Psyllid ID: psy10696


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
cHHHHHHHHHHHHHccccccccccccEEccccccccccccHHHHHHHHccccccccccccccccccccccEEEEcccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHcccHHHHHHcccc
cccEEEEEHHHHHHcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEccccccEEcccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccEEEEEEc
MFSVIILLISSTvlgigsstYWSLGVAYLddnvrknkMPVVLGVMSSAWDVGTLASFLVSsylggkghktKWVALGSIIMSIGCFLRtytncscipngmatqgacpadcgshfMWFIFILCLLNFFsatgragntiiqfrcvspedkslsiGITEALGcglafipgpiiygall
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
**SVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGA**
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNV**NKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHi
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
Q9Y6L6691 Solute carrier organic an yes N/A 0.494 0.124 0.357 3e-06
Q9JHI3682 Solute carrier organic an yes N/A 0.482 0.123 0.329 3e-06
Q9JJL3689 Solute carrier organic an yes N/A 0.494 0.124 0.329 4e-06
Q92959643 Solute carrier organic an no N/A 0.477 0.129 0.317 4e-06
Q8BXB6683 Solute carrier organic an no N/A 0.482 0.122 0.329 5e-06
Q99J94670 Solute carrier organic an no N/A 0.494 0.128 0.340 6e-06
Q9QZX8687 Solute carrier organic an no N/A 0.494 0.125 0.333 7e-06
Q9EPT5643 Solute carrier organic an no N/A 0.494 0.133 0.306 1e-05
O88397670 Solute carrier organic an no N/A 0.494 0.128 0.318 2e-05
Q00910644 Solute carrier organic an no N/A 0.494 0.133 0.306 2e-05
>sp|Q9Y6L6|SO1B1_HUMAN Solute carrier organic anion transporter family member 1B1 OS=Homo sapiens GN=SLCO1B1 PE=1 SV=2 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 89  YTNCSCIP-------NGMATQGACPAD--CGSHFMWFIFILCLLNFFSATGRAGNTIIQF 139
           + NCSC+        N  A  G CP D  C   F +F+ I  L  FFSA G   + ++  
Sbjct: 501 FYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIV 560

Query: 140 RCVSPEDKSLSIGITEALGCGLAFIPGPIIYGALL 174
           + V PE KSL++G    +   L  I  PI +GAL+
Sbjct: 561 KIVQPELKSLALGFHSMVIRALGGILAPIYFGALI 595




Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. Involved in the clearance of bile acids and organic anions from the liver.
Homo sapiens (taxid: 9606)
>sp|Q9JHI3|SO2B1_RAT Solute carrier organic anion transporter family member 2B1 OS=Rattus norvegicus GN=Slco2b1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JJL3|SO1B2_MOUSE Solute carrier organic anion transporter family member 1B2 OS=Mus musculus GN=Slco1b2 PE=1 SV=1 Back     alignment and function description
>sp|Q92959|SO2A1_HUMAN Solute carrier organic anion transporter family member 2A1 OS=Homo sapiens GN=SLCO2A1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BXB6|SO2B1_MOUSE Solute carrier organic anion transporter family member 2B1 OS=Mus musculus GN=Slco2b1 PE=1 SV=1 Back     alignment and function description
>sp|Q99J94|SO1A6_MOUSE Solute carrier organic anion transporter family member 1A6 OS=Mus musculus GN=Slco1a6 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZX8|SO1B2_RAT Solute carrier organic anion transporter family member 1B2 OS=Rattus norvegicus GN=Slco1b2 PE=1 SV=2 Back     alignment and function description
>sp|Q9EPT5|SO2A1_MOUSE Solute carrier organic anion transporter family member 2A1 OS=Mus musculus GN=Slco2a1 PE=1 SV=2 Back     alignment and function description
>sp|O88397|SO1A5_RAT Solute carrier organic anion transporter family member 1A5 OS=Rattus norvegicus GN=Slco1a5 PE=2 SV=2 Back     alignment and function description
>sp|Q00910|SO2A1_RAT Solute carrier organic anion transporter family member 2A1 OS=Rattus norvegicus GN=Slco2a1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
328710400 645 PREDICTED: solute carrier organic anion 0.511 0.137 0.522 2e-20
158296207 687 AGAP006637-PB [Anopheles gambiae str. PE 0.494 0.125 0.414 8e-15
195027459 649 GH20434 [Drosophila grimshawi] gi|193902 0.494 0.132 0.4 4e-14
195402609272 GJ14982 [Drosophila virilis] gi|19414076 0.494 0.316 0.410 9e-14
195154411 457 GL16935 [Drosophila persimilis] gi|19411 0.5 0.190 0.373 1e-13
242006912 607 conserved hypothetical protein [Pediculu 0.494 0.141 0.443 2e-13
198460227 667 GA17416 [Drosophila pseudoobscura pseudo 0.5 0.130 0.373 2e-13
195119832 649 GI19617 [Drosophila mojavensis] gi|19390 0.494 0.132 0.4 2e-13
195426312 670 GK20833 [Drosophila willistoni] gi|19415 0.494 0.128 0.373 4e-13
195346678 428 GM15650 [Drosophila sechellia] gi|194135 0.494 0.200 0.368 4e-13
>gi|328710400|ref|XP_001949701.2| PREDICTED: solute carrier organic anion transporter family member 4C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 86  LRTYTNCSCIPN-GMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSP 144
           L+ Y+NC+CI   G AT+G CP  CG+ F+ F+ ++ ++ F S+TGR+GNTIIQFRCV  
Sbjct: 487 LKAYSNCTCIGGLGTATEGVCPVACGNDFIIFLALMGVMRFLSSTGRSGNTIIQFRCVKQ 546

Query: 145 EDKSLSIGITEALGCGLAFIPGPIIYGALL 174
           EDKSLS+G +E +   +AF+PGPI+YG ++
Sbjct: 547 EDKSLSLGFSEVVMALVAFMPGPILYGTIV 576




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158296207|ref|XP_001237849.2| AGAP006637-PB [Anopheles gambiae str. PEST] gi|157016401|gb|EAU76635.2| AGAP006637-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195027459|ref|XP_001986600.1| GH20434 [Drosophila grimshawi] gi|193902600|gb|EDW01467.1| GH20434 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195402609|ref|XP_002059897.1| GJ14982 [Drosophila virilis] gi|194140763|gb|EDW57234.1| GJ14982 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195154411|ref|XP_002018115.1| GL16935 [Drosophila persimilis] gi|194113911|gb|EDW35954.1| GL16935 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|242006912|ref|XP_002424286.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507686|gb|EEB11548.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198460227|ref|XP_001361660.2| GA17416 [Drosophila pseudoobscura pseudoobscura] gi|198136942|gb|EAL26239.2| GA17416 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195119832|ref|XP_002004433.1| GI19617 [Drosophila mojavensis] gi|193909501|gb|EDW08368.1| GI19617 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195426312|ref|XP_002061282.1| GK20833 [Drosophila willistoni] gi|194157367|gb|EDW72268.1| GK20833 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195346678|ref|XP_002039884.1| GM15650 [Drosophila sechellia] gi|194135233|gb|EDW56749.1| GM15650 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
FB|FBgn0034716789 Oatp58Dc "Organic anion transp 0.477 0.105 0.397 3.9e-24
FB|FBgn0034715722 Oatp58Db "Organic anion transp 0.436 0.105 0.434 5.1e-24
FB|FBgn0032433745 Oatp33Ea "Organic anion transp 0.413 0.096 0.375 1.7e-20
UNIPROTKB|Q9UIG8 710 SLCO3A1 "Solute carrier organi 0.517 0.126 0.354 1.6e-19
UNIPROTKB|F1SCI1692 SLCO3A1 "Uncharacterized prote 0.517 0.130 0.354 1.9e-19
UNIPROTKB|F1NSG0 709 SLCO3A1 "Uncharacterized prote 0.517 0.126 0.354 2.1e-19
UNIPROTKB|Q8HYW2 710 SLCO3A1 "Solute carrier organi 0.517 0.126 0.364 2.1e-19
MGI|MGI:1351867 710 Slco3a1 "solute carrier organi 0.517 0.126 0.354 2.1e-19
RGD|620227 710 Slco3a1 "solute carrier organi 0.517 0.126 0.354 2.1e-19
UNIPROTKB|Q99N02 710 Slco3a1 "Solute carrier organi 0.517 0.126 0.354 2.1e-19
FB|FBgn0034716 Oatp58Dc "Organic anion transporting polypeptide 58Dc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 3.9e-24, Sum P(3) = 3.9e-24
 Identities = 33/83 (39%), Positives = 50/83 (60%)

Query:    89 YTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKS 148
             ++    + NG A  GACP +C + F+ F+ ++C L F  A+GRA N ++  RCV  +DK+
Sbjct:   621 HSQLEALANGQAMPGACPVNCWTQFVAFLAVMCCLKFVGASGRASNFLVSVRCVPEKDKT 680

Query:   149 LSIGITEALGCGLAFIPGPIIYG 171
              ++G    L   LAFIP PI +G
Sbjct:   681 AAMGFGMTLCSMLAFIPSPIFFG 703


GO:0015711 "organic anion transport" evidence=ISS
GO:0015347 "sodium-independent organic anion transmembrane transporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS
GO:0008514 "organic anion transmembrane transporter activity" evidence=ISS
GO:0031427 "response to methotrexate" evidence=IEP
FB|FBgn0034715 Oatp58Db "Organic anion transporting polypeptide 58Db" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032433 Oatp33Ea "Organic anion transporting polypeptide 33Ea" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UIG8 SLCO3A1 "Solute carrier organic anion transporter family member 3A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCI1 SLCO3A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSG0 SLCO3A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HYW2 SLCO3A1 "Solute carrier organic anion transporter family member 3A1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1351867 Slco3a1 "solute carrier organic anion transporter family, member 3a1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620227 Slco3a1 "solute carrier organic anion transporter family, member 3a1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q99N02 Slco3a1 "Solute carrier organic anion transporter family member 3A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
pfam03137582 pfam03137, OATP, Organic Anion Transporter Polypep 1e-17
TIGR00805633 TIGR00805, oat, sodium-independent organic anion t 2e-10
pfam03137 582 pfam03137, OATP, Organic Anion Transporter Polypep 1e-06
pfam03137 582 pfam03137, OATP, Organic Anion Transporter Polypep 5e-05
TIGR00805 633 TIGR00805, oat, sodium-independent organic anion t 6e-05
>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information
 Score = 78.9 bits (195), Expect = 1e-17
 Identities = 34/90 (37%), Positives = 52/90 (57%)

Query: 84  CFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVS 143
                  NCS   +  A++G CP+DC + F++F+ ++ +L+F          +I  RCV 
Sbjct: 465 SCSTWSNNCSSGNSHSASKGYCPSDCCTQFLYFLILMAILSFIGFLSAIPLYMIVLRCVP 524

Query: 144 PEDKSLSIGITEALGCGLAFIPGPIIYGAL 173
           PE+KSL++G+   L   L FIP PII+GAL
Sbjct: 525 PEEKSLALGVQWLLIRLLGFIPAPIIFGAL 554


This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters. Length = 582

>gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter Back     alignment and domain information
>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information
>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information
>gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
KOG3626|consensus735 99.97
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 99.96
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 99.95
KOG3626|consensus 735 99.94
TIGR00805633 oat sodium-independent organic anion transporter. 99.89
TIGR00805 633 oat sodium-independent organic anion transporter. 99.79
KOG1330|consensus493 98.4
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.82
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 96.81
PRK11663 434 regulatory protein UhpC; Provisional 96.71
PRK05122 399 major facilitator superfamily transporter; Provisi 96.64
PRK10054 395 putative transporter; Provisional 96.63
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 96.48
KOG1330|consensus 493 96.45
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.45
TIGR00891 405 2A0112 putative sialic acid transporter. 96.34
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 96.32
PRK14995 495 methyl viologen resistance protein SmvA; Provision 96.26
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 96.19
PRK10091 382 MFS transport protein AraJ; Provisional 96.18
PRK03699 394 putative transporter; Provisional 96.14
PRK03545 390 putative arabinose transporter; Provisional 96.11
PRK09705 393 cynX putative cyanate transporter; Provisional 96.11
PRK03633 381 putative MFS family transporter protein; Provision 96.07
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 95.99
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 95.98
PRK12382 392 putative transporter; Provisional 95.97
TIGR00900 365 2A0121 H+ Antiporter protein. 95.95
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.88
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 95.83
TIGR00895 398 2A0115 benzoate transport. 95.73
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 95.71
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 95.66
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 95.62
TIGR00893 399 2A0114 d-galactonate transporter. 95.58
TIGR00898 505 2A0119 cation transport protein. 95.56
TIGR00900365 2A0121 H+ Antiporter protein. 95.49
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.41
PRK10213 394 nepI ribonucleoside transporter; Reviewed 95.4
PRK11646 400 multidrug resistance protein MdtH; Provisional 95.25
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 95.24
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 95.12
PRK03893 496 putative sialic acid transporter; Provisional 95.08
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 95.05
PRK10489417 enterobactin exporter EntS; Provisional 94.89
PRK10489 417 enterobactin exporter EntS; Provisional 94.87
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 94.8
TIGR00892455 2A0113 monocarboxylate transporter 1. 94.77
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 94.71
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 94.65
PRK10473 392 multidrug efflux system protein MdtL; Provisional 94.64
PRK10077 479 xylE D-xylose transporter XylE; Provisional 94.52
PRK11195 393 lysophospholipid transporter LplT; Provisional 94.38
PRK09874 408 drug efflux system protein MdtG; Provisional 94.25
PRK14995495 methyl viologen resistance protein SmvA; Provision 94.17
PRK10504 471 putative transporter; Provisional 94.13
TIGR00891405 2A0112 putative sialic acid transporter. 94.11
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 94.03
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 93.98
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 93.91
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 93.83
TIGR00893399 2A0114 d-galactonate transporter. 93.7
KOG2325|consensus 488 93.67
TIGR00902382 2A0127 phenyl proprionate permease family protein. 93.4
TIGR00895398 2A0115 benzoate transport. 93.3
PRK12307 426 putative sialic acid transporter; Provisional 92.97
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 92.92
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 92.36
TIGR00889418 2A0110 nucleoside transporter. This family of prot 92.3
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 92.16
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 91.99
TIGR00897402 2A0118 polyol permease family. This family of prot 91.97
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 91.88
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 91.67
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 91.66
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 91.65
PRK10133 438 L-fucose transporter; Provisional 91.58
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 91.58
TIGR00892 455 2A0113 monocarboxylate transporter 1. 91.42
TIGR00881379 2A0104 phosphoglycerate transporter family protein 91.36
TIGR00901356 2A0125 AmpG-related permease. 91.34
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 91.14
PRK11043 401 putative transporter; Provisional 91.05
TIGR00901 356 2A0125 AmpG-related permease. 90.99
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 90.96
PRK10504471 putative transporter; Provisional 90.86
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 90.83
PRK15011 393 sugar efflux transporter B; Provisional 90.55
TIGR00896 355 CynX cyanate transporter. This family of proteins 90.52
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 90.45
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 90.29
PRK09528420 lacY galactoside permease; Reviewed 90.27
PRK11652 394 emrD multidrug resistance protein D; Provisional 90.26
TIGR00880141 2_A_01_02 Multidrug resistance protein. 90.25
PRK15403 413 multidrug efflux system protein MdtM; Provisional 90.22
PRK11902 402 ampG muropeptide transporter; Reviewed 90.15
PRK10406 432 alpha-ketoglutarate transporter; Provisional 90.09
KOG3764|consensus 464 89.96
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 89.64
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 89.54
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 89.51
PRK15075434 citrate-proton symporter; Provisional 89.32
PRK09952 438 shikimate transporter; Provisional 89.23
PRK09874408 drug efflux system protein MdtG; Provisional 89.01
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 88.99
PRK09952438 shikimate transporter; Provisional 88.97
PRK03893496 putative sialic acid transporter; Provisional 88.9
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 88.73
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 88.68
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 88.65
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 88.63
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 88.53
KOG2533|consensus 495 88.41
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 88.13
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 88.13
PRK11646400 multidrug resistance protein MdtH; Provisional 87.9
PRK10642 490 proline/glycine betaine transporter; Provisional 87.88
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 87.29
PRK03699394 putative transporter; Provisional 87.2
PLN00028 476 nitrate transmembrane transporter; Provisional 86.59
PRK10406432 alpha-ketoglutarate transporter; Provisional 86.5
PRK03545 390 putative arabinose transporter; Provisional 85.74
KOG0254|consensus 513 84.65
PRK15462 493 dipeptide/tripeptide permease D; Provisional 84.31
PRK10077 479 xylE D-xylose transporter XylE; Provisional 84.13
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 83.71
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 83.1
PRK10642490 proline/glycine betaine transporter; Provisional 82.99
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 82.13
PRK12382 392 putative transporter; Provisional 81.84
PRK12307 426 putative sialic acid transporter; Provisional 81.67
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 80.83
PRK15075 434 citrate-proton symporter; Provisional 80.55
KOG2532|consensus 466 80.07
>KOG3626|consensus Back     alignment and domain information
Probab=99.97  E-value=3.7e-32  Score=245.39  Aligned_cols=173  Identities=36%  Similarity=0.751  Sum_probs=151.6

Q ss_pred             hhHHHHHHHHHHhhcccccccceeeeeecccccCCCchhHHHHHHHHHhhhhhhhhhhhhccC-----C-C------CCc
Q psy10696          2 FSVIILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPVVLGVMSSAWDVGTLASFLVSSYLG-----G-K------GHK   69 (174)
Q Consensus         2 ~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~s~~~g~i~~~~~ig~~~~~~~~s~~g-----~-~------~~~   69 (174)
                      .+|.+|+++|++.|+|.+++++++++|||||.|+.+.|.|+|++.+...+||++|++++|++.     - .      .+|
T Consensus       235 ~~~llff~~q~l~GIG~Tpi~tlGisYiDDnvk~~~SplYlgi~~~~~~lGPaiGfllgS~~l~lYvD~~~~~~~it~~D  314 (735)
T KOG3626|consen  235 YPFLLFFLGQLLLGIGATPIFTLGISYIDDNVKKKNSPLYLGILYSMAILGPAIGFLLGSFCLKLYVDFGLSPIGITPTD  314 (735)
T ss_pred             hhHHHHHHHHHHhhcCCCCCccCCCccccccccccCCcHHHHHHHHHHHhhhHHHHHHHHHHHHeeeccccCCCCCCCCC
Confidence            378999999999999999999999999999999999999999999999999999999999762     1 1      589


Q ss_pred             ceeee---ehhhhhhhhcccccc---------------------------------------------------------
Q psy10696         70 TKWVA---LGSIIMSIGCFLRTY---------------------------------------------------------   89 (174)
Q Consensus        70 prwig---~g~l~~~~g~~l~~l---------------------------------------------------------   89 (174)
                      |||+|   +|+++.+.-.++.+.                                                         
T Consensus       315 PrWIGAWWlGFLi~g~~~~~~a~p~f~fPk~lp~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~ikdfp~s~~~ll~N~if  394 (735)
T KOG3626|consen  315 PRWIGAWWLGFLICGALLLFSAVPLFFFPKELPKSQKRKRARDLHVLKTESGGAKSDKTFGKKIKDFPKSIKRLLSNPIF  394 (735)
T ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHhCcccCccccccchhhhhcccccccccccCCcchhhhHHHHHHHHHHHhcCchH
Confidence            99998   899998875554110                                                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy10696         90 --------------------------------------------------------------------------------   89 (174)
Q Consensus        90 --------------------------------------------------------------------------------   89 (174)
                                                                                                      
T Consensus       395 ~~~~l~~~~~~~~~~G~~tFlPKyLE~Qfg~sas~An~l~G~i~vp~~~~Gi~lGG~iikkfkl~~r~~a~~~~~~~~l~  474 (735)
T KOG3626|consen  395 MLVVLASVIESLAITGYITFLPKYLETQFGISASLANILTGSIGVPAAAVGIFLGGLIIKKFKLSARGAAKFVIVCSVLS  474 (735)
T ss_pred             HHHHHHHHHHHHHHhhHHHhhHHHHHHHcCCCHHHHHHHhhhhhhhhhhhhhhccceeeeeecccHHHHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy10696         90 --------------------------------------------------------------------------------   89 (174)
Q Consensus        90 --------------------------------------------------------------------------------   89 (174)
                                                                                                      
T Consensus       475 l~~~~~~~~igC~~~~~aG~~~~y~~~~~~~~~~~~~s~Cn~~C~C~~~~~~PVCg~~G~tY~SpChAGC~~~~~~~~~~  554 (735)
T KOG3626|consen  475 LLFYSLLFFIGCESSPVAGVTNSYEGSPAFTSHENPFSSCNSDCSCDTSEYEPVCGENGITYFSPCHAGCTESSGTSDGN  554 (735)
T ss_pred             HHHHHHHHEecCCCCcccceecCCCCCCccccCCCchhhhhcCCCCCCcCcCcccCCCCCEEeChhhhCCcccccCCCCc
Confidence                                                                                            


Q ss_pred             ---cccccCC-----CCccccCCCCCCccchhHHHHHHHHHHHHHhhcCccCceeEEeeecCCCCchhHHHHHHHHHHhh
Q psy10696         90 ---TNCSCIP-----NGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQFRCVSPEDKSLSIGITEALGCGL  161 (174)
Q Consensus        90 ---~~c~c~~-----~~~~~~~~C~~~C~~~~~~f~~lf~~~q~l~g~g~tP~~~lgl~~V~~~~sslylGi~~~~~rll  161 (174)
                         +||+|.+     ++.+++|.|+.+|.+.+..|+.++++..++.+++++|.+.+.+|+|+||+|++++|++++++|+|
T Consensus       555 ~~ytnCsCv~~~~~~~~~a~~G~C~~~c~~~~~~Fl~~~~~~sf~~~~~~~p~~~i~LR~V~~e~ks~AlG~~~~~irll  634 (735)
T KOG3626|consen  555 TIYTNCSCVPTNKNGNGSAKKGYCPNDCCRQFLIFLALFAIGSFIGALGAVPGMLIVLRCVPPEEKSFALGFQWMLIRLL  634 (735)
T ss_pred             eeeccccccccccCCCceeecCCCCCCcchhhHHHHHHHHHHHHHHHhccCcceEEEEEccCchhchhhhHHHHHHHHHH
Confidence               0245543     22566788999987777889999999999999999999999999999999999999999999999


Q ss_pred             ccCcchhhhhccC
Q psy10696        162 AFIPGPIIYGALL  174 (174)
Q Consensus       162 g~IP~Pi~fG~~i  174 (174)
                      |+||+||+|||+|
T Consensus       635 g~IPsPIifG~~I  647 (735)
T KOG3626|consen  635 GFIPSPIIFGAVI  647 (735)
T ss_pred             hcCCchHhhhhhH
Confidence            9999999999987



>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.98
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 96.96
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.54
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 96.47
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 95.89
2xut_A 524 Proton/peptide symporter family protein; transport 94.85
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 90.75
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 86.15
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 82.81
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
Probab=96.98  E-value=0.00013  Score=59.37  Aligned_cols=140  Identities=14%  Similarity=0.160  Sum_probs=97.4

Q ss_pred             HHHHHHHHHhhcccccccceeeeeecccccCCCchh-HHHHHHHHHhhhhhhhhhhhhccCCCCCcceeeeehhhhhhhh
Q psy10696          5 IILLISSTVLGIGSSTYWSLGVAYLDDNVRKNKMPV-VLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIG   83 (174)
Q Consensus         5 ~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~s~-~~g~i~~~~~ig~~~~~~~~s~~g~~~~~prwig~g~l~~~~g   83 (174)
                      ..+++..++.+++.+.+.+    .+.+++++++.+. +.|.+.+.+.++..++.++.+++.+|-.|-|.+-++.++.+++
T Consensus         3 ~~~~~~~~~~~~~~~~~~~----~~~~~~~~~g~s~~~~g~~~~~~~~~~~~~~~~~g~l~dr~g~r~~~~~~~~~~~~~   78 (375)
T 2gfp_A            3 LMLVLLVAVGQMAQTIYIP----AIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISDRVGRRPVILVGMSIFMLA   78 (375)
T ss_dssp             HHHHHHHHHHHHHHHHHHH----HHHHHHTTSSSTTHHHHHHHHHHHHHHHHHHTTHHHHHTTSCCCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhh----hhHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchhHHHHHHHHHHH
Confidence            4567777888876665444    3445677888885 9999999999999999999999988755545556777777777


Q ss_pred             cccccccccccCCCCccccCCCCCCccchhHHHHHHHHHHHHHhhcCccCceeEE----eeecCCCCchhHHHHHHHHHH
Q psy10696         84 CFLRTYTNCSCIPNGMATQGACPADCGSHFMWFIFILCLLNFFSATGRAGNTIIQ----FRCVSPEDKSLSIGITEALGC  159 (174)
Q Consensus        84 ~~l~~l~~c~c~~~~~~~~~~C~~~C~~~~~~f~~lf~~~q~l~g~g~tP~~~lg----l~~V~~~~sslylGi~~~~~r  159 (174)
                      .++..+.                    ++.+    .+.+..++.|++.+..++..    -+..++|+|+.+.|+... ..
T Consensus        79 ~~~~~~~--------------------~~~~----~l~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  133 (375)
T 2gfp_A           79 TLVAVTT--------------------SSLT----VLIAASAMQGMGTGVGGVMARTLPRDLYERTQLRHANSLLNM-GI  133 (375)
T ss_dssp             HHHHHHH--------------------HHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSCCSHHHHHHH-HH
T ss_pred             HHHHHHh--------------------ccHH----HHHHHHHHHHHHHHhhhhhHHHHHHHHCCHHHHHHHHHHHHH-HH
Confidence            7665432                    1111    12345666666665544433    345788999999999876 44


Q ss_pred             hhccCcchhhhhcc
Q psy10696        160 GLAFIPGPIIYGAL  173 (174)
Q Consensus       160 llg~IP~Pi~fG~~  173 (174)
                      -+|.+.+|.+.|++
T Consensus       134 ~~g~~~~~~~~~~l  147 (375)
T 2gfp_A          134 LVSPLLAPLIGGLL  147 (375)
T ss_dssp             HHHHHHHHHHHHHS
T ss_pred             HHHHHhhHHHHHHH
Confidence            55777788877664



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 96.02
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 94.12
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 92.45
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=96.02  E-value=0.00024  Score=56.22  Aligned_cols=124  Identities=11%  Similarity=0.110  Sum_probs=79.5

Q ss_pred             ceeeeeecccccCCCchh-HHHHHHHHHhhhhhhhhhhhhccCCCCCcceeeeehhhhhhhhcccccccccccCCCCccc
Q psy10696         23 SLGVAYLDDNVRKNKMPV-VLGVMSSAWDVGTLASFLVSSYLGGKGHKTKWVALGSIIMSIGCFLRTYTNCSCIPNGMAT  101 (174)
Q Consensus        23 ~~~~~~i~~~~~~~~~s~-~~g~i~~~~~ig~~~~~~~~s~~g~~~~~prwig~g~l~~~~g~~l~~l~~c~c~~~~~~~  101 (174)
                      +...+++.    +++.+. +.|++.+.+.++.+++.++.+++.+|-.|-|.+-++.++.+++.++..+-....       
T Consensus        45 ~~~~p~~~----~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~-------  113 (447)
T d1pw4a_          45 ALAMPYLV----EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWAT-------  113 (447)
T ss_dssp             HHHHHHTT----SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHH-------
T ss_pred             HHHHHHHH----HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhh-------
Confidence            34445443    357775 999999999999999999999998876555566788888888777665421100       


Q ss_pred             cCCCCCCccchhHHHHHHHHHHHHHhhcCccCce----eEEeeecCCCCchhHHHHHHHHHHhhccCcchhhhh
Q psy10696        102 QGACPADCGSHFMWFIFILCLLNFFSATGRAGNT----IIQFRCVSPEDKSLSIGITEALGCGLAFIPGPIIYG  171 (174)
Q Consensus       102 ~~~C~~~C~~~~~~f~~lf~~~q~l~g~g~tP~~----~lgl~~V~~~~sslylGi~~~~~rllg~IP~Pi~fG  171 (174)
                               ++...+    ++..++.|++.+..+    .+.-+..++++|+.++|+..... .+|.+.+|++.+
T Consensus       114 ---------~~~~~~----~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~-~~g~~i~~~~~~  173 (447)
T d1pw4a_         114 ---------SSIAVM----FVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAH-NVGGGIPPLLFL  173 (447)
T ss_dssp             ---------SSSSHH----HHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHH-HHHHTSHHHHHH
T ss_pred             ---------hhHHHH----HHHHHHHHHhhhhhhhHHHHHHHHHHHhhccccccccccccc-chhhhhhhhhhh
Confidence                     001112    223444444443333    33345688899999999887644 445666666544



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure