Psyllid ID: psy10619
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| 321477841 | 716 | hypothetical protein DAPPUDRAFT_187192 [ | 0.589 | 0.202 | 0.744 | 6e-68 | |
| 270007015 | 638 | hypothetical protein TcasGA2_TC013459 [T | 0.727 | 0.280 | 0.670 | 1e-62 | |
| 91083023 | 684 | PREDICTED: similar to Propionyl-CoA carb | 0.727 | 0.261 | 0.670 | 1e-62 | |
| 395527353 | 828 | PREDICTED: propionyl-CoA carboxylase alp | 0.711 | 0.211 | 0.677 | 2e-62 | |
| 296481629 | 715 | TPA: propionyl-CoA carboxylase alpha cha | 0.699 | 0.240 | 0.686 | 8e-62 | |
| 118084650 | 713 | PREDICTED: propionyl-CoA carboxylase alp | 0.699 | 0.241 | 0.691 | 8e-62 | |
| 134085958 | 741 | propionyl-CoA carboxylase alpha chain, m | 0.699 | 0.232 | 0.686 | 8e-62 | |
| 148668300 | 699 | propionyl-Coenzyme A carboxylase, alpha | 0.699 | 0.246 | 0.686 | 2e-61 | |
| 348583772 | 702 | PREDICTED: propionyl-CoA carboxylase alp | 0.699 | 0.245 | 0.697 | 2e-61 | |
| 348583768 | 728 | PREDICTED: propionyl-CoA carboxylase alp | 0.699 | 0.236 | 0.697 | 3e-61 |
| >gi|321477841|gb|EFX88799.1| hypothetical protein DAPPUDRAFT_187192 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 263 bits (671), Expect = 6e-68, Method: Compositional matrix adjust.
Identities = 128/172 (74%), Positives = 151/172 (87%)
Query: 12 HVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEGV 71
HVK+ADEAVCIGPP +SY+N+DKI+ I+QT + AVHPGYGFLSENA FV+ L+ EGV
Sbjct: 88 HVKMADEAVCIGPPATRESYLNMDKILSVIKQTGSQAVHPGYGFLSENAEFVTILEREGV 147
Query: 72 VFIGPTAECIRGMGDKLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKAS 131
FIGP+A I GMGDK+ESKK+AKEAGV++IPGF+G++ D DHC++IARDIGYPVMIKAS
Sbjct: 148 AFIGPSAHAISGMGDKIESKKVAKEAGVHVIPGFDGVVVDEDHCIQIARDIGYPVMIKAS 207
Query: 132 AGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDDRILVEKFIKNPRHIEIQ 183
AGGGGKGMRIA ND EA EGF+LS QEAA+SFGDDR+LVEKF+ NPRHIEIQ
Sbjct: 208 AGGGGKGMRIAWNDAEAREGFRLSKQEAASSFGDDRMLVEKFVDNPRHIEIQ 259
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270007015|gb|EFA03463.1| hypothetical protein TcasGA2_TC013459 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91083023|ref|XP_974679.1| PREDICTED: similar to Propionyl-CoA carboxylase alpha chain, mitochondrial precursor (PCCase subunit alpha) (Propanoyl-CoA:carbon dioxide ligase subunit alpha) [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|395527353|ref|XP_003765814.1| PREDICTED: propionyl-CoA carboxylase alpha chain, mitochondrial, partial [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
| >gi|296481629|tpg|DAA23744.1| TPA: propionyl-CoA carboxylase alpha chain, mitochondrial [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|118084650|ref|XP_416970.2| PREDICTED: propionyl-CoA carboxylase alpha chain, mitochondrial [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|134085958|ref|NP_001076978.1| propionyl-CoA carboxylase alpha chain, mitochondrial [Bos taurus] gi|133778161|gb|AAI23877.1| PCCA protein [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|148668300|gb|EDL00630.1| propionyl-Coenzyme A carboxylase, alpha polypeptide, isoform CRA_a [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|348583772|ref|XP_003477646.1| PREDICTED: propionyl-CoA carboxylase alpha chain, mitochondrial-like isoform 3 [Cavia porcellus] | Back alignment and taxonomy information |
|---|
| >gi|348583768|ref|XP_003477644.1| PREDICTED: propionyl-CoA carboxylase alpha chain, mitochondrial-like isoform 1 [Cavia porcellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| UNIPROTKB|F1P0M2 | 690 | PCCA "Uncharacterized protein" | 0.699 | 0.249 | 0.691 | 5.9e-76 | |
| UNIPROTKB|F6QNC4 | 741 | PCCA "Uncharacterized protein" | 0.699 | 0.232 | 0.686 | 2.3e-74 | |
| MGI|MGI:97499 | 724 | Pcca "propionyl-Coenzyme A car | 0.699 | 0.237 | 0.686 | 2.5e-73 | |
| UNIPROTKB|P05165 | 728 | PCCA "Propionyl-CoA carboxylas | 0.699 | 0.236 | 0.686 | 2.5e-73 | |
| UNIPROTKB|E2R518 | 731 | PCCA "Uncharacterized protein" | 0.699 | 0.235 | 0.686 | 1.1e-72 | |
| RGD|3264 | 737 | Pcca "propionyl-coenzyme A car | 0.699 | 0.233 | 0.668 | 3.3e-71 | |
| UNIPROTKB|P14882 | 737 | Pcca "Propionyl-CoA carboxylas | 0.699 | 0.233 | 0.668 | 3.3e-71 | |
| TIGR_CMR|SPO_1101 | 681 | SPO_1101 "propionyl-CoA carbox | 0.699 | 0.252 | 0.662 | 7.7e-70 | |
| ZFIN|ZDB-GENE-040718-246 | 721 | pcca "propionyl-Coenzyme A car | 0.699 | 0.238 | 0.680 | 8.7e-65 | |
| UNIPROTKB|E1BR16 | 393 | PCCA "Uncharacterized protein" | 0.699 | 0.437 | 0.691 | 2.3e-62 |
| UNIPROTKB|F1P0M2 PCCA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 637 (229.3 bits), Expect = 5.9e-76, Sum P(2) = 5.9e-76
Identities = 119/172 (69%), Positives = 142/172 (82%)
Query: 12 HVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEGV 71
HVK+ADEAVC+GP ++SY+N+D I++ I++TRA AVHPGYGFLSEN F RL EGV
Sbjct: 62 HVKMADEAVCVGPAPTSKSYLNMDAIMEVIKKTRAQAVHPGYGFLSENKEFARRLAAEGV 121
Query: 72 VFIGPTAECIRGMGDKLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKAS 131
FIGP I+ MGDK+ESK LAK A VN IPGF+G+++DAD V IAR+IGYPVMIKAS
Sbjct: 122 TFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKAS 181
Query: 132 AGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDDRILVEKFIKNPRHIEIQ 183
AGGGGKGMRIA +D+E EGF+ SSQEAA+SFGDDR+L+EKFI NPRHIEIQ
Sbjct: 182 AGGGGKGMRIAWDDEETREGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQ 233
|
|
| UNIPROTKB|F6QNC4 PCCA "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97499 Pcca "propionyl-Coenzyme A carboxylase, alpha polypeptide" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P05165 PCCA "Propionyl-CoA carboxylase alpha chain, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R518 PCCA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|3264 Pcca "propionyl-coenzyme A carboxylase, alpha polypeptide" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14882 Pcca "Propionyl-CoA carboxylase alpha chain, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1101 SPO_1101 "propionyl-CoA carboxylase, alpha subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-246 pcca "propionyl-Coenzyme A carboxylase, alpha polypeptide" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BR16 PCCA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 2e-91 | |
| PRK08591 | 451 | PRK08591, PRK08591, acetyl-CoA carboxylase biotin | 7e-87 | |
| PRK06111 | 450 | PRK06111, PRK06111, acetyl-CoA carboxylase biotin | 1e-79 | |
| TIGR00514 | 449 | TIGR00514, accC, acetyl-CoA carboxylase, biotin ca | 4e-75 | |
| PRK08654 | 499 | PRK08654, PRK08654, pyruvate carboxylase subunit A | 6e-75 | |
| PRK05586 | 447 | PRK05586, PRK05586, biotin carboxylase; Validated | 1e-74 | |
| COG0439 | 449 | COG0439, AccC, Biotin carboxylase [Lipid metabolis | 3e-73 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 4e-70 | |
| PRK12833 | 467 | PRK12833, PRK12833, acetyl-CoA carboxylase biotin | 3e-68 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 2e-63 | |
| COG1038 | 1149 | COG1038, PycA, Pyruvate carboxylase [Energy produc | 9e-61 | |
| PRK08462 | 445 | PRK08462, PRK08462, biotin carboxylase; Validated | 5e-60 | |
| PRK07178 | 472 | PRK07178, PRK07178, pyruvate carboxylase subunit A | 4e-56 | |
| TIGR01235 | 1143 | TIGR01235, pyruv_carbox, pyruvate carboxylase | 9e-53 | |
| PRK08463 | 478 | PRK08463, PRK08463, acetyl-CoA carboxylase subunit | 2e-48 | |
| pfam02786 | 211 | pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha | 2e-37 | |
| pfam00289 | 108 | pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn | 2e-30 | |
| PRK14016 | 727 | PRK14016, PRK14016, cyanophycin synthetase; Provis | 1e-11 | |
| PRK01372 | 304 | PRK01372, ddl, D-alanine--D-alanine ligase; Review | 7e-11 | |
| TIGR01369 | 1050 | TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth | 5e-10 | |
| PRK12815 | 1068 | PRK12815, carB, carbamoyl phosphate synthase large | 1e-09 | |
| COG0458 | 400 | COG0458, CarB, Carbamoylphosphate synthase large s | 7e-09 | |
| PRK05294 | 1066 | PRK05294, carB, carbamoyl phosphate synthase large | 2e-08 | |
| TIGR02068 | 864 | TIGR02068, cya_phycin_syn, cyanophycin synthetase | 5e-08 | |
| PRK05294 | 1066 | PRK05294, carB, carbamoyl phosphate synthase large | 7e-08 | |
| PRK12767 | 326 | PRK12767, PRK12767, carbamoyl phosphate synthase-l | 8e-08 | |
| PRK01966 | 333 | PRK01966, ddl, D-alanyl-alanine synthetase A; Revi | 8e-08 | |
| TIGR01369 | 1050 | TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth | 2e-07 | |
| TIGR01205 | 315 | TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l | 2e-07 | |
| COG0026 | 375 | COG0026, PurK, Phosphoribosylaminoimidazole carbox | 2e-07 | |
| COG0151 | 428 | COG0151, PurD, Phosphoribosylamine-glycine ligase | 6e-07 | |
| TIGR01161 | 352 | TIGR01161, purK, phosphoribosylaminoimidazole carb | 2e-06 | |
| PRK06019 | 372 | PRK06019, PRK06019, phosphoribosylaminoimidazole c | 2e-06 | |
| TIGR00877 | 422 | TIGR00877, purD, phosphoribosylamine--glycine liga | 3e-06 | |
| pfam13535 | 183 | pfam13535, ATP-grasp_4, ATP-grasp domain | 5e-06 | |
| COG1181 | 317 | COG1181, DdlA, D-alanine-D-alanine ligase and rela | 2e-05 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 3e-05 | |
| pfam02222 | 171 | pfam02222, ATP-grasp, ATP-grasp domain | 3e-05 | |
| PRK00885 | 420 | PRK00885, PRK00885, phosphoribosylamine--glycine l | 3e-05 | |
| COG0189 | 318 | COG0189, RimK, Glutathione synthase/Ribosomal prot | 5e-05 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 6e-05 | |
| pfam07478 | 201 | pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-t | 8e-05 | |
| PLN02735 | 1102 | PLN02735, PLN02735, carbamoyl-phosphate synthase | 1e-04 | |
| PLN02735 | 1102 | PLN02735, PLN02735, carbamoyl-phosphate synthase | 2e-04 | |
| PRK12815 | 1068 | PRK12815, carB, carbamoyl phosphate synthase large | 3e-04 | |
| PRK02186 | 887 | PRK02186, PRK02186, argininosuccinate lyase; Provi | 5e-04 | |
| pfam01071 | 193 | pfam01071, GARS_A, Phosphoribosylglycinamide synth | 9e-04 | |
| TIGR02144 | 280 | TIGR02144, LysX_arch, Lysine biosynthesis enzyme L | 0.001 | |
| COG0045 | 387 | COG0045, SucC, Succinyl-CoA synthetase, beta subun | 0.002 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 0.003 |
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
Score = 281 bits (722), Expect = 2e-91
Identities = 104/173 (60%), Positives = 134/173 (77%)
Query: 11 RHVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEG 70
HV++ADEAV IGP AA+SY+++DKIIDA R+T A A+HPGYGFLSENA F +++ G
Sbjct: 40 LHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHPGYGFLSENADFAQAVEDAG 99
Query: 71 VVFIGPTAECIRGMGDKLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKA 130
+VFIGP+A IR MGDK+ +KKLA EAGV +PG++G I+DA V IA +IGYPV+IKA
Sbjct: 100 LVFIGPSAGAIRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKA 159
Query: 131 SAGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDDRILVEKFIKNPRHIEIQ 183
SAGGGGKGMR+ +E E + + +EA ASFGDDR+ +EK++ PRHIEIQ
Sbjct: 160 SAGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQ 212
|
Length = 645 |
| >gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237586 PRK14016, PRK14016, cyanophycin synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223534 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233705 TIGR02068, cya_phycin_syn, cyanophycin synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234993 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase | Back alignment and domain information |
|---|
| >gnl|CDD|223105 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233295 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >gnl|CDD|235674 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233164 TIGR00877, purD, phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|224102 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216935 pfam02222, ATP-grasp, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|234856 PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223267 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|203643 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235010 PRK02186, PRK02186, argininosuccinate lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216282 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain | Back alignment and domain information |
|---|
| >gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX | Back alignment and domain information |
|---|
| >gnl|CDD|223123 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 100.0 | |
| KOG0238|consensus | 670 | 100.0 | ||
| COG0439 | 449 | AccC Biotin carboxylase [Lipid metabolism] | 100.0 | |
| PRK08654 | 499 | pyruvate carboxylase subunit A; Validated | 100.0 | |
| PRK08462 | 445 | biotin carboxylase; Validated | 100.0 | |
| PRK12833 | 467 | acetyl-CoA carboxylase biotin carboxylase subunit; | 100.0 | |
| PRK07178 | 472 | pyruvate carboxylase subunit A; Validated | 100.0 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 100.0 | |
| TIGR00514 | 449 | accC acetyl-CoA carboxylase, biotin carboxylase su | 100.0 | |
| PRK08463 | 478 | acetyl-CoA carboxylase subunit A; Validated | 100.0 | |
| PRK05586 | 447 | biotin carboxylase; Validated | 100.0 | |
| PRK08591 | 451 | acetyl-CoA carboxylase biotin carboxylase subunit; | 100.0 | |
| KOG0369|consensus | 1176 | 99.98 | ||
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.97 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 99.97 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.97 | |
| PRK06111 | 450 | acetyl-CoA carboxylase biotin carboxylase subunit; | 99.97 | |
| PLN02257 | 434 | phosphoribosylamine--glycine ligase | 99.93 | |
| PF15632 | 329 | ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa | 99.93 | |
| PRK13789 | 426 | phosphoribosylamine--glycine ligase; Provisional | 99.93 | |
| TIGR01142 | 380 | purT phosphoribosylglycinamide formyltransferase 2 | 99.93 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 99.93 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 99.92 | |
| PRK00885 | 420 | phosphoribosylamine--glycine ligase; Provisional | 99.92 | |
| PRK13790 | 379 | phosphoribosylamine--glycine ligase; Provisional | 99.92 | |
| PRK12767 | 326 | carbamoyl phosphate synthase-like protein; Provisi | 99.92 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 99.92 | |
| TIGR01161 | 352 | purK phosphoribosylaminoimidazole carboxylase, Pur | 99.91 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 99.91 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 99.91 | |
| TIGR00877 | 423 | purD phosphoribosylamine--glycine ligase. This enz | 99.91 | |
| COG0458 | 400 | CarB Carbamoylphosphate synthase large subunit (sp | 99.91 | |
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 99.91 | |
| PRK06395 | 435 | phosphoribosylamine--glycine ligase; Provisional | 99.91 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 99.91 | |
| PRK05784 | 486 | phosphoribosylamine--glycine ligase; Provisional | 99.91 | |
| COG0151 | 428 | PurD Phosphoribosylamine-glycine ligase [Nucleotid | 99.9 | |
| PRK06019 | 372 | phosphoribosylaminoimidazole carboxylase ATPase su | 99.9 | |
| PRK14569 | 296 | D-alanyl-alanine synthetase A; Provisional | 99.9 | |
| KOG0368|consensus | 2196 | 99.9 | ||
| PRK14568 | 343 | vanB D-alanine--D-lactate ligase; Provisional | 99.9 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 99.89 | |
| PRK14572 | 347 | D-alanyl-alanine synthetase A; Provisional | 99.89 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 99.89 | |
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 99.89 | |
| PRK01966 | 333 | ddl D-alanyl-alanine synthetase A; Reviewed | 99.89 | |
| PRK14570 | 364 | D-alanyl-alanine synthetase A; Provisional | 99.89 | |
| PRK07206 | 416 | hypothetical protein; Provisional | 99.89 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 99.88 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide f | 99.88 | |
| PRK02186 | 887 | argininosuccinate lyase; Provisional | 99.88 | |
| PRK06524 | 493 | biotin carboxylase-like protein; Validated | 99.87 | |
| TIGR01205 | 315 | D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a | 99.86 | |
| PRK14571 | 299 | D-alanyl-alanine synthetase A; Provisional | 99.86 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 99.85 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 99.84 | |
| PRK14016 | 727 | cyanophycin synthetase; Provisional | 99.82 | |
| PF02786 | 211 | CPSase_L_D2: Carbamoyl-phosphate synthase L chain, | 99.81 | |
| PRK10446 | 300 | ribosomal protein S6 modification protein; Provisi | 99.79 | |
| KOG0237|consensus | 788 | 99.78 | ||
| COG0026 | 375 | PurK Phosphoribosylaminoimidazole carboxylase (NCA | 99.78 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.78 | |
| TIGR02144 | 280 | LysX_arch Lysine biosynthesis enzyme LysX. The fam | 99.78 | |
| TIGR00768 | 277 | rimK_fam alpha-L-glutamate ligases, RimK family. T | 99.76 | |
| PRK13278 | 358 | purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D | 99.73 | |
| PF13535 | 184 | ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A | 99.72 | |
| ), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071 | 194 | GARS_A: Phosphoribosylglycinamide synthetase, ATP- | 99.69 | |
| TIGR02068 | 864 | cya_phycin_syn cyanophycin synthetase. Cyanophycin | 99.69 | |
| TIGR01435 | 737 | glu_cys_lig_rel glutamate--cysteine ligase/gamma-g | 99.67 | |
| PRK02471 | 752 | bifunctional glutamate--cysteine ligase/glutathion | 99.67 | |
| COG0189 | 318 | RimK Glutathione synthase/Ribosomal protein S6 mod | 99.66 | |
| COG1181 | 317 | DdlA D-alanine-D-alanine ligase and related ATP-gr | 99.63 | |
| PF07478 | 203 | Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In | 99.62 | |
| PRK13277 | 366 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo | 99.56 | |
| PF08443 | 190 | RimK: RimK-like ATP-grasp domain; InterPro: IPR013 | 99.55 | |
| KOG0370|consensus | 1435 | 99.49 | ||
| PF02222 | 172 | ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T | 99.47 | |
| PLN02941 | 328 | inositol-tetrakisphosphate 1-kinase | 99.46 | |
| PF00289 | 110 | CPSase_L_chain: Carbamoyl-phosphate synthase L cha | 99.43 | |
| PRK12458 | 338 | glutathione synthetase; Provisional | 99.36 | |
| PRK00696 | 388 | sucC succinyl-CoA synthetase subunit beta; Provisi | 99.34 | |
| TIGR01016 | 386 | sucCoAbeta succinyl-CoA synthetase, beta subunit. | 99.33 | |
| TIGR01380 | 312 | glut_syn glutathione synthetase, prokaryotic. This | 99.32 | |
| PRK05246 | 316 | glutathione synthetase; Provisional | 99.3 | |
| KOG0370|consensus | 1435 | 99.28 | ||
| PF13549 | 222 | ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. | 99.27 | |
| PF02655 | 161 | ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 | 99.23 | |
| COG3919 | 415 | Predicted ATP-grasp enzyme [General function predi | 99.2 | |
| TIGR02291 | 317 | rimK_rel_E_lig alpha-L-glutamate ligase-related pr | 99.0 | |
| COG0045 | 387 | SucC Succinyl-CoA synthetase, beta subunit [Energy | 98.96 | |
| PRK14046 | 392 | malate--CoA ligase subunit beta; Provisional | 98.93 | |
| PF08442 | 202 | ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 | 98.91 | |
| COG1759 | 361 | 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu | 98.9 | |
| PLN00124 | 422 | succinyl-CoA ligase [GDP-forming] subunit beta; Pr | 98.81 | |
| COG1821 | 307 | Predicted ATP-utilizing enzyme (ATP-grasp superfam | 98.77 | |
| COG2232 | 389 | Predicted ATP-dependent carboligase related to bio | 98.72 | |
| PF14397 | 285 | ATPgrasp_ST: Sugar-transfer associated ATP-grasp | 98.56 | |
| PLN02235 | 423 | ATP citrate (pro-S)-lyase | 98.55 | |
| PF02955 | 173 | GSH-S_ATP: Prokaryotic glutathione synthetase, ATP | 98.28 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 98.27 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 98.02 | |
| PF05770 | 307 | Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- | 98.0 | |
| PRK06748 | 83 | hypothetical protein; Validated | 97.95 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 97.91 | |
| PF14398 | 262 | ATPgrasp_YheCD: YheC/D like ATP-grasp | 97.85 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.81 | |
| KOG0238|consensus | 670 | 97.56 | ||
| KOG0369|consensus | 1176 | 97.5 | ||
| PF14403 | 445 | CP_ATPgrasp_2: Circularly permuted ATP-grasp type | 97.49 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.46 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 97.44 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.43 | |
| ), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844 | 100 | GARS_N: Phosphoribosylglycinamide synthetase, N do | 97.4 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 97.31 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 97.3 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 97.05 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 97.03 | |
| PF11379 | 355 | DUF3182: Protein of unknown function (DUF3182); In | 97.02 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 96.97 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 96.95 | |
| PF14305 | 239 | ATPgrasp_TupA: TupA-like ATPgrasp | 96.93 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 96.9 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.86 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 96.84 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 96.76 | |
| PRK07051 | 80 | hypothetical protein; Validated | 96.75 | |
| KOG2799|consensus | 434 | 96.74 | ||
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.64 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 96.53 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 96.51 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 96.48 | |
| PRK07051 | 80 | hypothetical protein; Validated | 96.34 | |
| PRK06748 | 83 | hypothetical protein; Validated | 96.3 | |
| PF06849 | 124 | DUF1246: Protein of unknown function (DUF1246); In | 96.13 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 96.0 | |
| KOG3895|consensus | 488 | 95.98 | ||
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 95.65 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 95.55 | |
| PF02750 | 203 | Synapsin_C: Synapsin, ATP binding domain; InterPro | 95.22 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 95.16 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 95.06 | |
| PF03133 | 292 | TTL: Tubulin-tyrosine ligase family; InterPro: IPR | 94.74 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 94.62 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 94.58 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 94.43 | |
| COG1042 | 598 | Acyl-CoA synthetase (NDP forming) [Energy producti | 94.2 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 94.04 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 93.7 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 93.69 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 93.56 | |
| KOG1447|consensus | 412 | 93.51 | ||
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 93.49 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 93.41 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 93.38 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 93.32 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.26 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 93.09 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 92.9 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 92.89 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.67 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.66 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 92.49 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 92.22 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 91.96 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 91.73 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 91.06 | |
| PF01820 | 117 | Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; In | 90.69 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 90.55 | |
| KOG0559|consensus | 457 | 90.45 | ||
| COG2308 | 488 | Uncharacterized conserved protein [Function unknow | 89.98 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 89.67 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 89.56 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 89.29 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 88.92 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 88.29 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 88.07 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 87.86 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 87.7 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 87.53 | |
| PF09370 | 268 | TIM-br_sig_trns: TIM-barrel signal transduction pr | 87.49 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 87.47 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 87.26 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 86.47 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 86.45 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 85.73 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 85.68 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 85.59 | |
| PF04174 | 330 | CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In | 85.48 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 85.3 | |
| PF10281 | 38 | Ish1: Putative stress-responsive nuclear envelope | 84.85 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 83.93 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 83.8 | |
| TIGR02049 | 403 | gshA_ferroox glutamate--cysteine ligase, T. ferroo | 83.79 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 83.78 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 82.98 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 82.52 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 81.69 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 81.53 | |
| KOG2156|consensus | 662 | 80.56 |
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-39 Score=274.02 Aligned_cols=210 Identities=51% Similarity=0.844 Sum_probs=195.8
Q ss_pred CCcCCCCCCChhhhccceeEEcCCCCcCCCCCCHHHHHHHHHHhCCCEEccccccCCCCHHHHHHHHHcCCeEeCCCHHH
Q psy10619 1 MLFPDPCVFQRHVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEGVVFIGPTAEC 80 (246)
Q Consensus 1 ~v~~d~~~~~~~~~~ad~~~~~~~~~~~~~~~~~~~l~~~~~~~~~d~v~~~~~~~~e~~~~~~~~~~~g~~~~g~~~~~ 80 (246)
|||||.|.+++|+++||+++.++|.+..+||++.+.|++.+++.+.++|+|+|||++||+.+++.++..|+.++||++.+
T Consensus 30 AVYSdaDa~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHPGYGFLSENa~FA~a~~~aGlvfIGP~~~a 109 (645)
T COG4770 30 AVYSDADADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHPGYGFLSENADFAQAVEDAGLVFIGPSAGA 109 (645)
T ss_pred EEEecCCCCchhhhhcchhhhcCCCchhhhhccHHHHHHHHHHhCcccccCCccccccCHHHHHHHHHCCcEEECCCHHH
Confidence 69999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCHHHHHHHHHHhCCCCCCCCccccCCHHHHHHHHHHhCCcEEEEeccCCCCceeEEeCCHHHHHHHHHHHHHHHH
Q psy10619 81 IRGMGDKLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKASAGGGGKGMRIANNDQEAIEGFKLSSQEAA 160 (246)
Q Consensus 81 ~~~~~dK~~~~~~l~~~gip~p~~~~~~~~~~~~~~~~~~~~~~P~vvKp~~g~g~~gv~~v~~~~el~~~~~~~~~~~~ 160 (246)
++.+.||...|.++.++|+|+.|++.....+.+++..+++++|||++||+..|+||+|++++.+.+|+.+++.....++.
T Consensus 110 I~aMGdK~~AK~l~~~AgVp~VPG~~g~~qd~~~~~~~A~eiGyPVlIKAsaGGGGKGMRvv~~~~e~~e~l~sarrEA~ 189 (645)
T COG4770 110 IRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKASAGGGGKGMRVVETPEEFAEALESARREAK 189 (645)
T ss_pred HHHhccHHHHHHHHHHcCCCccCCCCCcccCHHHHHHHHHhcCCcEEEEeccCCCCCceEeecCHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999988889999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCceEEEecccCcceEEEEeeecceee---cchhhhhh----hhcCCCCCCCC
Q psy10619 161 ASFGDDRILVEKFIKNPRHIEIQGTTYKFLI---QTEKEFEY----AKLLPPKPKLD 210 (246)
Q Consensus 161 ~~~~~~~~lve~~i~~g~e~~v~v~~d~~~v---~~~~~~~~----~~~~~~~~~~~ 210 (246)
.+|+++.++||+|+...+++.++|++|.++. ..+..|+. +|++..+|.+-
T Consensus 190 asFGddrv~iEkyl~~PRHIEiQV~aD~HGNvv~LgERdCSlQRRhQKVIEEAPaP~ 246 (645)
T COG4770 190 ASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVIEEAPAPF 246 (645)
T ss_pred hhcCCceEehhhhcCCCceEEEEEEecCCCCEEEeeccccchhhhcchhhhcCCCCC
Confidence 9999999999999999999999999999873 25555554 45555444433
|
|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >COG0439 AccC Biotin carboxylase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08654 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK08462 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07178 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit | Back alignment and domain information |
|---|
| >PRK08463 acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK05586 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >PLN02257 phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon | Back alignment and domain information |
|---|
| >PRK13789 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK00885 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13790 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12767 carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >TIGR00877 purD phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06395 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >PRK05784 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14569 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >PRK14568 vanB D-alanine--D-lactate ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >PRK14572 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >PRK14570 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK07206 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02186 argininosuccinate lyase; Provisional | Back alignment and domain information |
|---|
| >PRK06524 biotin carboxylase-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase | Back alignment and domain information |
|---|
| >PRK14571 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14016 cyanophycin synthetase; Provisional | Back alignment and domain information |
|---|
| >PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >PRK10446 ribosomal protein S6 modification protein; Provisional | Back alignment and domain information |
|---|
| >KOG0237|consensus | Back alignment and domain information |
|---|
| >COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX | Back alignment and domain information |
|---|
| >TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family | Back alignment and domain information |
|---|
| >PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A | Back alignment and domain information |
|---|
| >PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >TIGR02068 cya_phycin_syn cyanophycin synthetase | Back alignment and domain information |
|---|
| >TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type | Back alignment and domain information |
|---|
| >PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 | Back alignment and domain information |
|---|
| >PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] | Back alignment and domain information |
|---|
| >KOG0370|consensus | Back alignment and domain information |
|---|
| >PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis | Back alignment and domain information |
|---|
| >PLN02941 inositol-tetrakisphosphate 1-kinase | Back alignment and domain information |
|---|
| >PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >PRK12458 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
| >TIGR01380 glut_syn glutathione synthetase, prokaryotic | Back alignment and domain information |
|---|
| >PRK05246 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0370|consensus | Back alignment and domain information |
|---|
| >PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A | Back alignment and domain information |
|---|
| >PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >COG3919 Predicted ATP-grasp enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein | Back alignment and domain information |
|---|
| >COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14046 malate--CoA ligase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp | Back alignment and domain information |
|---|
| >PLN02235 ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PF14305 ATPgrasp_TupA: TupA-like ATPgrasp | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2799|consensus | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >KOG3895|consensus | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >KOG1447|consensus | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PF01820 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6 | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >COG2308 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF10281 Ish1: Putative stress-responsive nuclear envelope protein; InterPro: IPR018803 This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues [] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02049 gshA_ferroox glutamate--cysteine ligase, T | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >KOG2156|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 246 | ||||
| 3n6r_A | 681 | Crystal Structure Of The Holoenzyme Of Propionyl-co | 3e-58 | ||
| 3n6r_A | 681 | Crystal Structure Of The Holoenzyme Of Propionyl-co | 1e-08 | ||
| 2vqd_A | 464 | Crystal Structure Of Biotin Carboxylase From Pseudo | 3e-43 | ||
| 3ho8_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 3e-41 | ||
| 3hbl_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 3e-41 | ||
| 3hb9_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 3e-41 | ||
| 3bg5_A | 1173 | Crystal Structure Of Staphylococcus Aureus Pyruvate | 3e-41 | ||
| 4hnv_A | 1173 | Crystal Structure Of R54e Mutant Of S. Aureus Pyruv | 3e-41 | ||
| 4hnu_A | 1173 | Crystal Structure Of K442e Mutant Of S. Aureus Pyru | 3e-41 | ||
| 4hnt_A | 1173 | Crystal Structure Of F403a Mutant Of S. Aureus Pyru | 3e-41 | ||
| 1ulz_A | 451 | Crystal Structure Of The Biotin Carboxylase Subunit | 2e-39 | ||
| 3va7_A | 1236 | Crystal Structure Of The Kluyveromyces Lactis Urea | 2e-39 | ||
| 3jzf_A | 486 | Crystal Structure Of Biotin Carboxylase From E. Col | 5e-39 | ||
| 3g8d_A | 444 | Crystal Structure Of The Biotin Carboxylase Subunit | 6e-39 | ||
| 2gps_A | 469 | Crystal Structure Of The Biotin Carboxylase Subunit | 6e-39 | ||
| 1dv2_A | 452 | The Structure Of Biotin Carboxylase, Mutant E288k, | 6e-39 | ||
| 3rv4_A | 452 | Crystal Structure Of E.Coli Biotin Carboxylase R16e | 6e-39 | ||
| 1bnc_A | 449 | Three-Dimensional Structure Of The Biotin Carboxyla | 6e-39 | ||
| 3rup_B | 452 | Crystal Structure Of E.Coli Biotin Carboxylase In C | 7e-39 | ||
| 3g8c_A | 444 | Crystal Stucture Of Biotin Carboxylase In Complex W | 7e-39 | ||
| 2gpw_A | 469 | Crystal Structure Of The Biotin Carboxylase Subunit | 7e-39 | ||
| 2dzd_A | 461 | Crystal Structure Of The Biotin Carboxylase Domain | 7e-38 | ||
| 2vpq_A | 451 | Crystal Structure Of Biotin Carboxylase From S. Aur | 3e-37 | ||
| 2cqy_A | 108 | Solution Structure Of B Domain From Human Propionyl | 8e-33 | ||
| 3tw7_A | 1165 | Structure Of Rhizobium Etli Pyruvate Carboxylase T8 | 1e-32 | ||
| 2qf7_A | 1165 | Crystal Structure Of A Complete Multifunctional Pyr | 1e-32 | ||
| 3u9s_A | 655 | Crystal Structure Of P. Aeruginosa 3-methylcrotonyl | 3e-32 | ||
| 3ouz_A | 446 | Crystal Structure Of Biotin Carboxylase-Adp Complex | 3e-28 | ||
| 2yl2_A | 540 | Crystal Structure Of Human Acetyl-Coa Carboxylase 1 | 9e-22 | ||
| 3jrw_A | 587 | Phosphorylated Bc Domain Of Acc2 Length = 587 | 7e-20 | ||
| 3jrx_A | 587 | Crystal Structure Of The Bc Domain Of Acc2 In Compl | 7e-20 | ||
| 3gid_A | 540 | The Biotin Carboxylase (Bc) Domain Of Human Acetyl- | 7e-20 | ||
| 2hjw_A | 573 | Crystal Structure Of The Bc Domain Of Acc2 Length = | 7e-20 | ||
| 1w96_A | 554 | Crystal Structure Of Biotin Carboxylase Domain Of A | 7e-19 | ||
| 1w93_A | 553 | Crystal Structure Of Biotin Carboxylase Domain Of A | 7e-19 | ||
| 4dim_A | 403 | Crystal Structure Of Phosphoribosylglycinamide Synt | 5e-06 | ||
| 3orq_A | 377 | Crystal Structure Of N5-Carboxyaminoimidazole Synth | 2e-05 | ||
| 3q1k_A | 367 | The Crystal Structure Of The D-Alanyl-Alanine Synth | 2e-04 | ||
| 1ce8_A | 1073 | Carbamoyl Phosphate Synthetase From Escherichis Col | 2e-04 | ||
| 1jdb_B | 1073 | Carbamoyl Phosphate Synthetase From Escherichia Col | 2e-04 | ||
| 1a9x_A | 1073 | Carbamoyl Phosphate Synthetase: Caught In The Act O | 2e-04 | ||
| 3i12_A | 364 | The Crystal Structure Of The D-alanyl-alanine Synth | 2e-04 | ||
| 3mjf_A | 431 | Phosphoribosylamine-Glycine Ligase From Yersinia Pe | 4e-04 | ||
| 2jku_A | 94 | Crystal Structure Of The N-Terminal Region Of The B | 6e-04 |
| >pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 | Back alignment and structure |
|
| >pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 | Back alignment and structure |
| >pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 | Back alignment and structure |
| >pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 | Back alignment and structure |
| >pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 | Back alignment and structure |
| >pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 | Back alignment and structure |
| >pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 | Back alignment and structure |
| >pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 | Back alignment and structure |
| >pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 | Back alignment and structure |
| >pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 | Back alignment and structure |
| >pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 | Back alignment and structure |
| >pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 | Back alignment and structure |
| >pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 | Back alignment and structure |
| >pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 | Back alignment and structure |
| >pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 | Back alignment and structure |
| >pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 | Back alignment and structure |
| >pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 | Back alignment and structure |
| >pdb|2CQY|A Chain A, Solution Structure Of B Domain From Human Propionyl-Coa Carboxylase Alpha Subunit Length = 108 | Back alignment and structure |
| >pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 | Back alignment and structure |
| >pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 | Back alignment and structure |
| >pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 | Back alignment and structure |
| >pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 | Back alignment and structure |
| >pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 | Back alignment and structure |
| >pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 | Back alignment and structure |
| >pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 | Back alignment and structure |
| >pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 | Back alignment and structure |
| >pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 | Back alignment and structure |
| >pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 | Back alignment and structure |
| >pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 | Back alignment and structure |
| >pdb|4DIM|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Synthetase From Anaerococcus Prevotii Length = 403 | Back alignment and structure |
| >pdb|3ORQ|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthetase From Staphylococcus Aureus Complexed With Adp Length = 377 | Back alignment and structure |
| >pdb|3Q1K|A Chain A, The Crystal Structure Of The D-Alanyl-Alanine Synthetase A From Salmonella Enterica Typhimurium Complexed With Adp Length = 367 | Back alignment and structure |
| >pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 | Back alignment and structure |
| >pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 | Back alignment and structure |
| >pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 | Back alignment and structure |
| >pdb|3I12|A Chain A, The Crystal Structure Of The D-alanyl-alanine Synthetase A From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 Length = 364 | Back alignment and structure |
| >pdb|3MJF|A Chain A, Phosphoribosylamine-Glycine Ligase From Yersinia Pestis Length = 431 | Back alignment and structure |
| >pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 1e-105 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 2e-13 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 1e-100 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 1e-07 | |
| 2vpq_A | 451 | Acetyl-COA carboxylase; bacteria, ATP-grAsp domain | 1e-97 | |
| 3ouz_A | 446 | Biotin carboxylase; structural genomics, center fo | 2e-97 | |
| 1ulz_A | 451 | Pyruvate carboxylase N-terminal domain; biotin car | 3e-97 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 1e-96 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 8e-04 | |
| 2w70_A | 449 | Biotin carboxylase; ligase, ATP-binding, fatty aci | 7e-95 | |
| 2dzd_A | 461 | Pyruvate carboxylase; biotin carboxylase, ligase; | 4e-89 | |
| 3glk_A | 540 | Acetyl-COA carboxylase 2; ATP binding, alternative | 6e-88 | |
| 3jrx_A | 587 | Acetyl-COA carboxylase 2; BC domain, soraphen A, a | 6e-88 | |
| 1w96_A | 554 | ACC, acetyl-coenzyme A carboxylase; ligase, obesit | 5e-86 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 6e-83 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 2e-04 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 7e-83 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 9e-05 | |
| 2cqy_A | 108 | Propionyl-COA carboxylase alpha chain, mitochondri | 9e-60 | |
| 4dim_A | 403 | Phosphoribosylglycinamide synthetase; structural g | 2e-21 | |
| 2pn1_A | 331 | Carbamoylphosphate synthase large subunit; ZP_0053 | 9e-18 | |
| 3vmm_A | 474 | Alanine-anticapsin ligase BACD; ATP-grAsp domain, | 1e-16 | |
| 1ehi_A | 377 | LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g | 1e-11 | |
| 2pvp_A | 367 | D-alanine-D-alanine ligase; 2.40A {Helicobacter py | 2e-11 | |
| 2fb9_A | 322 | D-alanine:D-alanine ligase; 1.90A {Thermus caldoph | 9e-11 | |
| 4eg0_A | 317 | D-alanine--D-alanine ligase; structural genomics, | 1e-10 | |
| 3r5x_A | 307 | D-alanine--D-alanine ligase; alpha-beta structure, | 3e-10 | |
| 3i12_A | 364 | D-alanine-D-alanine ligase A; D-alanyl-alanine syn | 4e-10 | |
| 2i87_A | 364 | D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco | 2e-09 | |
| 3lwb_A | 373 | D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan | 2e-09 | |
| 3e5n_A | 386 | D-alanine-D-alanine ligase A; bacterial blight; 2. | 2e-09 | |
| 1iow_A | 306 | DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho | 2e-09 | |
| 1e4e_A | 343 | Vancomycin/teicoplanin A-type resistance protein; | 4e-09 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 5e-09 | |
| 3ln6_A | 750 | Glutathione biosynthesis bifunctional protein GSH; | 1e-08 | |
| 3se7_A | 346 | VANA; alpha-beta structure, D-alanine-D-lactate li | 1e-08 | |
| 3tqt_A | 372 | D-alanine--D-alanine ligase; cell envelope; 1.88A | 5e-08 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 6e-08 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 7e-08 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 7e-08 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 9e-08 | |
| 3ln7_A | 757 | Glutathione biosynthesis bifunctional protein GSH; | 8e-08 | |
| 3aw8_A | 369 | PURK, phosphoribosylaminoimidazole carboxylase, AT | 9e-08 | |
| 3k3p_A | 383 | D-alanine--D-alanine ligase; D-alanyl-alanine synt | 1e-07 | |
| 2r7k_A | 361 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib | 1e-07 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 2e-07 | |
| 3eth_A | 355 | Phosphoribosylaminoimidazole carboxylase ATPase su | 6e-07 | |
| 1uc8_A | 280 | LYSX, lysine biosynthesis enzyme; alpha-aminoadipa | 6e-07 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 9e-07 | |
| 2r85_A | 334 | PURP protein PF1517; ATP-grAsp superfamily, unknow | 1e-06 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 3e-06 | |
| 3df7_A | 305 | Putative ATP-grAsp superfamily protein; putative p | 3e-06 | |
| 3lp8_A | 442 | Phosphoribosylamine-glycine ligase; ssgcid, NIH, n | 6e-06 | |
| 2yw2_A | 424 | Phosphoribosylamine--glycine ligase; glycinamide r | 7e-06 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 8e-06 | |
| 3mjf_A | 431 | Phosphoribosylamine--glycine ligase; structural ge | 1e-05 | |
| 2yrx_A | 451 | Phosphoribosylglycinamide synthetase; glycinamide | 2e-05 | |
| 2xcl_A | 422 | Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- | 2e-05 | |
| 2ip4_A | 417 | PURD, phosphoribosylamine--glycine ligase; GAR syn | 4e-05 | |
| 2z04_A | 365 | Phosphoribosylaminoimidazole carboxylase ATPase su | 4e-05 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 6e-05 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 7e-05 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 7e-05 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 2e-04 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 6e-04 | |
| 2qk4_A | 452 | Trifunctional purine biosynthetic protein adenosi; | 2e-04 | |
| 1wr2_A | 238 | Hypothetical protein PH1789; structural genomics, | 5e-04 | |
| 1vkz_A | 412 | Phosphoribosylamine--glycine ligase; TM1250, struc | 9e-04 |
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
Score = 318 bits (818), Expect = e-105
Identities = 114/173 (65%), Positives = 135/173 (78%)
Query: 11 RHVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEG 70
HV++ADEAV IGPP A QSYI +DK++ AIR T A AVHPGYGFLSEN+ F L+ EG
Sbjct: 40 LHVQMADEAVHIGPPPANQSYIVIDKVMAAIRATGAQAVHPGYGFLSENSKFAEALEAEG 99
Query: 71 VVFIGPTAECIRGMGDKLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKA 130
V+F+GP I MGDK+ SKK+A+EA V+ +PG+ G+I DAD V+I+ IGYPVMIKA
Sbjct: 100 VIFVGPPKGAIEAMGDKITSKKIAQEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKA 159
Query: 131 SAGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDDRILVEKFIKNPRHIEIQ 183
SAGGGGKGMRIA NDQEA EGF+ S EAA SFGDDRI +EKF+ PRHIEIQ
Sbjct: 160 SAGGGGKGMRIAWNDQEAREGFQSSKNEAANSFGDDRIFIEKFVTQPRHIEIQ 212
|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 | Back alignment and structure |
|---|
| >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 | Back alignment and structure |
|---|
| >1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 | Back alignment and structure |
|---|
| >2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 | Back alignment and structure |
|---|
| >3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 | Back alignment and structure |
|---|
| >3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 | Back alignment and structure |
|---|
| >1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 | Back alignment and structure |
|---|
| >2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 | Back alignment and structure |
|---|
| >1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 | Back alignment and structure |
|---|
| >2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 | Back alignment and structure |
|---|
| >2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 | Back alignment and structure |
|---|
| >4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 | Back alignment and structure |
|---|
| >3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 | Back alignment and structure |
|---|
| >3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 | Back alignment and structure |
|---|
| >2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 | Back alignment and structure |
|---|
| >3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 | Back alignment and structure |
|---|
| >3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 | Back alignment and structure |
|---|
| >1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 | Back alignment and structure |
|---|
| >1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 | Back alignment and structure |
|---|
| >3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 | Back alignment and structure |
|---|
| >3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 | Back alignment and structure |
|---|
| >3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 | Back alignment and structure |
|---|
| >3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Length = 757 | Back alignment and structure |
|---|
| >3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 | Back alignment and structure |
|---|
| >3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 | Back alignment and structure |
|---|
| >2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Length = 361 | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 | Back alignment and structure |
|---|
| >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Length = 355 | Back alignment and structure |
|---|
| >1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 | Back alignment and structure |
|---|
| >2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 | Back alignment and structure |
|---|
| >3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 | Back alignment and structure |
|---|
| >3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Length = 442 | Back alignment and structure |
|---|
| >2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Length = 424 | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 | Back alignment and structure |
|---|
| >3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Length = 431 | Back alignment and structure |
|---|
| >2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Length = 451 | Back alignment and structure |
|---|
| >2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Length = 422 | Back alignment and structure |
|---|
| >2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Length = 417 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Length = 377 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Length = 238 | Back alignment and structure |
|---|
| >1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 412 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| 3jrx_A | 587 | Acetyl-COA carboxylase 2; BC domain, soraphen A, a | 100.0 | |
| 3glk_A | 540 | Acetyl-COA carboxylase 2; ATP binding, alternative | 100.0 | |
| 3ouz_A | 446 | Biotin carboxylase; structural genomics, center fo | 100.0 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.98 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.97 | |
| 2vpq_A | 451 | Acetyl-COA carboxylase; bacteria, ATP-grAsp domain | 99.97 | |
| 1ulz_A | 451 | Pyruvate carboxylase N-terminal domain; biotin car | 99.97 | |
| 2w70_A | 449 | Biotin carboxylase; ligase, ATP-binding, fatty aci | 99.97 | |
| 2dzd_A | 461 | Pyruvate carboxylase; biotin carboxylase, ligase; | 99.97 | |
| 1w96_A | 554 | ACC, acetyl-coenzyme A carboxylase; ligase, obesit | 99.97 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.96 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.96 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 99.96 | |
| 4dim_A | 403 | Phosphoribosylglycinamide synthetase; structural g | 99.94 | |
| 3vmm_A | 474 | Alanine-anticapsin ligase BACD; ATP-grAsp domain, | 99.93 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 99.93 | |
| 3lp8_A | 442 | Phosphoribosylamine-glycine ligase; ssgcid, NIH, n | 99.93 | |
| 3mjf_A | 431 | Phosphoribosylamine--glycine ligase; structural ge | 99.92 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 99.92 | |
| 3aw8_A | 369 | PURK, phosphoribosylaminoimidazole carboxylase, AT | 99.92 | |
| 2yw2_A | 424 | Phosphoribosylamine--glycine ligase; glycinamide r | 99.91 | |
| 2ip4_A | 417 | PURD, phosphoribosylamine--glycine ligase; GAR syn | 99.91 | |
| 2pn1_A | 331 | Carbamoylphosphate synthase large subunit; ZP_0053 | 99.91 | |
| 3vot_A | 425 | L-amino acid ligase, BL00235; ATP-grAsp motif, ATP | 99.91 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.91 | |
| 3i12_A | 364 | D-alanine-D-alanine ligase A; D-alanyl-alanine syn | 99.91 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 99.91 | |
| 2yrx_A | 451 | Phosphoribosylglycinamide synthetase; glycinamide | 99.91 | |
| 2xcl_A | 422 | Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- | 99.91 | |
| 2qk4_A | 452 | Trifunctional purine biosynthetic protein adenosi; | 99.91 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.9 | |
| 3e5n_A | 386 | D-alanine-D-alanine ligase A; bacterial blight; 2. | 99.9 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 99.9 | |
| 3k3p_A | 383 | D-alanine--D-alanine ligase; D-alanyl-alanine synt | 99.9 | |
| 3tqt_A | 372 | D-alanine--D-alanine ligase; cell envelope; 1.88A | 99.9 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 99.9 | |
| 4fu0_A | 357 | D-alanine--D-alanine ligase 7; vancomycin resistan | 99.89 | |
| 1vkz_A | 412 | Phosphoribosylamine--glycine ligase; TM1250, struc | 99.89 | |
| 4eg0_A | 317 | D-alanine--D-alanine ligase; structural genomics, | 99.89 | |
| 1ehi_A | 377 | LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g | 99.89 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.89 | |
| 3lwb_A | 373 | D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan | 99.89 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 99.89 | |
| 2i87_A | 364 | D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco | 99.88 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 99.88 | |
| 3se7_A | 346 | VANA; alpha-beta structure, D-alanine-D-lactate li | 99.87 | |
| 3r5x_A | 307 | D-alanine--D-alanine ligase; alpha-beta structure, | 99.87 | |
| 2fb9_A | 322 | D-alanine:D-alanine ligase; 1.90A {Thermus caldoph | 99.86 | |
| 2z04_A | 365 | Phosphoribosylaminoimidazole carboxylase ATPase su | 99.86 | |
| 1e4e_A | 343 | Vancomycin/teicoplanin A-type resistance protein; | 99.86 | |
| 2pvp_A | 367 | D-alanine-D-alanine ligase; 2.40A {Helicobacter py | 99.85 | |
| 1iow_A | 306 | DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho | 99.84 | |
| 2cqy_A | 108 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.84 | |
| 3eth_A | 355 | Phosphoribosylaminoimidazole carboxylase ATPase su | 99.82 | |
| 1uc8_A | 280 | LYSX, lysine biosynthesis enzyme; alpha-aminoadipa | 99.79 | |
| 3ln7_A | 757 | Glutathione biosynthesis bifunctional protein GSH; | 99.78 | |
| 2r7k_A | 361 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib | 99.71 | |
| 3ln6_A | 750 | Glutathione biosynthesis bifunctional protein GSH; | 99.7 | |
| 1wr2_A | 238 | Hypothetical protein PH1789; structural genomics, | 99.69 | |
| 2r85_A | 334 | PURP protein PF1517; ATP-grAsp superfamily, unknow | 99.69 | |
| 1z2n_X | 324 | Inositol 1,3,4-trisphosphate 5/6-kinase; inositol | 99.67 | |
| 3df7_A | 305 | Putative ATP-grAsp superfamily protein; putative p | 99.66 | |
| 1i7n_A | 309 | Synapsin II; synapse, phosphorylation, neuropeptid | 99.65 | |
| 2pbz_A | 320 | Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt | 99.61 | |
| 2p0a_A | 344 | Synapsin-3, synapsin III; neurotransmitter release | 99.6 | |
| 1gsa_A | 316 | Glutathione synthetase; ligase; HET: ADP GSH; 2.00 | 99.6 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 99.59 | |
| 3ufx_B | 397 | Succinyl-COA synthetase beta subunit; ATP-grAsp fo | 99.48 | |
| 2q7d_A | 346 | Inositol-tetrakisphosphate 1-kinase; inositol kina | 99.47 | |
| 2nu8_B | 388 | SCS-beta, succinyl-COA synthetase beta chain; citr | 99.47 | |
| 2fp4_B | 395 | Succinyl-COA ligase [GDP-forming] beta-chain, mito | 99.41 | |
| 3t7a_A | 330 | Inositol pyrophosphate kinase; ATP-grAsp fold, tra | 98.99 | |
| 3mwd_A | 425 | ATP-citrate synthase; ATP-grAsp, phosphohistidine, | 98.2 | |
| 3pff_A | 829 | ATP-citrate synthase; phosphohistidine, organic ac | 97.97 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 97.64 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 97.53 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 97.44 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 97.38 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 97.29 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 97.25 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 97.2 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 97.18 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 97.1 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 97.1 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 96.86 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 96.76 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 96.71 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 96.71 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 96.69 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 96.64 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 96.58 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 96.41 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 96.39 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 96.37 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 96.34 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 96.26 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 96.23 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 96.2 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 96.16 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.16 | |
| 3tig_A | 380 | TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si | 96.12 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 96.1 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 96.0 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 96.0 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 95.9 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 95.87 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 95.81 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 95.75 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 95.73 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 95.62 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 95.5 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 95.35 | |
| 3n6x_A | 474 | Putative glutathionylspermidine synthase; domain o | 94.98 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 94.93 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 94.83 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 94.74 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 94.67 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 94.6 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 94.6 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 94.52 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 94.49 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 94.18 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 94.16 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 93.89 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 93.75 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 93.43 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 93.43 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 93.03 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 92.89 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 92.85 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 92.84 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 92.37 | |
| 2io8_A | 619 | Bifunctional glutathionylspermidine synthetase/ami | 91.94 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 90.92 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 90.53 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 89.16 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 83.66 | |
| 2vob_A | 652 | Trypanothione synthetase; ligase; 2.3A {Leishmania | 83.03 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 81.64 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 81.33 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 81.2 |
| >3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-32 Score=245.05 Aligned_cols=186 Identities=32% Similarity=0.509 Sum_probs=168.4
Q ss_pred CCcCCCC--CCChhhhccceeEEcCCCCcCCCCCCHHHHHHHHHHhCCCEEccccccCCCCHHHHHHHHHcCCeEeCCCH
Q psy10619 1 MLFPDPC--VFQRHVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENASFVSRLKEEGVVFIGPTA 78 (246)
Q Consensus 1 ~v~~d~~--~~~~~~~~ad~~~~~~~~~~~~~~~~~~~l~~~~~~~~~d~v~~~~~~~~e~~~~~~~~~~~g~~~~g~~~ 78 (246)
+||++.| ++++++++||+++.+++.....+|++.+.++++|++.++|+|+|++|+++|+..+++.+++.|++++|+++
T Consensus 93 av~s~~D~~~~a~~~~~ADe~v~i~~~~~~~syld~~~Il~~a~~~~vdaV~pG~GflsEn~~~a~~le~~Gi~~iGp~~ 172 (587)
T 3jrx_A 93 VMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELLCKNGVAFLGPPS 172 (587)
T ss_dssp EEECHHHHHTTCHHHHHSSEEEECCCSSGGGTTTCHHHHHHHHHHTTCSEEECCSSTTTTCTHHHHHHHTTTCEESSCCH
T ss_pred EEecccccCcCChhhHhCCEEEEeCCCCccccccCHHHHHHHHHHhCCCEEEeCCCccccCHHHHHHHHHCCCCeeCCCH
Confidence 3677545 99999999999999988777789999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCHHHHHHHHHHhCCCCCCCCc---------------------------cccCCHHHHHHHHHHhCCcEEEEec
Q psy10619 79 ECIRGMGDKLESKKLAKEAGVNIIPGFN---------------------------GIIRDADHCVEIARDIGYPVMIKAS 131 (246)
Q Consensus 79 ~~~~~~~dK~~~~~~l~~~gip~p~~~~---------------------------~~~~~~~~~~~~~~~~~~P~vvKp~ 131 (246)
+++.++.||..++++|+++|||+|++.. ..+.+.+++.++++++|||+||||.
T Consensus 173 ~ai~~~~DK~~ak~ll~~aGVPvpp~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~s~eea~~~a~~iGyPvVVKp~ 252 (587)
T 3jrx_A 173 EAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGKRISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKAS 252 (587)
T ss_dssp HHHHHHCSHHHHHHHHHHTTCCBCCBTTTTCCCCC------CCCCCCCCHHHHHTTSCCSHHHHHHHHHHHCSSEEEEET
T ss_pred HHHHHhCCHHHHHHHHHHcCCCCCCeecccccccccccccccccccccchhhccccccCCHHHHHHHHHhcCCeEEEEeC
Confidence 9999999999999999999999999752 1178899999999999999999999
Q ss_pred cCCCCceeEEeCCHHHHHHHHHHHHHHHHhhcCCCceEEEecccCcceEEEEeeeccee
Q psy10619 132 AGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDDRILVEKFIKNPRHIEIQGTTYKFL 190 (246)
Q Consensus 132 ~g~g~~gv~~v~~~~el~~~~~~~~~~~~~~~~~~~~lve~~i~~g~e~~v~v~~d~~~ 190 (246)
.|+||+|++++++.+|+.++++.+.... .+..++||+||++++|++|++++|+.+
T Consensus 253 ~GgGGkGv~iV~s~eEL~~a~~~a~~~~----~~~~vlVEeyI~g~rei~V~vl~D~~G 307 (587)
T 3jrx_A 253 EGGGGKGIRKAESAEDFPILFRQVQSEI----PGSPIFLMKLAQHARHLEVQILADQYG 307 (587)
T ss_dssp TCCSSSSEEEECSTTTHHHHHHHHHHHS----TTCCEEEEECCCSCEEEEEEEEECSSS
T ss_pred CCCCCCCeEEeCCHHHHHHHHHHHHhhc----cCCCEEEEEecCCCcEEEEEEEEcCCC
Confidence 9999999999999999999998876532 247899999999559999999998743
|
| >3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A | Back alignment and structure |
|---|
| >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... | Back alignment and structure |
|---|
| >2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* | Back alignment and structure |
|---|
| >3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A | Back alignment and structure |
|---|
| >2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A | Back alignment and structure |
|---|
| >2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* | Back alignment and structure |
|---|
| >2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A | Back alignment and structure |
|---|
| >1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} | Back alignment and structure |
|---|
| >3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* | Back alignment and structure |
|---|
| >2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* | Back alignment and structure |
|---|
| >1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* | Back alignment and structure |
|---|
| >2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* | Back alignment and structure |
|---|
| >2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* | Back alignment and structure |
|---|
| >1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* | Back alignment and structure |
|---|
| >3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* | Back alignment and structure |
|---|
| >3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* | Back alignment and structure |
|---|
| >1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* | Back alignment and structure |
|---|
| >3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* | Back alignment and structure |
|---|
| >2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 | Back alignment and structure |
|---|
| >2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X | Back alignment and structure |
|---|
| >2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* | Back alignment and structure |
|---|
| >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* | Back alignment and structure |
|---|
| >3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* | Back alignment and structure |
|---|
| >3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* | Back alignment and structure |
|---|
| >3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 246 | ||||
| d1ulza2 | 114 | c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term | 3e-22 | |
| d1ulza3 | 214 | d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom | 1e-20 | |
| d1a9xa5 | 275 | d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta | 1e-19 | |
| d2j9ga3 | 216 | d.142.1.2 (A:115-330) Biotin carboxylase (BC), dom | 1e-19 | |
| d1w96a2 | 170 | c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s | 7e-18 | |
| d2j9ga2 | 114 | c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term | 9e-18 | |
| d2r7ka2 | 238 | d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo | 9e-18 | |
| d1a9xa6 | 259 | d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta | 1e-16 | |
| d2r85a2 | 235 | d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo | 3e-14 | |
| d1w96a3 | 267 | d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M | 2e-11 | |
| d1uc8a2 | 192 | d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly | 4e-11 | |
| d1gsoa3 | 224 | d.142.1.2 (A:104-327) Glycinamide ribonucleotide s | 1e-07 | |
| d1ehia2 | 228 | d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V | 4e-07 | |
| d1kjqa3 | 206 | d.142.1.2 (A:113-318) Glycinamide ribonucleotide t | 4e-06 | |
| d1iowa2 | 210 | d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain | 5e-06 | |
| d3etja3 | 198 | d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo | 1e-05 | |
| d1e4ea2 | 211 | d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V | 1e-05 | |
| d1i7na2 | 206 | d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus nor | 2e-05 | |
| d1vkza3 | 220 | d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy | 6e-04 | |
| d2nu7b2 | 238 | d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta- | 9e-04 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 0.001 |
| >d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PreATP-grasp domain superfamily: PreATP-grasp domain family: BC N-terminal domain-like domain: Biotin carboxylase (BC), N-terminal domain species: Aquifex aeolicus [TaxId: 63363]
Score = 86.1 bits (213), Expect = 3e-22
Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
Query: 1 MLFPDPCVFQRHVKLADEAVCIGPPVAAQSYINVDKIIDAIRQTRADAVHPGYGFLSENA 60
++ + RHVKLADEA IG +Y+N +II+ + ADA+HPGYGFL+ENA
Sbjct: 30 AIYNEVESTARHVKLADEAYMIGTD-PLDTYLNKQRIINLALEVGADAIHPGYGFLAENA 88
Query: 61 SFVSRLKEEGVVFIGPTAECIRGMGD 86
F +E G+ FIGP + I MGD
Sbjct: 89 EFAKMCEEAGITFIGPHWKVIELMGD 114
|
| >d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 | Back information, alignment and structure |
|---|
| >d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 | Back information, alignment and structure |
|---|
| >d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 | Back information, alignment and structure |
|---|
| >d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 267 | Back information, alignment and structure |
|---|
| >d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 | Back information, alignment and structure |
|---|
| >d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 | Back information, alignment and structure |
|---|
| >d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 | Back information, alignment and structure |
|---|
| >d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 | Back information, alignment and structure |
|---|
| >d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 206 | Back information, alignment and structure |
|---|
| >d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 | Back information, alignment and structure |
|---|
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 238 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| d1ulza3 | 214 | Biotin carboxylase (BC), domain 2 {Aquifex aeolicu | 99.8 | |
| d1vkza3 | 220 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.8 | |
| d2j9ga3 | 216 | Biotin carboxylase (BC), domain 2 {Escherichia col | 99.79 | |
| d1a9xa5 | 275 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.78 | |
| d1a9xa6 | 259 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.77 | |
| d1gsoa3 | 224 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.75 | |
| d1w96a3 | 267 | Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye | 99.69 | |
| d2j9ga2 | 114 | Biotin carboxylase (BC), N-terminal domain {Escher | 99.68 | |
| d1ulza2 | 114 | Biotin carboxylase (BC), N-terminal domain {Aquife | 99.67 | |
| d1ehia2 | 228 | D-alanine:D-lactate ligase VanA, C-domain {Leucono | 99.67 | |
| d1iowa2 | 210 | D-ala-D-ala ligase, C-domain {Escherichia coli, ge | 99.65 | |
| d1kjqa3 | 206 | Glycinamide ribonucleotide transformylase PurT, do | 99.64 | |
| d2r7ka2 | 238 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 99.64 | |
| d1e4ea2 | 211 | D-alanine:D-lactate ligase VanA, C-domain {Enteroc | 99.6 | |
| d1uc8a2 | 192 | Lysine biosynthesis enzyme LysX ATP-binding domain | 99.59 | |
| d3etja3 | 198 | N5-carboxyaminoimidazole ribonucleotide synthetase | 99.59 | |
| d2r85a2 | 235 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 99.58 | |
| d1w96a2 | 170 | Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye | 99.57 | |
| d1i7na2 | 206 | Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 | 99.49 | |
| d2nu7b2 | 238 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 99.06 | |
| d1eucb2 | 246 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 98.97 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 98.23 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 98.14 | |
| d1gsaa2 | 192 | Prokaryotic glutathione synthetase, C-domain {Esch | 98.13 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 97.97 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 97.96 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 97.73 | |
| d1gsoa2 | 105 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 97.16 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 97.05 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 97.02 | |
| d2pbza2 | 213 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 97.01 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.79 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.5 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 96.42 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.37 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 96.31 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.26 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.05 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.04 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.92 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.9 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.87 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.87 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.73 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.64 | |
| d1e4ea1 | 130 | D-alanine:D-lactate ligase VanA, N-domain {Enteroc | 95.25 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.15 | |
| d1ehia1 | 132 | D-alanine:D-lactate ligase VanA, N-domain {Leucono | 95.07 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 94.53 | |
| d1uc8a1 | 88 | Lysine biosynthesis enzyme LysX, N-terminal domain | 92.46 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.12 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 91.21 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 88.86 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 88.65 | |
| d1gr0a1 | 243 | Myo-inositol 1-phosphate synthase {Mycobacterium t | 84.11 | |
| d1e2wa2 | 64 | Cytochrome f, small domain {Chlamydomonas reinhard | 82.42 | |
| d1ci3m2 | 62 | Cytochrome f, small domain {Phormidium laminosum [ | 81.36 |
| >d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATP-grasp superfamily: Glutathione synthetase ATP-binding domain-like family: BC ATP-binding domain-like domain: Biotin carboxylase (BC), domain 2 species: Aquifex aeolicus [TaxId: 63363]
Probab=99.80 E-value=3.5e-19 Score=138.74 Aligned_cols=104 Identities=44% Similarity=0.830 Sum_probs=87.7
Q ss_pred HHHHHHHHHHhCCCCCCCCccccCCHHHHHHHHHHhCCcEEEEeccCCCCceeEEeCCHHHHHHHHHHHHHHHHhhcCCC
Q psy10619 87 KLESKKLAKEAGVNIIPGFNGIIRDADHCVEIARDIGYPVMIKASAGGGGKGMRIANNDQEAIEGFKLSSQEAAASFGDD 166 (246)
Q Consensus 87 K~~~~~~l~~~gip~p~~~~~~~~~~~~~~~~~~~~~~P~vvKp~~g~g~~gv~~v~~~~el~~~~~~~~~~~~~~~~~~ 166 (246)
|..+|++|+++|||++|+++..+.|.+++.++++++|||+||||.++++|+|+.++++.+|+..++......+.......
T Consensus 1 K~~~k~~~~~aGvP~~p~~~~~v~s~~ea~~~~~~ig~P~vvKP~~~~~s~gv~~v~~~~el~~a~~~~~~~~~~~~~~~ 80 (214)
T d1ulza3 1 KARSKEVMKKAGVPVVPGSDGVLKSLEEAKALAREIGYPVLLKATAGGGGRGIRICRNEEELVKNYEQASREAEKAFGRG 80 (214)
T ss_dssp HHHHHHHHHHTTCCBCCBCSSSCCCHHHHHHHHHHHCSSEEEEECSSSSCCSCEEESSHHHHHHHHHHHHHHHHHTTSCC
T ss_pred CHHHHHHHHHcCCCcCCCcCCCCCCHHHHHHHHHHcCCCEEEeeccccCCccceeeeccHHHHHHHHHHHHHHHHhcCCC
Confidence 78999999999999866544568999999999999999999999999999999999999999999988777665555567
Q ss_pred ceEEEecccCcceEEEEeeeccee
Q psy10619 167 RILVEKFIKNPRHIEIQGTTYKFL 190 (246)
Q Consensus 167 ~~lve~~i~~g~e~~v~v~~d~~~ 190 (246)
.+|||+||+|..++...++.|+.+
T Consensus 81 ~viiEe~i~G~e~~~~~~~~d~~~ 104 (214)
T d1ulza3 81 DLLLEKFIENPKHIEYQVLGDKHG 104 (214)
T ss_dssp CEEEEECCCSCEEEEEEEEECTTS
T ss_pred CceeheeecCcceeeEEEEEcCCC
Confidence 899999999434445556666654
|
| >d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} | Back information, alignment and structure |
|---|
| >d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} | Back information, alignment and structure |
|---|