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0007280 "pole cell migration" evidence=NAS
GO:0008406 "gonad development" evidence=NAS
GO:0008105 "asymmetric protein localization" evidence=IMP;TAS
GO:0008285 "negative regulation of cell proliferation" evidence=TAS
GO:0051726 "regulation of cell cycle" evidence=NAS
GO:0001738 "morphogenesis of a polarized epithelium" evidence=TAS
GO:0016323 "basolateral plasma membrane" evidence=IDA;TAS
GO:0035088 "establishment or maintenance of apical/basal cell polarity" evidence=IMP
GO:0019991 "septate junction assembly" evidence=IMP
GO:0045186 "zonula adherens assembly" evidence=IMP
GO:0045571 "negative regulation of imaginal disc growth" evidence=IMP
GO:0000902 "cell morphogenesis" evidence=IMP
GO:0007472 "wing disc morphogenesis" evidence=IMP
GO:0048749 "compound eye development" evidence=IMP
GO:0050680 "negative regulation of epithelial cell proliferation" evidence=IMP
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0022402 "cell cycle process" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0030100 "regulation of endocytosis" evidence=IMP
GO:0072002 "Malpighian tubule development" evidence=IMP
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP
GO:0007464 "R3/R4 cell fate commitment" evidence=IMP
GO:0072089 "stem cell proliferation" evidence=IMP
GO:0048863 "stem cell differentiation" evidence=IMP
GO:0045169 "fusome" evidence=IDA
UNIPROTKB|F1N0Y1 LOC100295316 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14160 SCRIB "Protein scribble homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2145950 Scrib "scribbled homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565055 Scrib "scribbled planar cell polarity protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0D6 E1C0D6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-572 scrib "scribbled homolog (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2442313 Lrrc1 "leucine rich repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTT6 LRRC1 "Leucine-rich repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2676665 Lrrc7 "leucine rich repeat containing 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam04121685 pfam04121, Nup84_Nup100, Nuclear pore protein 84 / 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 55.7 bits (134), Expect = 6e-09
 Identities = 51/158 (32%), Positives = 71/158 (44%), Gaps = 18/158 (11%)

Query: 126 RSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCN 185
            +L+EL L  N I  LP     L  L+ L LS N++  LP  + N  NL  LD+S N   
Sbjct: 140 SNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNK-- 197

Query: 186 RQVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSD 245
                       + ++P ++     +LEEL L  N I +L         L  L  L LS+
Sbjct: 198 ------------ISDLPPEIELL-SALEELDLSNNSIIELL---SSLSNLKNLSGLELSN 241

Query: 246 NEIHRLPPEIQNFENLVELDVSRNAPSNVDSSMVYLKL 283
           N++  LP  I N  NL  LD+S N  S++ S      L
Sbjct: 242 NKLEDLPESIGNLSNLETLDLSNNQISSISSLGSLTNL 279


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|217909 pfam04121, Nup84_Nup100, Nuclear pore protein 84 / 107 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
KOG0444|consensus 1255 99.91
KOG4194|consensus 873 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
KOG0472|consensus 565 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG4194|consensus 873 99.88
KOG0444|consensus 1255 99.86
KOG0472|consensus 565 99.82
KOG0617|consensus264 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
KOG0617|consensus264 99.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
KOG0618|consensus 1081 99.68
KOG0618|consensus 1081 99.64
KOG4237|consensus 498 99.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.61
KOG4237|consensus 498 99.47
KOG0532|consensus 722 99.45
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.41
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.38
KOG0532|consensus 722 99.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.37
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
KOG1259|consensus490 99.34
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG3207|consensus 505 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1909|consensus382 99.08
KOG1259|consensus490 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG0531|consensus 414 98.79
KOG1909|consensus382 98.76
KOG0531|consensus 414 98.75
KOG3207|consensus 505 98.71
KOG2982|consensus 418 98.71
KOG1859|consensus 1096 98.68
PLN03150 623 hypothetical protein; Provisional 98.65
PLN03150623 hypothetical protein; Provisional 98.62
KOG4579|consensus177 98.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.52
KOG4658|consensus 889 98.38
KOG1859|consensus 1096 98.37
KOG1644|consensus233 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.26
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.24
PRK15386 426 type III secretion protein GogB; Provisional 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.22
KOG4579|consensus177 98.18
PRK15386 426 type III secretion protein GogB; Provisional 98.09
KOG4658|consensus 889 97.96
KOG2120|consensus419 97.92
KOG1644|consensus233 97.77
KOG2120|consensus419 97.69
KOG2982|consensus 418 97.57
KOG3665|consensus 699 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.46
KOG2123|consensus 388 97.2
KOG3665|consensus 699 97.06
KOG2123|consensus 388 97.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.51
KOG4308|consensus 478 96.42
KOG2739|consensus260 96.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.21
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.63
KOG2739|consensus 260 95.61
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.09
smart0037026 LRR Leucine-rich repeats, outliers. 95.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.99
KOG0473|consensus 326 94.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.46
smart0037026 LRR Leucine-rich repeats, outliers. 93.46
KOG0473|consensus 326 91.25
KOG4308|consensus 478 88.13
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.59
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.36
KOG3864|consensus221 80.58
>KOG0444|consensus Back     alignment and domain information
Probab=99.91  E-value=7.3e-27  Score=210.38  Aligned_cols=159  Identities=14%  Similarity=0.103  Sum_probs=116.9

Q ss_pred             chhhhhhhhhccccccc-cccCcccccc------ccCCCCcccccccccccCCccccEEeeCCCccccccCccc------
Q psy10538          2 IMLSKFFNKELSSHLFR-GKISEDTINS------LCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNE------   68 (288)
Q Consensus         2 ~~~~~~~~~~ls~~~~~-g~~p~~~~~~------~~~~~~~~~~~~~~~~~~l~~L~~l~~~~~~l~~l~~~~~------   68 (288)
                      .+++.--+.|+|.|.|+ +.+|.++.++      -++...+...+  +-++.+.+|+.+..+++++.++.....      
T Consensus         4 gVLpFVrGvDfsgNDFsg~~FP~~v~qMt~~~WLkLnrt~L~~vP--eEL~~lqkLEHLs~~HN~L~~vhGELs~Lp~LR   81 (1255)
T KOG0444|consen    4 GVLPFVRGVDFSGNDFSGDRFPHDVEQMTQMTWLKLNRTKLEQVP--EELSRLQKLEHLSMAHNQLISVHGELSDLPRLR   81 (1255)
T ss_pred             cccceeecccccCCcCCCCcCchhHHHhhheeEEEechhhhhhCh--HHHHHHhhhhhhhhhhhhhHhhhhhhccchhhH
Confidence            35666778999999999 5789887766      34434444443  345667777788888887766322111      


Q ss_pred             -e-EEecCCCCCCCCccccCCCCccEEEcCCCCccchhhHHH---------hhcCCceecchHHhhcCcCCcEEEcccCC
Q psy10538         69 -W-FHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVA---------EWTSKLKLYSKDVLRYFRSLEELLLDANH  137 (288)
Q Consensus        69 -~-l~~~~~~~~~lp~~l~~l~~l~~l~l~~n~l~~l~~~~~---------~~~~~l~~~~~~~~~~l~~L~~L~l~~n~  137 (288)
                       . ....+-.-+-+|+.++.+..|+.+||++|+++..|+.+-         .+.|++.+||...|.++..|-.||+++|+
T Consensus        82 sv~~R~N~LKnsGiP~diF~l~dLt~lDLShNqL~EvP~~LE~AKn~iVLNLS~N~IetIPn~lfinLtDLLfLDLS~Nr  161 (1255)
T KOG0444|consen   82 SVIVRDNNLKNSGIPTDIFRLKDLTILDLSHNQLREVPTNLEYAKNSIVLNLSYNNIETIPNSLFINLTDLLFLDLSNNR  161 (1255)
T ss_pred             HHhhhccccccCCCCchhcccccceeeecchhhhhhcchhhhhhcCcEEEEcccCccccCCchHHHhhHhHhhhccccch
Confidence             1 111111223489999999999999999999999886543         56788899999999999999999999999


Q ss_pred             CcccCcccccCCCccEEecCCCCCc
Q psy10538        138 IRDLPKNFFRLNRLRKLGLSDNEIH  162 (288)
Q Consensus       138 i~~lp~~~~~l~~L~~L~l~~n~l~  162 (288)
                      +..+|+.+.++.+|++|.+++|.+.
T Consensus       162 Le~LPPQ~RRL~~LqtL~Ls~NPL~  186 (1255)
T KOG0444|consen  162 LEMLPPQIRRLSMLQTLKLSNNPLN  186 (1255)
T ss_pred             hhhcCHHHHHHhhhhhhhcCCChhh
Confidence            9988888888888888888888653



>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3cqc_A270 Nucleoporin Nup107/nup133 Interaction Complex Lengt 1e-09
3i4r_A277 Nup107(Aa658-925)NUP133(AA517-1156) Complex, H.Sapi 1e-09
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-09
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-06
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 2e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
3cqg_A246 Nucleoporin Nup107/nup133 Interaction Complex, Delt 8e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 6e-04
>pdb|3CQC|A Chain A, Nucleoporin Nup107/nup133 Interaction Complex Length = 270 Back     alignment and structure

Iteration: 1

Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Query: 20 KISEDTINSLCDGGDVTSHTSRSWSRNASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPR 79 KI +D+I + + + S + + ++IRE+LC + YL A E FNEWF + NS P+ Sbjct: 59 KIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSV-PQ 117 Query: 80 GPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDV 121 P I + ++E+V HE + ++YE W L + DV Sbjct: 118 KPALIPQ-PTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADV 158
>pdb|3I4R|A Chain A, Nup107(Aa658-925)NUP133(AA517-1156) Complex, H.Sapiens Length = 277 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3CQG|A Chain A, Nucleoporin Nup107/nup133 Interaction Complex, Delta Finger Mutant Length = 246 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-18
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-19
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-18
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
3cqc_A270 Nuclear pore complex protein NUP107; nucleoporin, 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  101 bits (255), Expect = 2e-25
 Identities = 37/161 (22%), Positives = 63/161 (39%), Gaps = 21/161 (13%)

Query: 127 SLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRN---- 182
               L L +  +   P   FRL+ L+ + +    +  LP  +Q F  L  L ++RN    
Sbjct: 82  GRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRA 141

Query: 183 -----GCNRQVEYVDKRHCS-LPNVPEDV--------LRYFRSLEELLLDANHIRDLPKN 228
                    ++  +  R C  L  +PE +         +   +L+ L L+   IR LP  
Sbjct: 142 LPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPA- 200

Query: 229 YLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRN 269
                 L  L+ L + ++ +  L P I +   L ELD+   
Sbjct: 201 --SIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGC 239


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3cqc_A Nuclear pore complex protein NUP107; nucleoporin, mRNA transport, nucleus, phosphoprotein, protein transport, translocation, polymorphism; 2.53A {Homo sapiens} PDB: 3i4r_A 3cqg_A Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.4
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.39
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.28
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.19
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.12
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.31
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.18
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.03
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.34
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.1
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=99.95  E-value=7.4e-27  Score=222.29  Aligned_cols=263  Identities=15%  Similarity=0.171  Sum_probs=152.2

Q ss_pred             hhhhhhhhccccccccc-----------------cCcccc--cc----ccCC--CCcccccccccccCCccccEEeeCCC
Q psy10538          4 LSKFFNKELSSHLFRGK-----------------ISEDTI--NS----LCDG--GDVTSHTSRSWSRNASSIREYLCHKT   58 (288)
Q Consensus         4 ~~~~~~~~ls~~~~~g~-----------------~p~~~~--~~----~~~~--~~~~~~~~~~~~~~l~~L~~l~~~~~   58 (288)
                      ++++...+|++|.+.|.                 +|..+.  ++    .++.  ..+... ....+.++++|+.++++.+
T Consensus       205 l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~-~p~~l~~l~~L~~L~Ls~n  283 (636)
T 4eco_A          205 LTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTK-LPTFLKALPEMQLINVACN  283 (636)
T ss_dssp             CTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSS-CCTTTTTCSSCCEEECTTC
T ss_pred             ccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCcc-ChHHHhcCCCCCEEECcCC
Confidence            45667788999999996                 888877  54    2222  222221 1256778999999999999


Q ss_pred             c-ccc--cc------------CccceEEecCCCCCCCCc--cccCCCCccEEEcCCCCcc-chhhHHHhhcCCceecchH
Q psy10538         59 Y-LAA--EE------------AFNEWFHYYNSTKPRGPP--EINEDAAYSERVLHESRLQ-QYEEVVAEWTSKLKLYSKD  120 (288)
Q Consensus        59 ~-l~~--l~------------~~~~~l~~~~~~~~~lp~--~l~~l~~l~~l~l~~n~l~-~l~~~~~~~~~~l~~~~~~  120 (288)
                      . +++  ++            .....+++.++.++.+|.  .++.+++|+++++++|++. .+|                
T Consensus       284 ~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip----------------  347 (636)
T 4eco_A          284 RGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLKTFPVETSLQKMKKLGMLECLYNQLEGKLP----------------  347 (636)
T ss_dssp             TTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCSSCCCHHHHTTCTTCCEEECCSCCCEEECC----------------
T ss_pred             CCCccccchHHHHhhhccccCCCCCEEECCCCcCCccCchhhhccCCCCCEEeCcCCcCccchh----------------
Confidence            8 764  11            234568888888889998  8999999999999999887 443                


Q ss_pred             HhhcCcCCcEEEcccCCCcccCcccccCCC-ccEEecCCCCCcccCccccCCC--CCcEEEccCCCCCC-----------
Q psy10538        121 VLRYFRSLEELLLDANHIRDLPKNFFRLNR-LRKLGLSDNEIHRLPPEIQNFE--NLVELDVSRNGCNR-----------  186 (288)
Q Consensus       121 ~~~~l~~L~~L~l~~n~i~~lp~~~~~l~~-L~~L~l~~n~l~~l~~~l~~~~--~L~~L~l~~n~~~~-----------  186 (288)
                      .+..+++|++|++++|+++.+|..+..+++ |+.|++++|.++.+|..+....  +|++|++++|.+.+           
T Consensus       348 ~~~~l~~L~~L~L~~N~l~~lp~~l~~l~~~L~~L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~  427 (636)
T 4eco_A          348 AFGSEIKLASLNLAYNQITEIPANFCGFTEQVENLSFAHNKLKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDP  427 (636)
T ss_dssp             CCEEEEEESEEECCSSEEEECCTTSEEECTTCCEEECCSSCCSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCS
T ss_pred             hhCCCCCCCEEECCCCccccccHhhhhhcccCcEEEccCCcCcccchhhhhcccCccCEEECcCCcCCCcchhhhccccc
Confidence            234445555555555555555555555555 5555555555555554443322  45555555554431           


Q ss_pred             ------CccEEEccCCCCCCCChHHHhcCCCcceeecccCcccccCCccccccCC-------CCccEEEccCCCCccCCc
Q psy10538        187 ------QVEYVDKRHCSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRL-------NRLRKLGLSDNEIHRLPP  253 (288)
Q Consensus       187 ------~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~l~~~~~~~~~l-------~~L~~L~l~~n~l~~~p~  253 (288)
                            +|++|++++|.++.+|...+..+++|+.|++++|.++.+|...  +...       ++|+.|++++|+++.+|.
T Consensus       428 ~~~~~~~L~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~--~~~~~~~~~~l~~L~~L~Ls~N~l~~lp~  505 (636)
T 4eco_A          428 TPFKGINVSSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNS--LKDENENFKNTYLLTSIDLRFNKLTKLSD  505 (636)
T ss_dssp             SCCCCCCEEEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSS--SEETTEECTTGGGCCEEECCSSCCCBCCG
T ss_pred             ccccCCCCCEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHH--hccccccccccCCccEEECcCCcCCccCh
Confidence                  4455555555555555554444455555555555555444431  1111       145555555555555554


Q ss_pred             ccc--CCCCCcEEECcCCCCCCcCcccccccccc
Q psy10538        254 EIQ--NFENLVELDVSRNAPSNVDSSMVYLKLGR  285 (288)
Q Consensus       254 ~l~--~~~~L~~L~L~~N~l~~ip~~~~~l~~~~  285 (288)
                      .+.  .+++|+.|++++|+++.+|..+..++.++
T Consensus       506 ~~~~~~l~~L~~L~Ls~N~l~~ip~~~~~l~~L~  539 (636)
T 4eco_A          506 DFRATTLPYLVGIDLSYNSFSKFPTQPLNSSTLK  539 (636)
T ss_dssp             GGSTTTCTTCCEEECCSSCCSSCCCGGGGCSSCC
T ss_pred             hhhhccCCCcCEEECCCCCCCCcChhhhcCCCCC
Confidence            443  44555555555555555555444444443



>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 61.9 bits (149), Expect = 1e-11
 Identities = 32/177 (18%), Positives = 61/177 (34%), Gaps = 39/177 (22%)

Query: 124 YFRSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNG 183
              +L+EL L+ N ++D+      L  L  L L++N+I  L P +     L EL +  N 
Sbjct: 217 ILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGANQ 274

Query: 184 ------------------------------CNRQVEYVDKRHCSLPNVPEDVLRYFRSLE 213
                                           + + Y+     ++ ++    +     L+
Sbjct: 275 ISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQ 332

Query: 214 ELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNA 270
            L    N + D+         L  +  L    N+I  L P + N   + +L ++  A
Sbjct: 333 RLFFANNKVSDVS----SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.3
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.23
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.17
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.36
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=4.1e-24  Score=180.15  Aligned_cols=191  Identities=27%  Similarity=0.273  Sum_probs=166.7

Q ss_pred             CCccccEEeeCCCccccccCccceEEecCCCCCCCCccccCCCCccEEEcCCCCccchhhHHHhhcCCceecchHHhhcC
Q psy10538         46 NASSIREYLCHKTYLAAEEAFNEWFHYYNSTKPRGPPEINEDAAYSERVLHESRLQQYEEVVAEWTSKLKLYSKDVLRYF  125 (288)
Q Consensus        46 ~l~~L~~l~~~~~~l~~l~~~~~~l~~~~~~~~~lp~~l~~l~~l~~l~l~~n~l~~l~~~~~~~~~~l~~~~~~~~~~l  125 (288)
                      +...+.+++|+++.++.                 +|+.+.  +++++|+|++|+++              .+++..|.++
T Consensus         8 ~~~~~~~v~C~~~~L~~-----------------iP~~lp--~~l~~L~Ls~N~i~--------------~l~~~~f~~l   54 (266)
T d1p9ag_           8 KVASHLEVNCDKRNLTA-----------------LPPDLP--KDTTILHLSENLLY--------------TFSLATLMPY   54 (266)
T ss_dssp             CSTTCCEEECTTSCCSS-----------------CCSCCC--TTCCEEECTTSCCS--------------EEEGGGGTTC
T ss_pred             ccCCCeEEEccCCCCCe-----------------eCcCcC--cCCCEEECcCCcCC--------------CcCHHHhhcc
Confidence            34555667777777754                 777664  57899999998877              5667779999


Q ss_pred             cCCcEEEcccCCCcccCcccccCCCccEEecCCCCCcccCccccCCCCCcEEEccCCCCC----------CCccEEEccC
Q psy10538        126 RSLEELLLDANHIRDLPKNFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNGCN----------RQVEYVDKRH  195 (288)
Q Consensus       126 ~~L~~L~l~~n~i~~lp~~~~~l~~L~~L~l~~n~l~~l~~~l~~~~~L~~L~l~~n~~~----------~~L~~L~l~~  195 (288)
                      ++|++|++++|+|+.+|. +..+++|++|++++|+++..+..+..+++|+.+++++|.+.          .++++|++++
T Consensus        55 ~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~  133 (266)
T d1p9ag_          55 TRLTQLNLDRAELTKLQV-DGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKG  133 (266)
T ss_dssp             TTCCEEECTTSCCCEEEC-CSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTT
T ss_pred             cccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccceeeccccccccccccccccc
Confidence            999999999999998864 56799999999999999988888889999999999999765          3789999999


Q ss_pred             CCCCCCChHHHhcCCCcceeecccCcccccCCccccccCCCCccEEEccCCCCccCCccccCCCCCcEEECcCCCCC
Q psy10538        196 CSLPNVPEDVLRYFRSLEELLLDANHIRDLPKNYLDFFRLNRLRKLGLSDNEIHRLPPEIQNFENLVELDVSRNAPS  272 (288)
Q Consensus       196 n~l~~~~~~~~~~~~~L~~L~l~~n~l~~l~~~~~~~~~l~~L~~L~l~~n~l~~~p~~l~~~~~L~~L~L~~N~l~  272 (288)
                      |.++.+++..+..+++++.+++++|+++.++...  ++.+++|++|++++|+|+.+|..+..+++|+.|+|++|++.
T Consensus       134 n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~--~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~Np~~  208 (266)
T d1p9ag_         134 NELKTLPPGLLTPTPKLEKLSLANNNLTELPAGL--LNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWL  208 (266)
T ss_dssp             SCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTT--TTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEECCSCCBC
T ss_pred             cccceeccccccccccchhcccccccccccCccc--cccccccceeecccCCCcccChhHCCCCCCCEEEecCCCCC
Confidence            9999999998888999999999999999888753  78899999999999999999999989999999999999876



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure