Psyllid ID: psy10546


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR
cccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccHHHHcccccccccccEEEccccccccccccccccccccEEEccccccccccHHHHHcHHHcccEEEccccccccccHHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccHHHHHcccccccEEcccccccccccccccccccccccccEEEccccccccccHHHHccccccccEEEccccccccccHHHHccccccc
ccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEccccccccccccccHHHHcccccccEEEcccccccEccHHHHccccEEEEEcccccccEccHHHHcccHHHccEEEccccccccccHHHHcccccccEEEcccccccEcccHHHcccccccEEEccccccccccHHHHHccHcccEEEccccccccccHHHcccccccEEEcccccccEccccccHHHcccHcccEEEccccccccccHHHHHcHHHHHcEEEccccccccccHHHHcccHccc
MTSHFSPFHLVTLILLTALIqggsaqcpwedeseselqSTCICSYNTANELSiqcndltnyplFKATlnkhvntkvPLDLLYINNSAIrninentfngifiknlqlshcrinsitpnaFRHLEFTLKHLNlqendleqvpVETLRHLknltlidlsknkigkipddsfstLNNLVTLklsdnnltlyKNSFRGLELSLKnlnlkntklksVPECIKGLKSLTFLDLAQNLLtqlpgnnmgifknlnsltALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNltlidlsknkigkipddsfSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNnlltefptkaintlrelr
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGlelslknlnlkntklkSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTlsslsllnnllTEFPTKAINTLRELR
*****SPFHLVTLILLTALIQGGSAQCPWED****ELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAI*******
**SHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLREL*
MTSHFSPFHLVTLILLTALIQGG***************STCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR
**SHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTL*EL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
A4IIW9 606 Leucine-rich repeat and i yes N/A 0.859 0.422 0.299 1e-15
P12024 1315 Chaoptin OS=Drosophila me no N/A 0.718 0.162 0.311 2e-15
Q9BXB1 951 Leucine-rich repeat-conta yes N/A 0.687 0.215 0.306 2e-14
Q9Z2H4 951 Leucine-rich repeat-conta no N/A 0.634 0.198 0.316 1e-13
Q9Z1P4 907 Leucine-rich repeat-conta yes N/A 0.842 0.276 0.286 1e-13
O75473 907 Leucine-rich repeat-conta no N/A 0.758 0.249 0.307 2e-13
A2ARI4 951 Leucine-rich repeat-conta no N/A 0.697 0.218 0.306 4e-13
Q6P1C6 1117 Leucine-rich repeats and no N/A 0.741 0.197 0.307 4e-13
Q9Y4C4 1052 Malignant fibrous histioc no N/A 0.604 0.171 0.331 6e-13
P35858 605 Insulin-like growth facto no N/A 0.805 0.396 0.292 8e-13
>sp|A4IIW9|LIGO1_XENTR Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Xenopus tropicalis GN=lingo1 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/297 (29%), Positives = 146/297 (49%), Gaps = 41/297 (13%)

Query: 11  VTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNK 70
           + LI++ +++ G ++ CP            C CS     + S+ C+        K  L+ 
Sbjct: 12  ILLIVVGSILSGSASGCP----------QRCDCS---PQDRSVLCHR-------KRYLD- 50

Query: 71  HVNTKVPLD--LLYINNSAIRNINENTFNGI-FIKNLQLSHCRINSITPNAFRHLEFTLK 127
            V   +P D  LL ++ + I+ +N++ F+   +++ L+L+   ++ I P AF  L F L+
Sbjct: 51  -VPEGIPTDTRLLDLSKNRIKALNQDEFSAFPYLEELELNENIVSIIEPGAFNGL-FNLR 108

Query: 128 HLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLT-L 186
            L L+ N L+ +P+     L NLT +D+S+NKI  + DD F  L NL +L++ DN+L  +
Sbjct: 109 SLGLRSNRLKLIPLGVFTGLSNLTQLDISENKIVILLDDMFQDLYNLKSLEVGDNDLVYI 168

Query: 187 YKNSFRGLELSLKNLNLKNTKLKSVP----ECIKGLKSLTFLDLAQNLLTQLPGNNMGIF 242
              +FRGL  SL+ L L+   L SVP      + GL +L    L  N++          F
Sbjct: 169 SHRAFRGLN-SLEELTLEKCNLTSVPTEALSHLHGLITLKLRYLNINVIRDYS------F 221

Query: 243 KNLNSLTALNLER-NILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR 298
           K L  L  L +     L  +  N   G+   L+SLS+ ++ L+  P  AI  L  LR
Sbjct: 222 KRLYRLKNLEIAHWPYLDTMTSNGLYGL--NLTSLSITHSNLSSIPYVAIRHLVYLR 276




May play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Xenopus tropicalis (taxid: 8364)
>sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 Back     alignment and function description
>sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 Back     alignment and function description
>sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=2 SV=1 Back     alignment and function description
>sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=2 SV=1 Back     alignment and function description
>sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
270007619 847 hypothetical protein TcasGA2_TC014301 [T 0.949 0.334 0.567 3e-75
328717065 906 PREDICTED: hypothetical protein LOC10016 0.939 0.309 0.569 3e-75
242015296 941 leucine-rich transmembrane protein, puta 0.949 0.300 0.555 2e-72
442625201 982 hattifattener, isoform C [Drosophila mel 0.909 0.275 0.545 7e-69
442625199 981 hattifattener, isoform B [Drosophila mel 0.909 0.276 0.545 7e-69
195114654 1321 GI14569 [Drosophila mojavensis] gi|19391 0.909 0.205 0.538 9e-69
158297416 961 AGAP007846-PA [Anopheles gambiae str. PE 0.949 0.294 0.526 2e-68
308737016 664 RT10042p [Drosophila melanogaster] 0.906 0.406 0.543 3e-68
195386074 1288 GJ17086 [Drosophila virilis] gi|19414818 0.912 0.211 0.528 8e-68
194762211 1270 GF15849 [Drosophila ananassae] gi|190616 0.926 0.217 0.532 1e-67
>gi|270007619|gb|EFA04067.1| hypothetical protein TcasGA2_TC014301 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  288 bits (736), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/287 (56%), Positives = 212/287 (73%), Gaps = 4/287 (1%)

Query: 13  LILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHV 72
           +    ALI   SAQCPW+ ES  +LQS+C+CSYN  +ELS+QC D+ ++P   A L K+ 
Sbjct: 7   IATFVALITLASAQCPWQRES-VDLQSSCLCSYNLGHELSVQC-DMVDWPKLLAALQKYA 64

Query: 73  NTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQ 132
            T  PLDLLY+NNS I  +N+N F  + + NLQLS C+INS+    F+  E  LK+LNLQ
Sbjct: 65  -TATPLDLLYVNNSTIGALNDNIFVNLRVHNLQLSGCKINSVAGGTFKGQEQHLKNLNLQ 123

Query: 133 ENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFR 192
           +NDL +VPVE+LR L+ L+L+DLS N+I  +PD +F TL  L TLKLSDNN+TL   + +
Sbjct: 124 DNDLTEVPVESLRPLRTLSLLDLSHNRISAVPDGAFETLKKLATLKLSDNNVTLSLEALK 183

Query: 193 GLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPG-NNMGIFKNLNSLTAL 251
           GLE SLKNLNLK T+ K +PE +K LK+L FLDL+QN L +LPG   +  F+ LNSLTAL
Sbjct: 184 GLEGSLKNLNLKGTRQKDIPEAVKNLKTLAFLDLSQNSLRELPGMTGLKSFEGLNSLTAL 243

Query: 252 NLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR 298
           NLERN++Q+L++NAF GVE TLSSLSLLNNLL +FPT+A++ L ELR
Sbjct: 244 NLERNLIQKLDKNAFQGVEKTLSSLSLLNNLLPDFPTEALSVLSELR 290




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328717065|ref|XP_001952046.2| PREDICTED: hypothetical protein LOC100165587 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242015296|ref|XP_002428300.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] gi|212512885|gb|EEB15562.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|442625201|ref|NP_608607.2| hattifattener, isoform C [Drosophila melanogaster] gi|442625205|ref|NP_001259875.1| hattifattener, isoform E [Drosophila melanogaster] gi|440213134|gb|AAF51357.2| hattifattener, isoform C [Drosophila melanogaster] gi|440213136|gb|AGB92412.1| hattifattener, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625199|ref|NP_001259873.1| hattifattener, isoform B [Drosophila melanogaster] gi|442625203|ref|NP_001259874.1| hattifattener, isoform D [Drosophila melanogaster] gi|440213133|gb|AGB92410.1| hattifattener, isoform B [Drosophila melanogaster] gi|440213135|gb|AGB92411.1| hattifattener, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195114654|ref|XP_002001882.1| GI14569 [Drosophila mojavensis] gi|193912457|gb|EDW11324.1| GI14569 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|158297416|ref|XP_317652.4| AGAP007846-PA [Anopheles gambiae str. PEST] gi|157015184|gb|EAA12609.4| AGAP007846-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|308737016|gb|ADO34904.1| RT10042p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195386074|ref|XP_002051729.1| GJ17086 [Drosophila virilis] gi|194148186|gb|EDW63884.1| GJ17086 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194762211|ref|XP_001963249.1| GF15849 [Drosophila ananassae] gi|190616946|gb|EDV32470.1| GF15849 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
FB|FBgn0261509 1316 haf "hattifattener" [Drosophil 0.969 0.219 0.451 1.3e-59
WB|WBGene00002282 773 let-4 [Caenorhabditis elegans 0.835 0.322 0.285 2.4e-20
FB|FBgn0000313 1315 chp "chaoptic" [Drosophila mel 0.721 0.163 0.290 3.8e-17
UNIPROTKB|P35858 605 IGFALS "Insulin-like growth fa 0.788 0.388 0.275 1.9e-16
WB|WBGene00010621 961 egg-6 [Caenorhabditis elegans 0.802 0.248 0.248 8.3e-16
FB|FBgn0033250470 CG14762 [Drosophila melanogast 0.637 0.404 0.306 3.6e-15
WB|WBGene00003915 594 pan-1 [Caenorhabditis elegans 0.785 0.393 0.253 5.9e-15
UNIPROTKB|Q9BXB1 951 LGR4 "Leucine-rich repeat-cont 0.872 0.273 0.269 9.6e-15
UNIPROTKB|F1MT22 907 LGR5 "Uncharacterized protein" 0.812 0.266 0.270 2.9e-14
RGD|1307733 907 Lgr5 "leucine rich repeat cont 0.798 0.262 0.312 5.6e-14
FB|FBgn0261509 haf "hattifattener" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 1.3e-59, P = 1.3e-59
 Identities = 134/297 (45%), Positives = 179/297 (60%)

Query:     7 PFHLVTLILLTALIQG----GSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYP 62
             P     L+LL  LI G      AQCPW+ +   +LQ++CIC+YN   ELS+QC D  ++ 
Sbjct:    11 PAATTPLLLLLPLILGRLHVAHAQCPWQRDVP-DLQTSCICAYNLGRELSVQC-DQVDFS 68

Query:    63 LFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHL 122
                A +N H   K P+DLLY+NNS I  + +  F+ + + NLQLS C I  I   AF+  
Sbjct:    69 QLLAAMNTHARLK-PVDLLYVNNSTISELPDAVFSNLSLHNLQLSSCGIQRIATGAFKGQ 127

Query:   123 EFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDN 182
             E  L++LNLQ+N L  VPVE L+ L  L L+DLSKN++  IPDD+F  L  L TLKL+DN
Sbjct:   128 ESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDN 187

Query:   183 NLTLYKNSFRGXXXXXXXXXXXXXXXXSVPECIKGLKSLTFLDLAQNLLTQLPG-NNMGI 241
             N+TL  N+FRG                 VPE I+GLKSL FLDL+QN + +LPG   + +
Sbjct:   188 NVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQNGIKELPGAGGIRV 247

Query:   242 FKNLNSLTALNLERNILQELNENAFLGVEDTXXXXXXXXXXXTEFPTKAINTLRELR 298
             F  L++LTALNLERN++Q + E AF GV  T            EFP  A+++L+ELR
Sbjct:   248 FDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELR 304


GO:0008045 "motor neuron axon guidance" evidence=IMP
WB|WBGene00002282 let-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0000313 chp "chaoptic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P35858 IGFALS "Insulin-like growth factor-binding protein complex acid labile subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00010621 egg-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00003915 pan-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXB1 LGR4 "Leucine-rich repeat-containing G-protein coupled receptor 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT22 LGR5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1307733 Lgr5 "leucine rich repeat containing G protein coupled receptor 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 48.3 bits (116), Expect = 6e-08
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 126 LKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNL 184
           LK L+L  N L  +P    + L NL ++DLS N +  I  ++FS L +L +L LS NNL
Sbjct: 2   LKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
KOG4237|consensus 498 99.96
KOG4194|consensus 873 99.95
KOG4194|consensus 873 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG0444|consensus 1255 99.83
KOG0444|consensus 1255 99.83
KOG4237|consensus 498 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG0472|consensus 565 99.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG0472|consensus 565 99.74
KOG0617|consensus264 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0618|consensus 1081 99.7
KOG0617|consensus264 99.68
KOG0618|consensus 1081 99.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.59
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.53
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.4
KOG0532|consensus 722 99.39
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
KOG1259|consensus490 99.27
KOG3207|consensus 505 99.22
KOG3207|consensus 505 99.17
KOG0532|consensus 722 99.14
KOG1859|consensus 1096 99.1
KOG1259|consensus490 99.1
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.1
KOG0531|consensus 414 99.06
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.06
KOG1909|consensus382 98.96
KOG1909|consensus382 98.93
KOG0531|consensus414 98.87
KOG2120|consensus419 98.78
PLN03150623 hypothetical protein; Provisional 98.77
PLN03150623 hypothetical protein; Provisional 98.76
KOG1644|consensus233 98.72
KOG2982|consensus 418 98.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.54
KOG4579|consensus177 98.54
KOG4658|consensus 889 98.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.49
KOG2120|consensus419 98.48
KOG4579|consensus177 98.45
KOG1859|consensus 1096 98.45
KOG1644|consensus233 98.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
KOG4658|consensus 889 98.26
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.99
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG2982|consensus 418 97.94
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.92
KOG3665|consensus 699 97.72
KOG2739|consensus260 97.58
KOG3665|consensus 699 97.52
KOG2123|consensus 388 97.29
KOG2123|consensus 388 97.19
KOG2739|consensus260 97.04
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.74
smart0037026 LRR Leucine-rich repeats, outliers. 95.74
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.31
smart0037026 LRR Leucine-rich repeats, outliers. 94.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.85
KOG3864|consensus221 94.15
KOG0473|consensus 326 93.03
KOG3864|consensus221 92.49
KOG4341|consensus 483 92.42
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 92.38
KOG0473|consensus 326 92.29
KOG4308|consensus 478 91.85
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 91.0
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.4
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.74
KOG4308|consensus 478 88.96
KOG4341|consensus483 88.85
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.49
KOG1947|consensus 482 84.77
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.22
>KOG4237|consensus Back     alignment and domain information
Probab=99.96  E-value=1.4e-30  Score=216.25  Aligned_cols=245  Identities=27%  Similarity=0.388  Sum_probs=198.0

Q ss_pred             CcceecCCCCCceEeeecCCCCchhhHHHhhhhcCCccccceEEecCCcccccCcCCCCCc-ceeEEEecCCCCCccChh
Q psy10546         39 STCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGI-FIKNLQLSHCRINSITPN  117 (298)
Q Consensus        39 ~~C~C~~~~~~~~~v~c~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~-~L~~L~l~~n~l~~~~~~  117 (298)
                      ..|.|+.-.  ...|+|+ ..++.++|..+|..+      ..+++..|+|+.||++.|+.. +|++|||++|+|+.|.|.
T Consensus        39 ~pC~Cs~~~--g~~VdCr-~~GL~eVP~~LP~~t------veirLdqN~I~~iP~~aF~~l~~LRrLdLS~N~Is~I~p~  109 (498)
T KOG4237|consen   39 APCTCSDVE--GGIVDCR-GKGLTEVPANLPPET------VEIRLDQNQISSIPPGAFKTLHRLRRLDLSKNNISFIAPD  109 (498)
T ss_pred             CCcccCCCC--CceEEcc-CCCcccCcccCCCcc------eEEEeccCCcccCChhhccchhhhceecccccchhhcChH
Confidence            679997432  6799999 899999999999766      789999999999999999877 899999999999999999


Q ss_pred             hhhhhhccCcEEEccC-CCCcccChHhhhcCCCCCEEEccCCcCCcCCcccccCCccCcEEeccCCcccccccccccccc
Q psy10546        118 AFRHLEFTLKHLNLQE-NDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLEL  196 (298)
Q Consensus       118 ~f~~~~~~L~~L~l~~-n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~  196 (298)
                      +|.++. ++..|-+.+ |+|+.++.+.|.++..++.|.+.-|++.-+..+.|..++++..|.+.+|.+..+....+..+.
T Consensus       110 AF~GL~-~l~~Lvlyg~NkI~~l~k~~F~gL~slqrLllNan~i~Cir~~al~dL~~l~lLslyDn~~q~i~~~tf~~l~  188 (498)
T KOG4237|consen  110 AFKGLA-SLLSLVLYGNNKITDLPKGAFGGLSSLQRLLLNANHINCIRQDALRDLPSLSLLSLYDNKIQSICKGTFQGLA  188 (498)
T ss_pred             hhhhhH-hhhHHHhhcCCchhhhhhhHhhhHHHHHHHhcChhhhcchhHHHHHHhhhcchhcccchhhhhhccccccchh
Confidence            999999 776666665 999999998888888888888888888777777777777777777777766544332111111


Q ss_pred             Cc----------------------------------------------------------cEE----EcCCCcCCCcc-c
Q psy10546        197 SL----------------------------------------------------------KNL----NLKNTKLKSVP-E  213 (298)
Q Consensus       197 ~L----------------------------------------------------------~~L----~l~~n~l~~~~-~  213 (298)
                      .+                                                          +.+    .-..+....-| .
T Consensus       189 ~i~tlhlA~np~icdCnL~wla~~~a~~~ietsgarc~~p~rl~~~Ri~q~~a~kf~c~~esl~s~~~~~d~~d~~cP~~  268 (498)
T KOG4237|consen  189 AIKTLHLAQNPFICDCNLPWLADDLAMNPIETSGARCVSPYRLYYKRINQEDARKFLCSLESLPSRLSSEDFPDSICPAK  268 (498)
T ss_pred             ccchHhhhcCccccccccchhhhHHhhchhhcccceecchHHHHHHHhcccchhhhhhhHHhHHHhhccccCcCCcChHH
Confidence            11                                                          111    11111122334 4


Q ss_pred             cccCCCCCCEEeCCCCCCCcCCCCCcccCCCCCCCCEEECCCCcccccChhhhhhhhcCCCEEEcCCCcCCccchHHhhh
Q psy10546        214 CIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINT  293 (298)
Q Consensus       214 ~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~  293 (298)
                      .|..+++|+.|+|++|.+++|.+   .+|.+..++++|.|..|++..+....|.++. .|+.|++++|+|+.+.+++|..
T Consensus       269 cf~~L~~L~~lnlsnN~i~~i~~---~aFe~~a~l~eL~L~~N~l~~v~~~~f~~ls-~L~tL~L~~N~it~~~~~aF~~  344 (498)
T KOG4237|consen  269 CFKKLPNLRKLNLSNNKITRIED---GAFEGAAELQELYLTRNKLEFVSSGMFQGLS-GLKTLSLYDNQITTVAPGAFQT  344 (498)
T ss_pred             HHhhcccceEeccCCCccchhhh---hhhcchhhhhhhhcCcchHHHHHHHhhhccc-cceeeeecCCeeEEEecccccc
Confidence            68899999999999999999888   8899999999999999999999999999988 7999999999999999999988


Q ss_pred             hhcc
Q psy10546        294 LREL  297 (298)
Q Consensus       294 l~~L  297 (298)
                      +..|
T Consensus       345 ~~~l  348 (498)
T KOG4237|consen  345 LFSL  348 (498)
T ss_pred             ccee
Confidence            7655



>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-11
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 3e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-11
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-08
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-11
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 5e-08
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-08
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-08
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 3e-07
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 4e-07
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-07
3zyn_A 321 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-07
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 1e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 3e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-04
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 3e-04
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 3e-04
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-04
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 4e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 7e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 7e-04
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 37/111 (33%), Positives = 66/111 (59%), Gaps = 3/111 (2%) Query: 84 NNSAIRNINENTFNGIF-IKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVE 142 +N+ +R+++ TF+G+ + L L C + + P FR L L++L LQ+N L+ +P + Sbjct: 88 DNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLA-ALQYLYLQDNALQALPDD 146 Query: 143 TLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLT-LYKNSFR 192 T R L NLT + L N+I +P+ +F L++L L L N + ++ ++FR Sbjct: 147 TFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFR 197
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-37
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-27
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-27
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-27
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-26
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-20
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-20
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-22
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-21
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-20
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A 229 Variable lymphocyte receptor diversity region; var 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-11
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
 Score =  141 bits (358), Expect = 3e-39
 Identities = 76/298 (25%), Positives = 122/298 (40%), Gaps = 38/298 (12%)

Query: 8   FHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCND--LTNYPLFK 65
             L  L++      G +  CP          S C CS        + C    L   P   
Sbjct: 16  SLLSVLLMGCVAETGSAQTCP----------SVCSCS---NQFSKVICVRKNLREVP--- 59

Query: 66  ATLNKHVNTKVPLDL--LYINNSAIRNINENTFNG-IFIKNLQLSHCRINSITPNAFRHL 122
                     +  +   L ++ + I+ I  N+F     ++ LQLS   I +I   AF  L
Sbjct: 60  --------DGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGL 111

Query: 123 EFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDN 182
              L  L L +N L  +P     +L  L  + L  N I  IP  +F+ + +L  L L + 
Sbjct: 112 A-NLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGEL 170

Query: 183 NL--TLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMG 240
                + + +F GL  +L+ LNL    L+ +P  +  L  L  LDL+ N L+ +     G
Sbjct: 171 KRLSYISEGAFEGLS-NLRYLNLAMCNLREIPN-LTPLIKLDELDLSGNHLSAIRP---G 225

Query: 241 IFKNLNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLRELR 298
            F+ L  L  L + ++ +Q +  NAF  ++ +L  ++L +N LT  P      L  L 
Sbjct: 226 SFQGLMHLQKLWMIQSQIQVIERNAFDNLQ-SLVEINLAHNNLTLLPHDLFTPLHHLE 282


>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 100.0
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.91
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.91
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.84
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.79
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.49
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.46
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.45
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.37
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.33
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 87.23
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.98
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.6e-34  Score=255.31  Aligned_cols=248  Identities=28%  Similarity=0.393  Sum_probs=218.7

Q ss_pred             ccCCCcceecCCCCCceEeeecCCCCchhhHHHhhhhcCCccccceEEecCCcccccCcCCCCCc-ceeEEEecCCCCCc
Q psy10546         35 SELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGI-FIKNLQLSHCRINS  113 (298)
Q Consensus        35 ~~~~~~C~C~~~~~~~~~v~c~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~-~L~~L~l~~n~l~~  113 (298)
                      ..||..|.|...   ...+.|. ..++..+|..++      ..++.|++++|.+..++...|... +|++|++++|+++.
T Consensus        33 ~~Cp~~C~C~~~---~~~v~c~-~~~l~~iP~~~~------~~l~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~  102 (440)
T 3zyj_A           33 QTCPSVCSCSNQ---FSKVICV-RKNLREVPDGIS------TNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRT  102 (440)
T ss_dssp             CCCCSSSEECTT---SCEEECC-SCCCSSCCSCCC------TTCSEEECCSCCCCEECTTTTSSCSSCCEEECCSSCCCE
T ss_pred             ccCCCCCEeCCC---CCEEEeC-CCCcCcCCCCCC------CCCcEEEccCCcCCeeCHHHhhCCCCCCEEECCCCcCCc
Confidence            344477999742   3478898 566776665554      456899999999999998888665 89999999999999


Q ss_pred             cChhhhhhhhccCcEEEccCCCCcccChHhhhcCCCCCEEEccCCcCCcCCcccccCCccCcEEeccC-Ccccccccccc
Q psy10546        114 ITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSD-NNLTLYKNSFR  192 (298)
Q Consensus       114 ~~~~~f~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~-n~~~~~~~~~~  192 (298)
                      +.+.+|.++. +|++|+|++|+++.+++..|..+++|++|++++|++..+++..|..+++|+.|++++ +.+..++...+
T Consensus       103 i~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~  181 (440)
T 3zyj_A          103 IEIGAFNGLA-NLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAF  181 (440)
T ss_dssp             ECGGGGTTCS-SCCEEECCSSCCSSCCTTTSCSCSSCCEEECCSCCCCEECTTTTTTCTTCCEEECCCCTTCCEECTTTT
T ss_pred             cChhhccCCc-cCCEEECCCCcCCeeCHhHhhccccCceeeCCCCcccccCHHHhhhCcccCEeCCCCCCCcceeCcchh
Confidence            9999999998 999999999999999988899999999999999999999998999999999999998 56667777667


Q ss_pred             ccccCccEEEcCCCcCCCccccccCCCCCCEEeCCCCCCCcCCCCCcccCCCCCCCCEEECCCCcccccChhhhhhhhcC
Q psy10546        193 GLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDT  272 (298)
Q Consensus       193 ~~~~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~  272 (298)
                      ..+++|++|++++|.++.+| .+..+++|++|++++|.++.+++   ..|.++++|++|++++|+++++++..|.++. +
T Consensus       182 ~~l~~L~~L~L~~n~l~~~~-~~~~l~~L~~L~Ls~N~l~~~~~---~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-~  256 (440)
T 3zyj_A          182 EGLSNLRYLNLAMCNLREIP-NLTPLIKLDELDLSGNHLSAIRP---GSFQGLMHLQKLWMIQSQIQVIERNAFDNLQ-S  256 (440)
T ss_dssp             TTCSSCCEEECTTSCCSSCC-CCTTCSSCCEEECTTSCCCEECT---TTTTTCTTCCEEECTTCCCCEECTTSSTTCT-T
T ss_pred             hcccccCeecCCCCcCcccc-ccCCCcccCEEECCCCccCccCh---hhhccCccCCEEECCCCceeEEChhhhcCCC-C
Confidence            77789999999999999887 47889999999999999998876   6788999999999999999999998888887 7


Q ss_pred             CCEEEcCCCcCCccchHHhhhhhccC
Q psy10546        273 LSSLSLLNNLLTEFPTKAINTLRELR  298 (298)
Q Consensus       273 L~~L~l~~n~i~~~~~~~~~~l~~L~  298 (298)
                      |+.|++++|.++.+++..|.++++|+
T Consensus       257 L~~L~L~~N~l~~~~~~~~~~l~~L~  282 (440)
T 3zyj_A          257 LVEINLAHNNLTLLPHDLFTPLHHLE  282 (440)
T ss_dssp             CCEEECTTSCCCCCCTTTTSSCTTCC
T ss_pred             CCEEECCCCCCCccChhHhccccCCC
Confidence            99999999999999999988887764



>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 56.2 bits (134), Expect = 9e-10
 Identities = 36/173 (20%), Positives = 70/173 (40%), Gaps = 7/173 (4%)

Query: 125 TLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNL 184
               L+LQ N + ++     ++LKNL  + L  NKI KI   +F+ L  L  L LS N L
Sbjct: 32  DTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQL 91

Query: 185 TLYKNSFRGLELSLKNLNLKNTKLKSVPECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKN 244
                    +  +L+ L +   ++  V + +    +   +        +  G   G F+ 
Sbjct: 92  K---ELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQG 148

Query: 245 LNSLTALNLERNILQELNENAFLGVEDTLSSLSLLNNLLTEFPTKAINTLREL 297
           +  L+ + +    +  + +        +L+ L L  N +T+    ++  L  L
Sbjct: 149 MKKLSYIRIADTNITTIPQGLP----PSLTELHLDGNKITKVDAASLKGLNNL 197


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.23
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=9.1e-30  Score=212.58  Aligned_cols=235  Identities=23%  Similarity=0.329  Sum_probs=206.3

Q ss_pred             CCCcceecCCCCCceEeeecCCCCchhhHHHhhhhcCCccccceEEecCCcccccCcCCCCCc-ceeEEEecCCCCCccC
Q psy10546         37 LQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGI-FIKNLQLSHCRINSIT  115 (298)
Q Consensus        37 ~~~~C~C~~~~~~~~~v~c~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~-~L~~L~l~~n~l~~~~  115 (298)
                      ||..|.|...  .+..|.|++ .++..+|..++      ..+++|++++|.++++++..|... +|+.|++++|++..+.
T Consensus         2 cp~~C~C~~~--~~~~v~c~~-~~L~~iP~~ip------~~~~~L~Ls~N~i~~i~~~~f~~l~~L~~L~ls~n~l~~i~   72 (284)
T d1ozna_           2 CPGACVCYNE--PKVTTSCPQ-QGLQAVPVGIP------AASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARID   72 (284)
T ss_dssp             CCTTCEEECS--SSCEEECCS-SCCSSCCTTCC------TTCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCEEC
T ss_pred             cCCCCEEcCC--CCeEEEcCC-CCCCccCCCCC------CCCCEEECcCCcCCCCCHHHhhccccccccccccccccccc
Confidence            4478999632  467899984 56666665555      345899999999999999988766 8999999999999999


Q ss_pred             hhhhhhhhccCcEEEcc-CCCCcccChHhhhcCCCCCEEEccCCcCCcCCcccccCCccCcEEeccCCcccccccccccc
Q psy10546        116 PNAFRHLEFTLKHLNLQ-ENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGL  194 (298)
Q Consensus       116 ~~~f~~~~~~L~~L~l~-~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~  194 (298)
                      +..+.+.. .++++.+. .+.+..+++..|.++++|++|++++|.+..+....+....+|+.+++++|.++.++...+..
T Consensus        73 ~~~~~~~~-~~~~l~~~~~~~~~~l~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~l~l~~N~l~~i~~~~f~~  151 (284)
T d1ozna_          73 AAAFTGLA-LLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRD  151 (284)
T ss_dssp             TTTTTTCT-TCCEEECCSCTTCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTT
T ss_pred             cccccccc-cccccccccccccccccchhhcccccCCEEecCCcccccccccccchhcccchhhhccccccccChhHhcc
Confidence            99998888 88888765 66788998889999999999999999999888888889999999999999999988777776


Q ss_pred             ccCccEEEcCCCcCCCcc-ccccCCCCCCEEeCCCCCCCcCCCCCcccCCCCCCCCEEECCCCcccccChhhhhhhhcCC
Q psy10546        195 ELSLKNLNLKNTKLKSVP-ECIKGLKSLTFLDLAQNLLTQLPGNNMGIFKNLNSLTALNLERNILQELNENAFLGVEDTL  273 (298)
Q Consensus       195 ~~~L~~L~l~~n~l~~~~-~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L  273 (298)
                      ..+|+.|++++|.++.++ ..|.++++|+++++++|+++.+.+   ..|.+++++++|++++|.+.++++..|.... +|
T Consensus       152 ~~~L~~L~l~~N~l~~l~~~~f~~l~~L~~l~l~~N~l~~i~~---~~f~~l~~L~~L~l~~N~i~~~~~~~~~~~~-~L  227 (284)
T d1ozna_         152 LGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHP---HAFRDLGRLMTLYLFANNLSALPTEALAPLR-AL  227 (284)
T ss_dssp             CTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCCEECT---TTTTTCTTCCEEECCSSCCSCCCHHHHTTCT-TC
T ss_pred             ccchhhcccccCcccccchhhhccccccchhhhhhccccccCh---hHhhhhhhccccccccccccccccccccccc-cc
Confidence            689999999999999886 678899999999999999998776   7789999999999999999999999998877 79


Q ss_pred             CEEEcCCCcCCc
Q psy10546        274 SSLSLLNNLLTE  285 (298)
Q Consensus       274 ~~L~l~~n~i~~  285 (298)
                      ++|++++|++.-
T Consensus       228 ~~L~l~~N~l~C  239 (284)
T d1ozna_         228 QYLRLNDNPWVC  239 (284)
T ss_dssp             CEEECCSSCEEC
T ss_pred             CEEEecCCCCCC
Confidence            999999999873



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure