Psyllid ID: psy10704

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MKVDLMGQSIYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVIKS
ccccccccccccccccccHHHHHHHccccccccccccccEEEEEEcccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccEEEEEEEcccEEEEEccccHHHcccccHHcccccEEEEEcHHcHHHHHHHHHHHHHHccccc
cccEEccccHHHccccccHHHHHHHHccccccccccccccEEEEEEEEcccccEEEEEcccEEEEEEccEEEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEEEccccccccccEcccccEEEEEEccccEEEEcHHHHHHHcccHHHHHcccEEEEcccccHHHHHHHHHHHHHHccccc
mkvdlmgqsiyevthpcdhsevksilsanhteDIRAQRSVFIRLKCtltskgrnvnvkaATYKVIHCtghlvqnqtpasngstlmepqdnienqsdntrrgsaiqdkddsepeeevgekrrvvtepshcfvaigepiphpanydvplsqtfltkhsldmkftyadetmedflgfnpdifiaksvfdfhhaqdsfhiqnafknpcyscviks
MKVDLMGQSIYEvthpcdhsevKSILSANHTEDIRAQRSVFIRLKctltskgrnvnvKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDnienqsdntrrgsaiqdkddsepeeevgekrrvvtepSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFhiqnafknpCYSCVIKS
MKVDLMGQSIYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVIKS
*********IYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLV*****************************************************PSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVI**
MKVDLMGQSIYEVTHPCDHSEVKSILSA************************************IHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQ********************PSHCFVAIGEPIPH******PLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSC*I**
MKVDLMGQSIYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIEN****************************VVTEPSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVIKS
*KVDLMGQSIYEVTHPCDHSEVKSILSANHTE**RAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQNQTPAS*****************NTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVIK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVDLMGQSIYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHPANYDVPLSQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYSCVIKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q61221 836 Hypoxia-inducible factor yes N/A 0.748 0.188 0.368 2e-37
Q9YIB9 811 Hypoxia-inducible factor yes N/A 0.748 0.194 0.383 6e-37
Q16665 826 Hypoxia-inducible factor yes N/A 0.748 0.191 0.368 9e-37
O35800 825 Hypoxia-inducible factor yes N/A 0.748 0.191 0.373 1e-36
Q309Z6 819 Hypoxia-inducible factor N/A N/A 0.748 0.192 0.368 1e-36
Q9XTA5 823 Hypoxia-inducible factor yes N/A 0.748 0.191 0.378 2e-36
Q0PGG7 823 Hypoxia-inducible factor N/A N/A 0.748 0.191 0.378 2e-36
Q24167 1507 Protein similar OS=Drosop yes N/A 0.720 0.100 0.381 3e-35
Q98SW2 766 Hypoxia-inducible factor N/A N/A 0.772 0.212 0.355 2e-34
Q99814 870 Endothelial PAS domain-co no N/A 0.786 0.190 0.344 1e-33
>sp|Q61221|HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus GN=Hif1a PE=1 SV=3 Back     alignment and function desciption
 Score =  155 bits (392), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 121/201 (60%), Gaps = 43/201 (21%)

Query: 2   KVDLMGQSIYEVTHPCDHSEVKSILS-----ANHTEDIRAQRSVFIRLKCTLTSKGRNVN 56
           + +L G S+++ THPCDH E++ +L+         +++  QRS F+R+KCTLTS+GR +N
Sbjct: 124 QFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKELNTQRSFFLRMKCTLTSRGRTMN 183

Query: 57  VKAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEV 116
           +K+AT+KV+HCTGH+                                + D + ++P+   
Sbjct: 184 IKSATWKVLHCTGHI-------------------------------HVYDTNSNQPQ--C 210

Query: 117 GEKRRVVTEPSHCFVAIGEPIPHPANYDVPL-SQTFLTKHSLDMKFTYADETMEDFLGFN 175
           G K+     P  C V I EPIPHP+N ++PL S+TFL++HSLDMKF+Y DE + + +G+ 
Sbjct: 211 GYKK----PPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYE 266

Query: 176 PDIFIAKSVFDFHHAQDSFHI 196
           P+  + +S+++++HA DS H+
Sbjct: 267 PEELLGRSIYEYYHALDSDHL 287
Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP.
Mus musculus (taxid: 10090)
>sp|Q9YIB9|HIF1A_CHICK Hypoxia-inducible factor 1-alpha OS=Gallus gallus GN=HIF1A PE=2 SV=2 Back     alignment and function description
>sp|Q16665|HIF1A_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens GN=HIF1A PE=1 SV=1 Back     alignment and function description
>sp|O35800|HIF1A_RAT Hypoxia-inducible factor 1-alpha OS=Rattus norvegicus GN=Hif1a PE=2 SV=1 Back     alignment and function description
>sp|Q309Z6|HIF1A_EOSBA Hypoxia-inducible factor 1-alpha OS=Eospalax baileyi GN=HIF1A PE=2 SV=1 Back     alignment and function description
>sp|Q9XTA5|HIF1A_BOVIN Hypoxia-inducible factor 1-alpha OS=Bos taurus GN=HIF1A PE=2 SV=1 Back     alignment and function description
>sp|Q0PGG7|HIF1A_BOSMU Hypoxia-inducible factor 1-alpha OS=Bos mutus grunniens GN=HIF1A PE=2 SV=1 Back     alignment and function description
>sp|Q24167|SIMA_DROME Protein similar OS=Drosophila melanogaster GN=sima PE=2 SV=2 Back     alignment and function description
>sp|Q98SW2|HIF1A_ONCMY Hypoxia-inducible factor 1-alpha OS=Oncorhynchus mykiss GN=hif1a PE=2 SV=1 Back     alignment and function description
>sp|Q99814|EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens GN=EPAS1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
189237669 795 PREDICTED: similar to hypoxia-inducible 0.763 0.202 0.495 1e-46
270008138 879 hypoxia inducible factor 1, alpha subuni 0.763 0.183 0.495 2e-46
328718768 928 PREDICTED: hypothetical protein LOC10016 0.886 0.201 0.443 2e-43
328788553 1138 PREDICTED: hypothetical protein LOC40885 0.829 0.153 0.453 1e-41
242022671 368 Hypoxia-inducible factor 1 alpha, putati 0.710 0.407 0.457 3e-41
350421186 1132 PREDICTED: hypothetical protein LOC10074 0.824 0.153 0.450 1e-40
383863621 1095 PREDICTED: uncharacterized protein LOC10 0.829 0.159 0.433 4e-40
380025288 580 PREDICTED: hypoxia-inducible factor 1-al 0.834 0.303 0.428 5e-40
332023564 730 Hypoxia-inducible factor 1 alpha [Acromy 0.824 0.238 0.400 4e-38
345489461 989 PREDICTED: hypothetical protein LOC10012 0.815 0.173 0.413 1e-37
>gi|189237669|ref|XP_967427.2| PREDICTED: similar to hypoxia-inducible factor 1 alpha [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/202 (49%), Positives = 125/202 (61%), Gaps = 41/202 (20%)

Query: 2   KVDLMGQSIYEVTHPCDHSEVKSILSANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKAAT 61
           ++DLMGQ+I+E +HPCDH E+K ILS    E+    +S FIRLKCTLTSKGR+VN+K+AT
Sbjct: 127 QIDLMGQNIFEYSHPCDHDEIKEILSTKTREETETPKSFFIRLKCTLTSKGRSVNLKSAT 186

Query: 62  YKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRR 121
           YKVIHCTGH+VQ +                                DD   E   G  RR
Sbjct: 187 YKVIHCTGHIVQTE--------------------------------DDGNEENAKGTLRR 214

Query: 122 VVTEPSHCFVAIGEPIPHPANYDVPL-SQTFLTKHSLDMKFTYADE-TMEDFLGFNPDIF 179
                  C VAIG+PIPHP+N + PL  QTFLTKHSLDMKFT+AD+  M D LG++ +  
Sbjct: 215 -------CLVAIGQPIPHPSNIEAPLPRQTFLTKHSLDMKFTHADDKIMMDVLGYDSEDL 267

Query: 180 IAKSVFDFHHAQDSFHIQNAFK 201
           + KSV+D+HHA DS  I +AFK
Sbjct: 268 VGKSVYDYHHAMDSDAICSAFK 289

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270008138|gb|EFA04586.1| hypoxia inducible factor 1, alpha subunit [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328718768|ref|XP_001951675.2| PREDICTED: hypothetical protein LOC100167974 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328788553|ref|XP_392382.4| PREDICTED: hypothetical protein LOC408852 [Apis mellifera] Back     alignment and taxonomy information
>gi|242022671|ref|XP_002431762.1| Hypoxia-inducible factor 1 alpha, putative [Pediculus humanus corporis] gi|212517087|gb|EEB19024.1| Hypoxia-inducible factor 1 alpha, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350421186|ref|XP_003492763.1| PREDICTED: hypothetical protein LOC100746032 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863621|ref|XP_003707278.1| PREDICTED: uncharacterized protein LOC100880842 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025288|ref|XP_003696409.1| PREDICTED: hypoxia-inducible factor 1-alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|332023564|gb|EGI63800.1| Hypoxia-inducible factor 1 alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345489461|ref|XP_001605010.2| PREDICTED: hypothetical protein LOC100121394 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
ZFIN|ZDB-GENE-040426-706 777 hif1ab "hypoxia-inducible fact 0.398 0.108 0.483 8.5e-38
UNIPROTKB|F1NJK2 810 HIF1A "Hypoxia-inducible facto 0.322 0.083 0.527 1.9e-36
MGI|MGI:106918 836 Hif1a "hypoxia inducible facto 0.412 0.104 0.414 2.6e-36
UNIPROTKB|F1NQK5 811 HIF1A "Hypoxia-inducible facto 0.336 0.087 0.5 5e-36
UNIPROTKB|Q9YIB9 811 HIF1A "Hypoxia-inducible facto 0.336 0.087 0.5 5e-36
RGD|61928 825 Hif1a "hypoxia-inducible facto 0.402 0.103 0.433 6.6e-36
UNIPROTKB|O35800 825 Hif1a "Hypoxia-inducible facto 0.402 0.103 0.433 6.6e-36
UNIPROTKB|F1LT63 827 Hif1a "Hypoxia-inducible facto 0.402 0.102 0.433 6.7e-36
UNIPROTKB|D4A8P8 828 Hif1a "Hypoxia-inducible facto 0.402 0.102 0.433 6.7e-36
UNIPROTKB|F8W9L0 767 HIF1A "Hypoxia-inducible facto 0.412 0.113 0.414 6.7e-36
ZFIN|ZDB-GENE-040426-706 hif1ab "hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 8.5e-38, Sum P(2) = 8.5e-38
 Identities = 43/89 (48%), Positives = 61/89 (68%)

Query:     4 DLMGQSIYEVTHPCDHSEVKSIL----SANHTEDIRAQRSVFIRLKCTLTSKGRNVNVKA 59
             DL G SI+E +HPCDH E++ +L     +  T++   +RS F+R+KCTLTS+GR VN+K+
Sbjct:   127 DLTGHSIFEFSHPCDHEELREMLVHRTGSKKTKEQNTERSFFLRMKCTLTSRGRTVNIKS 186

Query:    60 ATYKVIHCTGHL-VQNQTPASNGSTLMEP 87
             AT+KV+HC GH+ V   + AS  S   EP
Sbjct:   187 ATWKVLHCAGHVRVHEGSEASEDSGFKEP 215
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0051402 "neuron apoptotic process" evidence=IGI
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|F1NJK2 HIF1A "Hypoxia-inducible factor 1-alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:106918 Hif1a "hypoxia inducible factor 1, alpha subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQK5 HIF1A "Hypoxia-inducible factor 1-alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YIB9 HIF1A "Hypoxia-inducible factor 1-alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|61928 Hif1a "hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O35800 Hif1a "Hypoxia-inducible factor 1-alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LT63 Hif1a "Hypoxia-inducible factor 1-alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A8P8 Hif1a "Hypoxia-inducible factor 1-alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8W9L0 HIF1A "Hypoxia-inducible factor 1-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
smart0009167 smart00091, PAS, PAS domain 2e-05
cd00130103 cd00130, PAS, PAS domain; PAS motifs appear in arc 6e-05
>gnl|CDD|214512 smart00091, PAS, PAS domain Back     alignment and domain information 
 Score = 40.5 bits (95), Expect = 2e-05
 Identities = 15/55 (27%), Positives = 27/55 (49%)

Query: 148 SQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKN 202
               +    LD +  YA+   E+ LG++P+  I KS+ +  H +D   +Q A + 
Sbjct: 10  LPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQR 64

PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. Length = 67
>gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
KOG3558|consensus 768 100.0
KOG3559|consensus 598 99.92
KOG3560|consensus 712 99.92
KOG3561|consensus 803 99.75
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 99.69
KOG3753|consensus 1114 99.64
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 98.13
KOG3561|consensus 803 98.1
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.05
KOG3558|consensus 768 97.99
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 97.78
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 97.77
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 97.76
PRK13560 807 hypothetical protein; Provisional 97.39
KOG3559|consensus 598 97.35
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 97.29
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 97.14
KOG3560|consensus 712 96.92
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 96.62
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 96.57
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 96.09
PRK09776 1092 putative diguanylate cyclase; Provisional 95.87
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 95.77
PRK09776 1092 putative diguanylate cyclase; Provisional 95.65
PRK13557 540 histidine kinase; Provisional 95.57
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 95.33
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 94.8
PRK10060 663 RNase II stability modulator; Provisional 94.4
PRK11091 779 aerobic respiration control sensor protein ArcB; P 94.17
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 93.63
PRK13560 807 hypothetical protein; Provisional 93.39
PRK13559 361 hypothetical protein; Provisional 92.49
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 92.0
PF08446110 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold 90.44
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 89.74
PRK13558 665 bacterio-opsin activator; Provisional 89.47
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 88.28
PRK11006 430 phoR phosphate regulon sensor protein; Provisional 88.22
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 88.2
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 84.51
KOG3753|consensus 1114 82.85
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 82.78
>KOG3558|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.9e-41  Score=307.27  Aligned_cols=169  Identities=39%  Similarity=0.751  Sum_probs=150.0

Q ss_pred             CCccccCCccccCCChhhHHHHHHHhcCCCCC-------CCCCceeEEEEEeeecCCCCccccCCCCceEEEEEEEeeec
Q psy10704          1 MKVDLMGQSIYEVTHPCDHSEVKSILSANHTE-------DIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHCTGHLVQ   73 (211)
Q Consensus         1 ~Q~dL~G~Siyd~iHp~D~~~~~~~L~~~~~~-------~~~~~rsF~cRmk~~~~~r~~~~~~~~~~y~~v~~~G~l~~   73 (211)
                      +|+||+|.||||||||+||+||++||......       +...+|+||+|||+++++|||.+|+|+.+||++||||++|.
T Consensus       155 SQvELTG~SvFDfiHP~DheE~~eqL~l~~~~p~~~es~~~~teRsFflRMKsTLT~RGRtlnlKSa~yKvlh~tgh~rv  234 (768)
T KOG3558|consen  155 SQVELTGSSVFDFIHPCDHEEIAEQLGLRLTTPEVKESTDTSTERSFFLRMKSTLTKRGRTLNLKSAGYKVLHCTGHLRV  234 (768)
T ss_pred             cceeeecchhhhccCccCHHHHHHHhccccCCCcccccccCccceeEEEEeeeeeccCCceeeeeccceeEEEEeeeeee
Confidence            69999999999999999999999999876641       34568999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCcCCCCccccccccccccCccccCCCCCCcccccccccccccCCCceEEEEeeeCCCCCCCCCCCC-ceeE
Q psy10704         74 NQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHPANYDVPLS-QTFL  152 (211)
Q Consensus        74 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~Lv~i~r~~~~~~~~e~~~~-~~f~  152 (211)
                      ..+.+. +..                               -+|.+     .+..|||++|.++++|+..|+++. ..|+
T Consensus       235 ~~~~sh-~s~-------------------------------~~g~~-----~Pl~~lV~~a~alp~ps~~EipL~~~~Fv  277 (768)
T KOG3558|consen  235 YNNPSH-NSP-------------------------------LCGYK-----EPLLGLVALAEALPPPSYTEIPLDCHMFV  277 (768)
T ss_pred             ccCCCC-CCc-------------------------------ccCcc-----ccchheeeeeccCCCCcccccccCCceeE
Confidence            876421 100                               13432     137899999999999999999998 8999


Q ss_pred             EEEeCCeeEEEechhhhhhcCCChhhhcCCCccceecccCHHHHHHHHHhhhhh
Q psy10704        153 TKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPCYS  206 (211)
Q Consensus       153 trh~~dg~i~~vd~~~~~~lGy~~~el~G~s~y~~vH~~D~~~~~~~h~~l~~r  206 (211)
                      +||++|++|+|||+|+..++||.|+||+|+|+|+|||++|.+.+.+.|..||.|
T Consensus       278 tRhs~DmkityCedRisdlm~y~PeeLvGrS~Ye~~Ha~Ds~~v~KSh~dL~~K  331 (768)
T KOG3558|consen  278 TRHSLDMKITYCEDRISDLMDYEPEELVGRSCYEFVHALDSDRVRKSHHDLLTK  331 (768)
T ss_pred             EeeecceeEEEEchhHHHHhcCCHHHhhchhHHHhhhHhhhhHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999987544

>KOG3559|consensus Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>KOG3753|consensus Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>KOG3753|consensus Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1p97_A114 Nmr Structure Of The C-Terminal Pas Domain Of Hif2a 1e-10
3f1n_A117 Crystal Structure Of A High Affinity Heterodimer Of 3e-10
2a24_A107 Haddock Structure Of Hif-2aARNT PAS-B Heterodimer L 4e-10
4h6j_A113 Identification Of Cys 255 In Hif-1 As A Novel Site 4e-10
4f3l_B387 Crystal Structure Of The Heterodimeric Clock:bmal1 4e-09
>pdb|1P97|A Chain A, Nmr Structure Of The C-Terminal Pas Domain Of Hif2a Length = 114 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 43/57 (75%)
Query: 148 SQTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNPC 204
           S+TFL++HS+DMKFTY D+ + + +G++P+  + +S ++F+HA DS ++  + +N C
Sbjct: 5   SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLC 61
>pdb|3F1N|A Chain A, Crystal Structure Of A High Affinity Heterodimer Of Hif2 Alpha And Arnt C-Terminal Pas Domains, With Internally Bound Ethylene Glycol. Length = 117 Back     alignment and structure
>pdb|2A24|A Chain A, Haddock Structure Of Hif-2aARNT PAS-B Heterodimer Length = 107 Back     alignment and structure
>pdb|4H6J|A Chain A, Identification Of Cys 255 In Hif-1 As A Novel Site For Development Of Covalent Inhibitors Of Hif-1 ARNT PASB DOMAIN PROTEIN-Protein Interaction Length = 113 Back     alignment and structure
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
4f3l_A361 Mclock, circadian locomoter output cycles protein 1e-29
3rty_A 339 Period circadian protein; PAS domain, signalling, 9e-27
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 9e-25
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 9e-23
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 3e-22
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 7e-22
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 7e-14
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 2e-13
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 7e-12
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 5e-06
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 6e-05
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
 Score =  111 bits (279), Expect = 1e-29
 Identities = 36/206 (17%), Positives = 71/206 (34%), Gaps = 29/206 (14%)

Query: 2   KVDLMGQSIYEVTHPCDHSEVKSILS----ANHTEDIRAQRSVFIRLKCTLTSKGRNVNV 57
             DL+ QSI+      +HSEV  ILS     + +      +S      C    +G     
Sbjct: 123 PSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPK 182

Query: 58  KAATYKVIHCTGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVG 117
           + +TY+ +   G+     + +++     E      ++     R                 
Sbjct: 183 EPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRV---------------- 226

Query: 118 EKRRVVTEPSHCFVAIGEPIPHPANYDVPL-SQTFLTKHSLDMKFTYADETMEDFLGFNP 176
                        V +  P        V   ++ F ++HSL+ KF + D      +G+ P
Sbjct: 227 --------CFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLP 278

Query: 177 DIFIAKSVFDFHHAQDSFHIQNAFKN 202
              +  S +D++H  D  ++    ++
Sbjct: 279 FEVLGTSGYDYYHVDDLENLAKCHEH 304
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Length = 339 Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Length = 309 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Length = 320 Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Length = 317 Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A Length = 117 Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 2b02_A* 2k7s_A 2a24_B Length = 121 Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Length = 111 Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Length = 132 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 100.0
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 100.0
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 99.98
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.97
4f3l_A361 Mclock, circadian locomoter output cycles protein 99.94
3rty_A 339 Period circadian protein; PAS domain, signalling, 99.94
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 99.45
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.96
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.95
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.94
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 98.83
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.65
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 98.62
4dj3_A 317 Period circadian protein homolog 3; PAS domain, ci 98.58
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 98.55
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.53
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.51
3rty_A 339 Period circadian protein; PAS domain, signalling, 98.44
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.14
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 97.72
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 97.71
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 97.7
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 97.69
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 97.67
3mjq_A126 Uncharacterized protein; NESG, structural genomics 97.49
2r78_A117 Sensor protein; sensory box sensor histidine kinas 97.48
3icy_A118 Sensor protein; sensory box histidine kinase/respo 97.47
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 97.45
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 97.44
3nja_A125 Probable ggdef family protein; structural genomics 97.43
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 97.39
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 97.38
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 97.34
3eeh_A125 Putative light and redox sensing histidine kinase; 97.33
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 97.31
3mr0_A142 Sensory box histidine kinase/response regulator; P 97.3
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 97.28
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 97.26
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 97.25
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 97.19
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 97.17
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.15
3p7n_A 258 Sensor histidine kinase; LOV domain, light-activat 97.11
3olo_A118 Two-component sensor histidine kinase; structural 97.1
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 97.1
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 97.09
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 97.02
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 97.0
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 96.94
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 96.9
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 96.88
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 96.83
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 96.74
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 96.56
1byw_A110 Protein (human ERG potassium channel); PAS domain, 96.55
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 96.47
3b33_A115 Sensor protein; structural genomics, PAS domain, n 96.4
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 96.34
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 96.2
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 96.05
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 96.05
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 95.96
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 95.64
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 95.55
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 95.38
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 95.21
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 95.1
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 95.06
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 94.9
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 94.65
3vol_A 233 Aerotaxis transducer AER2; heme, oxygen sensor pro 94.46
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 94.29
2qkp_A151 Uncharacterized protein; structural genomics, unkn 94.2
2ool_A 337 Sensor protein; bacteriophytochrome, photoconversi 92.89
3icy_A118 Sensor protein; sensory box histidine kinase/respo 91.31
3mr0_A142 Sensory box histidine kinase/response regulator; P 89.72
3nja_A125 Probable ggdef family protein; structural genomics 88.9
3cax_A369 Uncharacterized protein PF0695; structural genomic 88.18
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.2e-32  Score=238.89  Aligned_cols=153  Identities=20%  Similarity=0.298  Sum_probs=117.9

Q ss_pred             CCccccCCccccCCChhhHHHHHHHhcCCCC-------------CCCCCceeEEEEEeeecCCCCccccCCCCceEEEEE
Q psy10704          1 MKVDLMGQSIYEVTHPCDHSEVKSILSANHT-------------EDIRAQRSVFIRLKCTLTSKGRNVNVKAATYKVIHC   67 (211)
Q Consensus         1 ~Q~dL~G~Siyd~iHp~D~~~~~~~L~~~~~-------------~~~~~~rsF~cRmk~~~~~r~~~~~~~~~~y~~v~~   67 (211)
                      +|.||+|+||||||||+||++|++||++...             .+.+.+|+|+|||||.+.+.      +..+|++++|
T Consensus        63 ~~~~l~g~s~~d~iHp~D~~~f~~qL~~~~lp~~~~~~~~~~~~~~~~~~rsF~CRmr~~l~k~------~~~~Y~~~~~  136 (320)
T 4dj2_A           63 KRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCRIRGGPDRD------PGPRYQPFRL  136 (320)
T ss_dssp             CSTTTTTSBGGGGBCHHHHHHHHHHCCTTTCCBTTC-------------CCCEEEEECCC-------------CCEEEEE
T ss_pred             CHHHHcCCcHHHhcCHHHHHHHHHhhcccCCCCcccCcccccccccCCCceeEEEEEEEeccCC------CcccEEEEEE
Confidence            5899999999999999999999999987421             12246899999999986432      3578999999


Q ss_pred             EEeeecCCCCCCCCCCcCCCCccccccccccccCccccCCCCCCcccccccccccccCCCceEEEEeeeCCCC-CCCCCC
Q psy10704         68 TGHLVQNQTPASNGSTLMEPQDNIENQSDNTRRGSAIQDKDDSEPEEEVGEKRRVVTEPSHCFVAIGEPIPHP-ANYDVP  146 (211)
Q Consensus        68 ~G~l~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~Lv~i~r~~~~~-~~~e~~  146 (211)
                      +|+++.+...                                      .|.      .+..++++++.++.++ +..+++
T Consensus       137 ~g~lk~~~~~--------------------------------------~g~------~~~~~~li~a~~~~s~~~~~~i~  172 (320)
T 4dj2_A          137 TPYVTKIRVS--------------------------------------DGA------PAQPCCLLIAERIHSGYEAPRIP  172 (320)
T ss_dssp             EEEEEEECC-----------------------------------------C------CCEEEEEEEEEECCCSSSSSCCC
T ss_pred             EEEecccccC--------------------------------------CCC------cccceeeeeeeeccCcccccccc
Confidence            9999876431                                      010      0223555567777654 455565


Q ss_pred             CC-ceeEEEEeCCeeEEEechhhhhhcCCChhhhcCCCccceecccCHHHHHHHHHhh
Q psy10704        147 LS-QTFLTKHSLDMKFTYADETMEDFLGFNPDIFIAKSVFDFHHAQDSFHIQNAFKNP  203 (211)
Q Consensus       147 ~~-~~f~trh~~dg~i~~vd~~~~~~lGy~~~el~G~s~y~~vH~~D~~~~~~~h~~l  203 (211)
                      .+ ..|++||++||+|+|||+++..+|||.|+||+|+++|+|+||+|++.+.+.|+.+
T Consensus       173 ~~~~~Fitrh~~dG~~~yvd~~~~~lLGY~peELig~s~~~~vHPdD~~~~~~~~~~~  230 (320)
T 4dj2_A          173 PDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKI  230 (320)
T ss_dssp             GGGCEEEEEECTTCBEEEECTTHHHHHSCCHHHHTTSBGGGGBCGGGHHHHHHHHHHH
T ss_pred             CCCceEEEEecCCceEEEcCcceeccCCcChHHHcCCcHHHhCCHHHHHHHHHHHHHH
Confidence            55 8999999999999999999999999999999999999999999999999998754
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1oj5a_109 d.110.3.8 (A:) PAS domain of steroid receptor coac 1e-06
d2oola2114 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodops 6e-05
d1p97a_114 d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t 4e-04
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 43.9 bits (103), Expect = 1e-06
 Identities = 9/57 (15%), Positives = 17/57 (29%), Gaps = 1/57 (1%)

Query: 149 QTFLTKHSLDMKFTYADETMEDFLGFNP-DIFIAKSVFDFHHAQDSFHIQNAFKNPC 204
           ++F+TK     K    D +     G    +  + K ++ F   Q             
Sbjct: 2   ESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQE 58
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 114 Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 99.5
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.16
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 98.1
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 98.09
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.0
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 98.0
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 97.86
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.71
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 97.7
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 97.64
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 97.6
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 97.55
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 97.42
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 96.1
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 95.76
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 93.15
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 92.13
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.50  E-value=1.4e-15  Score=110.72  Aligned_cols=63  Identities=17%  Similarity=0.310  Sum_probs=53.2

Q ss_pred             ceeEEEEeCCeeEEEechhhhhhcCCCh-hhhcCCCccceecccCHH--HHHHHHHhh---------hhhcccCC
Q psy10704        149 QTFLTKHSLDMKFTYADETMEDFLGFNP-DIFIAKSVFDFHHAQDSF--HIQNAFKNP---------CYSCVIKS  211 (211)
Q Consensus       149 ~~f~trh~~dg~i~~vd~~~~~~lGy~~-~el~G~s~y~~vH~~D~~--~~~~~h~~l---------~~rf~~k~  211 (211)
                      ..|++||++||+|++||+++..++||.| +||+|+++|+|+||||++  ..+..|+.+         .|||+.|.
T Consensus         2 e~F~trh~~~g~~~~vd~~~~~~~gy~~~eelig~s~~~f~HPeD~~~~~~~~~~~~~~~~g~~~~~~yR~~~kd   76 (109)
T d1oj5a_           2 ESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILND   76 (109)
T ss_dssp             CEEEEEECTTCCEEEEECHHHHTTCCSCHHHHHHHHHHHHTSCBTTBCCHHHHHHHHHHHHSEEECCCEEEECTT
T ss_pred             ceEEEEECCCceEEEECHHHhhHhhcCCHHHHcCCcHHHeECcccchHHHhhHHHHHHHhhcccchhhhhhhhcc
Confidence            4799999999999999999999999996 999999999999999975  344445532         58888773
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure