Psyllid ID: psy10739


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
SLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
ccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccc
HHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHcccccEEEEEc
sllsssrvNIVKEAAWTIsnitagnsrqiDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELrkahkddqlfkrrnidqldeieeenvtvieptcmspikmtvPEMIegmkssnpkMRMIATRSARKMlskerhppidelieagvvpicvfqr
sllsssrvNIVKEAAwtisnitagnsrQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKmsqkvaaidrkasfknagksfdeMRRKRCEMNVelrkahkddqlfkrrnidqldeieeenvtvieptcmspikMTVPEMIEgmkssnpkMRMIATRSARKmlskerhppidelieagvVPICVFQR
SLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
*******VNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKV********************************************************************NVTVIEPTCM******************************************ELIEAGVVPICVF**
SL*****VNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMR********************************************SPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
********NIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
*LLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNID*****************MSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLLPYIVNILENGDAKVQKEAAINTKMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
P52170 522 Importin subunit alpha-1 N/A N/A 0.588 0.210 0.427 3e-20
P52292 529 Importin subunit alpha-2 yes N/A 0.540 0.190 0.437 1e-19
P52171 523 Importin subunit alpha-2 N/A N/A 0.588 0.210 0.435 1e-19
P52295 522 Importin subunit alpha OS yes N/A 0.577 0.206 0.405 4e-19
P52293 529 Importin subunit alpha-2 yes N/A 0.540 0.190 0.419 1e-18
O35344 521 Importin subunit alpha-3 no N/A 0.588 0.211 0.394 4e-18
O00505 521 Importin subunit alpha-3 no N/A 0.588 0.211 0.394 5e-18
O35343 521 Importin subunit alpha-4 no N/A 0.572 0.205 0.384 2e-16
O00629 521 Importin subunit alpha-4 no N/A 0.572 0.205 0.376 8e-16
A9QM74 516 Importin subunit alpha-8 no N/A 0.566 0.205 0.394 9e-16
>sp|P52170|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis GN=kpna1 PE=1 SV=2 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 81/117 (69%), Gaps = 7/117 (5%)

Query: 68  AIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEP 127
           A +R   FKN GK   E+RR+R E++VELRKA KD+Q+ KRRN+     + EE +   E 
Sbjct: 7   ADERMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNVC----LPEELILSPEK 62

Query: 128 TCMSPIK---MTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVP 181
             M  ++   +++ E+++GM S +P+  +  T++ARKMLS+ER+PP++++IEAG++P
Sbjct: 63  NAMQSVQVPPLSLEEIVQGMNSGDPENELRCTQAARKMLSRERNPPLNDIIEAGLIP 119




Essential for selective protein import into nucleus. Promotes signal-dependent binding of karyophilic proteins to the nuclear envelope.
Xenopus laevis (taxid: 8355)
>sp|P52292|IMA2_HUMAN Importin subunit alpha-2 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 Back     alignment and function description
>sp|P52171|IMA2_XENLA Importin subunit alpha-2 OS=Xenopus laevis GN=kpna2 PE=1 SV=2 Back     alignment and function description
>sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster GN=Pen PE=1 SV=2 Back     alignment and function description
>sp|P52293|IMA2_MOUSE Importin subunit alpha-2 OS=Mus musculus GN=Kpna2 PE=1 SV=2 Back     alignment and function description
>sp|O35344|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus GN=Kpna3 PE=1 SV=1 Back     alignment and function description
>sp|O00505|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 Back     alignment and function description
>sp|O35343|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna4 PE=2 SV=1 Back     alignment and function description
>sp|O00629|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA4 PE=1 SV=1 Back     alignment and function description
>sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
348511215 523 PREDICTED: importin subunit alpha-2 [Ore 0.593 0.212 0.468 2e-22
5802657 523 pendulin [Oreochromis niloticus] 0.593 0.212 0.468 2e-22
223647006 526 Importin subunit alpha-2 [Salmo salar] g 0.582 0.207 0.477 6e-22
410901792 521 PREDICTED: importin subunit alpha-2-like 0.625 0.224 0.433 1e-21
405950951 617 Importin subunit alpha-1 [Crassostrea gi 0.545 0.165 0.483 1e-21
427785233 516 Putative karyopherin importin alpha [Rhi 0.566 0.205 0.462 2e-21
432871172 522 PREDICTED: importin subunit alpha-2-like 0.593 0.212 0.450 3e-21
345488160 520 PREDICTED: importin subunit alpha-2-like 0.609 0.219 0.470 7e-21
91077394 516 PREDICTED: similar to importin alpha 1a 0.593 0.215 0.491 1e-20
380029460 520 PREDICTED: importin subunit alpha-2-like 0.582 0.209 0.464 2e-20
>gi|348511215|ref|XP_003443140.1| PREDICTED: importin subunit alpha-2 [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 76/111 (68%)

Query: 71  RKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCM 130
           R   FKN GK  +E+RR+R E+NVELRKA KDDQ+FKRRN+  + E     +      C 
Sbjct: 7   RLNQFKNKGKDVNELRRRRVEVNVELRKAKKDDQIFKRRNVTAMPEDATSPLQERSQNCQ 66

Query: 131 SPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVP 181
              + TV E++ G+ S N + ++ AT++ARK+LS+++HPPID+LI AG++P
Sbjct: 67  GLRQWTVEEIVAGVNSGNSESQLQATQAARKLLSRDKHPPIDQLISAGLIP 117




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|5802657|gb|AAD51751.1| pendulin [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|223647006|gb|ACN10261.1| Importin subunit alpha-2 [Salmo salar] gi|223672871|gb|ACN12617.1| Importin subunit alpha-2 [Salmo salar] Back     alignment and taxonomy information
>gi|410901792|ref|XP_003964379.1| PREDICTED: importin subunit alpha-2-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|405950951|gb|EKC18904.1| Importin subunit alpha-1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|427785233|gb|JAA58068.1| Putative karyopherin importin alpha [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|432871172|ref|XP_004071868.1| PREDICTED: importin subunit alpha-2-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|345488160|ref|XP_001605009.2| PREDICTED: importin subunit alpha-2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91077394|ref|XP_975293.1| PREDICTED: similar to importin alpha 1a [Tribolium castaneum] gi|270001645|gb|EEZ98092.1| hypothetical protein TcasGA2_TC000505 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380029460|ref|XP_003698390.1| PREDICTED: importin subunit alpha-2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
ZFIN|ZDB-GENE-040718-22 546 kpna2 "karyopherin alpha 2 (RA 0.641 0.219 0.438 2.4e-23
UNIPROTKB|J3KS65143 KPNA2 "Importin subunit alpha- 0.566 0.741 0.439 2.1e-20
UNIPROTKB|J3QLL0134 KPNA2 "Importin subunit alpha- 0.566 0.791 0.439 2.1e-20
UNIPROTKB|F1M4P1 522 F1M4P1 "Importin subunit alpha 0.636 0.227 0.418 3.6e-20
UNIPROTKB|F1NJS6 528 KPNA2 "Importin subunit alpha" 0.647 0.229 0.419 4.7e-20
UNIPROTKB|P52292 529 KPNA2 "Importin subunit alpha- 0.566 0.200 0.439 1.3e-19
RGD|621419 529 Kpna2 "karyopherin alpha 2" [R 0.636 0.224 0.398 1.7e-19
UNIPROTKB|Q6P6T9 529 Kpna2 "Importin subunit alpha" 0.636 0.224 0.398 1.7e-19
UNIPROTKB|E2R6L9 529 KPNA2 "Importin subunit alpha" 0.636 0.224 0.398 1.7e-19
UNIPROTKB|J9P954 529 J9P954 "Importin subunit alpha 0.636 0.224 0.398 2.1e-19
ZFIN|ZDB-GENE-040718-22 kpna2 "karyopherin alpha 2 (RAG cohort 1, importin alpha 1)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 2.4e-23, Sum P(2) = 2.4e-23
 Identities = 53/121 (43%), Positives = 76/121 (62%)

Query:    61 KMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEE 120
             KMS       R   FKN GK   E+RR+R E+NVELRKA KD+Q+ KRRN+    +    
Sbjct:    21 KMSAANENTARLTQFKNKGKDATELRRRRIEVNVELRKAKKDEQILKRRNVSSFPDEATS 80

Query:   121 NVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVV 180
              +      C +    TV E++ G+ S+N + ++ AT++ARK+LS+ERHPPID +I AG++
Sbjct:    81 PLQEKSQNCQAQ-HWTVEEIVNGVNSNNLETQVQATQAARKLLSRERHPPIDRIISAGLI 139

Query:   181 P 181
             P
Sbjct:   140 P 140


GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008565 "protein transporter activity" evidence=IEA
GO:0006606 "protein import into nucleus" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
UNIPROTKB|J3KS65 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QLL0 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4P1 F1M4P1 "Importin subunit alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJS6 KPNA2 "Importin subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P52292 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621419 Kpna2 "karyopherin alpha 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P6T9 Kpna2 "Importin subunit alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6L9 KPNA2 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P954 J9P954 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-17
pfam0174997 pfam01749, IBB, Importin beta binding domain 7e-16
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-13
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-11
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 3e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.001
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
 Score = 79.5 bits (196), Expect = 1e-17
 Identities = 42/121 (34%), Positives = 68/121 (56%), Gaps = 5/121 (4%)

Query: 62  MSQKVAAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEE 120
            + +     R+ +FK  G+ S DE+RR+R E  VELRK  +++ L KRRN+  + E  E 
Sbjct: 1   STSRFVPEARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAES 60

Query: 121 NVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVV 180
           +   +E          +P++ + + S + + ++ A    RK+LSKE  PPI  +I+AGVV
Sbjct: 61  SFIPME----QQFYSELPQLTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVV 116

Query: 181 P 181
           P
Sbjct: 117 P 117


Length = 526

>gnl|CDD|201951 pfam01749, IBB, Importin beta binding domain Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
KOG0166|consensus 514 99.91
KOG0166|consensus 514 99.9
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.89
PF0174997 IBB: Importin beta binding domain; InterPro: IPR00 99.87
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.41
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.39
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.83
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.83
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.63
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.32
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 98.04
KOG4224|consensus 550 98.02
KOG4224|consensus 550 98.01
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.0
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.85
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.42
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.66
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.22
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.97
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.58
PRK09687280 putative lyase; Provisional 95.27
PF05804 708 KAP: Kinesin-associated protein (KAP) 95.07
KOG1048|consensus 717 94.9
PF05804 708 KAP: Kinesin-associated protein (KAP) 94.82
KOG1048|consensus 717 94.73
KOG2160|consensus342 94.6
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.87
PRK09687280 putative lyase; Provisional 92.91
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 92.76
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 91.91
KOG4199|consensus461 90.06
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 88.13
PF1153840 Snurportin1: Snurportin1; InterPro: IPR024721 Snur 87.46
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 84.36
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 84.17
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 83.56
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 83.39
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 82.81
KOG2171|consensus 1075 81.61
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
Probab=99.96  E-value=6.8e-30  Score=220.20  Aligned_cols=121  Identities=34%  Similarity=0.504  Sum_probs=100.9

Q ss_pred             cchhhhhHhhhhhhccCCC-hHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhcccCCCCCCCccCCHHHHH
Q psy10739         63 SQKVAAIDRKASFKNAGKS-FDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMI  141 (187)
Q Consensus        63 ~t~~~~~~R~~~fKn~g~d-~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~~~~~~~~~~~~l~~iv  141 (187)
                      .+..-|++|+.+||+||.. ++++||+|++.+|||||+||||.|.||||......+..+..-    +-.......+|+|.
T Consensus         2 ~srf~p~~Rr~~fk~Kg~f~adelRr~ReeQQvElRkqKreE~LnKrRNl~dv~e~a~ss~i----~meqq~~~elp~lt   77 (526)
T COG5064           2 TSRFVPEARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAESSFI----PMEQQFYSELPQLT   77 (526)
T ss_pred             CcccchHHHHhcccCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccchhhhccC----chhHHhhhhhHHHH
Confidence            3466788999999999864 899999999999999999999999999998433332222211    00112234689999


Q ss_pred             HHhcCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739        142 EGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR  187 (187)
Q Consensus       142 ~~l~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~  187 (187)
                      +.++|+|.+.|+.|+..|||+||+|.+||||.||++|+|||||+||
T Consensus        78 ~~l~SdDie~q~qav~kFR~~LS~E~~PPIq~VIdaGvVpRfvefm  123 (526)
T COG5064          78 QQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFM  123 (526)
T ss_pred             HHHhhhHHHHHHHHHHHHHHHhccccCCCchhHHhccccHHHHHHH
Confidence            9999999999999999999999999999999999999999999996



>KOG0166|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF01749 IBB: Importin beta binding domain; InterPro: IPR002652 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF11538 Snurportin1: Snurportin1; InterPro: IPR024721 Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor [] Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
3tpo_A 529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 9e-20
1wa5_B 530 Crystal Structure Of The Exportin Cse1p Complexed W 2e-16
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 3e-12
3rz9_A 510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 2e-07
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 3e-12
4ba3_A 496 Mimp_alphadibb_a89nls Length = 496 2e-07
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 3e-12
3ukw_B 510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 7e-08
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 4e-12
4htv_A 509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 7e-08
1ial_A453 Importin Alpha, Mouse Length = 453 4e-12
1ial_A 453 Importin Alpha, Mouse Length = 453 1e-08
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 4e-12
2ynr_A 461 Mimp_alphadibb_b54nls Length = 461 1e-08
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 4e-12
1q1s_C 466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 2e-07
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 4e-12
1ejl_I 460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 2e-07
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 4e-12
3btr_C 427 Ar-Nls:importin-Alpha Complex Length = 427 2e-07
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 4e-12
1y2a_C 428 Structure Of Mammalian Importin Bound To The Non-Cl 2e-07
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 4e-12
3ve6_A 426 Crystal Structure Analysis Of Venezuelan Equine Enc 2e-07
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 4e-12
3tpm_A 422 Crystal Structure Of Mal Rpel Domain In Complex Wit 3e-07
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 4e-12
3l3q_A 427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 2e-07
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 5e-12
2c1m_A 424 Nup50:importin-Alpha Complex Length = 424 3e-07
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 1e-11
3fex_C 467 Crystal Structure Of The Cbc-Importin Alpha Complex 7e-08
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 2e-10
1bk5_A 422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 6e-05
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 2e-10
1bk6_A 422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 6e-05
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 3e-10
2c1t_A 454 Structure Of The Kap60p:nup2 Complex Length = 454 5e-05
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 3e-10
1ee4_A 423 Crystal Structure Of Yeast Karyopherin (Importin) A 6e-05
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 3e-10
1un0_A 443 Crystal Structure Of Yeast Karyopherin (Importin) A 6e-05
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 3e-10
1ee5_A 424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 5e-05
4b8j_A 528 Rimp_alpha1a Length = 528 3e-09
1qgk_B44 Structure Of Importin Beta Bound To The Ibb Domain 2e-08
2yns_A490 Rimp_alpha_b54nls Length = 490 4e-08
2yns_A 490 Rimp_alpha_b54nls Length = 490 4e-08
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 9e-08
3tj3_A 447 Structure Of Importin A5 Bound To The N-Terminus Of 1e-05
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 9e-08
2jdq_A 450 C-Terminal Domain Of Influenza A Virus Polymerase P 1e-05
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 4e-06
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 4e-06
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 4e-06
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 5e-06
1qgr_B27 Structure Of Importin Beta Bound To The Ibb Domain 2e-04
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 9e-04
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure

Iteration: 1

Score = 92.8 bits (229), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 47/112 (41%), Positives = 73/112 (65%), Gaps = 11/112 (9%) Query: 75 FKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNI-----DQLDEIEEENVTVIEPTC 129 FKN GK EMRR+R E+NVELRKA KD+Q+ KRRN+ D ++E Sbjct: 17 FKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENR------NN 70 Query: 130 MSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVP 181 + +V ++++G+ S+N + ++ AT++ARK+LS+E+ PPID +I AG++P Sbjct: 71 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIP 122
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|1QGK|B Chain B, Structure Of Importin Beta Bound To The Ibb Domain Of Importin Alpha Length = 44 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|1QGR|B Chain B, Structure Of Importin Beta Bound To The Ibb Domain Of Importin Alpha (Ii Crystal Form, Grown At Low Ph) Length = 27 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-27
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-08
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 6e-08
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 9e-08
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 3e-07
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-06
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 3e-20
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-13
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-10
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-07
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-07
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-06
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-04
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-18
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-16
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-11
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 9e-17
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-13
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-12
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-10
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 1e-05
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-16
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-11
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-09
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-08
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-08
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-08
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-07
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-06
1qgk_B44 Protein (importin alpha-2 subunit); transport rece 4e-13
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-11
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-06
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-06
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-04
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-10
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-05
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-05
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-09
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-09
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-08
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-07
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-07
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-07
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-06
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-06
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-06
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-09
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-08
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-07
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-06
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-04
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-04
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 7e-09
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 8e-09
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-08
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-08
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-08
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-07
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-07
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 9e-07
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 9e-06
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-04
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-07
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-04
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-07
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-06
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 6e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-05
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-05
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 6e-04
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 5e-05
1qgr_B27 Protein (importin alpha-2 subunit); transport rece 3e-04
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
 Score =  107 bits (267), Expect = 1e-27
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 6/132 (4%)

Query: 59  NTKMSQKVAAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLD-- 115
               + K     R+ +FKN G+ S DE+RR+R    VELRKA +D+ L KRRN       
Sbjct: 5   TDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDG 64

Query: 116 ---EIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPID 172
              + E+E+    +    S ++  +P+M + + S + + ++ AT   R++LS+E  PPID
Sbjct: 65  ADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPID 124

Query: 173 ELIEAGVVPICV 184
            +I+AGVVP  V
Sbjct: 125 VVIQAGVVPRLV 136


>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1qgk_B Protein (importin alpha-2 subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.50A {Homo sapiens} Length = 44 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1qgr_B Protein (importin alpha-2 subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} Length = 27 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.96
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.81
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.8
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.67
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.63
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.63
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.6
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.54
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.49
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.39
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.38
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.37
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.37
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.37
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.34
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.3
4hxt_A 252 De novo protein OR329; structural genomics, PSI-bi 99.29
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.29
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.28
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.28
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.27
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.27
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.26
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.26
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.25
3nmz_A458 APC variant protein; protein-protein complex, arma 99.22
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.21
3nmz_A458 APC variant protein; protein-protein complex, arma 99.16
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.14
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.12
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.1
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.87
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.77
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.74
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.7
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.61
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.94
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.85
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.44
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.14
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.98
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 96.75
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.75
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.73
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.69
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.63
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 96.62
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.5
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.49
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 96.19
1qgr_A 876 Protein (importin beta subunit); transport recepto 95.7
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 95.61
2p8q_B40 Snurportin-1; heat repeat, IBB-domain, importin, k 94.9
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 94.37
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 94.21
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.86
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 92.58
1qgr_A 876 Protein (importin beta subunit); transport recepto 92.22
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 91.98
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 91.36
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 88.71
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 88.14
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 87.63
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 87.46
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 86.23
3grl_A 651 General vesicular transport factor P115; vesicle t 84.1
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 81.46
3grl_A 651 General vesicular transport factor P115; vesicle t 80.79
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 80.18
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=99.96  E-value=1.3e-30  Score=235.03  Aligned_cols=122  Identities=39%  Similarity=0.615  Sum_probs=64.3

Q ss_pred             hhhhhHhhhhhhccCCChHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhcccCCCCCCCccCCHHHHHHHh
Q psy10739         65 KVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGM  144 (187)
Q Consensus        65 ~~~~~~R~~~fKn~g~d~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~~~~~~~~~~~~l~~iv~~l  144 (187)
                      .+.|++|++.|||+|+|.+|+||||+|..|||||+||||+|+||||+....++..++.. +...........+++|++++
T Consensus         7 ~~~~~~r~~~~k~~~~~~~e~r~~R~~~~v~lRk~kr~e~l~krR~~~~~~~~~~~~~~-~~~~~~~~~~~~l~~lv~~l   85 (529)
T 3tpo_A            7 ANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQ-ENRNNQGTVNWSVEDIVKGI   85 (529)
T ss_dssp             -------------------------------------CCSCSCCCCCC----------------CGGGSSCCHHHHHHHH
T ss_pred             CCCcHHHHHHhccCCCChHHHHHHHhHHHHHHHHHHHHHHHHhccCCCCCcccccChhh-hccchhhhHHHHHHHHHHHh
Confidence            45789999999999999999999999999999999999999999998654444333332 22222334457899999999


Q ss_pred             cCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739        145 KSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR  187 (187)
Q Consensus       145 ~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~  187 (187)
                      +|+|++.|+.|++++||+||.++||||+.||++|+||+||+||
T Consensus        86 ~s~d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G~ip~Lv~lL  128 (529)
T 3tpo_A           86 NSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL  128 (529)
T ss_dssp             TSSCHHHHHHHHHHHHHHHTSSSCCCHHHHHHTTHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHcCCCCchHHHHHHCCCHHHHHHHH
Confidence            9999999999999999999999999999999999999999875



>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2p8q_B Snurportin-1; heat repeat, IBB-domain, importin, karyopherin, transport; 2.35A {Homo sapiens} PDB: 2q5d_C 3lww_B Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 5e-26
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 0.001
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 0.002
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-11
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 8e-04
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.002
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-07
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-04
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  101 bits (251), Expect = 5e-26
 Identities = 46/123 (37%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 71  RKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDE-----IEEENVTV 124
           R+ +FKN G+ S DE+RR+R    VELRKA +D+ L KRRN     +      E+E+   
Sbjct: 6   RRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVS 65

Query: 125 IEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICV 184
            +    S ++  +P+M + + S + + ++ AT   R++LS+E  PPID +I+AGVVP  V
Sbjct: 66  ADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLV 125

Query: 185 FQR 187
              
Sbjct: 126 EFM 128


>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.86
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.35
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.19
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.14
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.03
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.34
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.07
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.01
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 94.41
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 93.6
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 92.14
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 91.91
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 87.12
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 86.12
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 82.33
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 81.95
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.86  E-value=1.4e-23  Score=182.72  Aligned_cols=121  Identities=36%  Similarity=0.521  Sum_probs=84.5

Q ss_pred             hhhHhhhhhhccCC-ChHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhccc-----CCCCCCCccCCHHHH
Q psy10739         67 AAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVI-----EPTCMSPIKMTVPEM  140 (187)
Q Consensus        67 ~~~~R~~~fKn~g~-d~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~-----~~~~~~~~~~~l~~i  140 (187)
                      .|++|++.||++|+ |++|+||||++..|||||+|||+.|.|||++....+...++...+     ...........++++
T Consensus         2 ~~~~~~~~~~~~~~~~~~e~r~kR~~~~veiRk~kr~e~l~kkR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~   81 (503)
T d1wa5b_           2 VPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQM   81 (503)
T ss_dssp             CCGGGCC-----------CCCCCTTSSCCCCSCCCCCSCCSCCCCC----------------------------CCHHHH
T ss_pred             CchHHhHHhccCCCCChHHHHHHHHHHHHHHhHHHHHHHHHhhcCCCcccccccccchhccccchhhHHHHHHHHHHHHH
Confidence            47899999999997 999999999999999999999999999998643211111111100     001112234789999


Q ss_pred             HHHhcCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739        141 IEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR  187 (187)
Q Consensus       141 v~~l~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~  187 (187)
                      +++++|+|++.++.|+..+|++||.+.+|||+.+|++|++|.||.+|
T Consensus        82 ~~~~~s~~~~~~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l  128 (503)
T d1wa5b_          82 TQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFM  128 (503)
T ss_dssp             HHHHSCSSHHHHHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTT
T ss_pred             HHHhcCCCHHHHHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHH
Confidence            99999999999999999999999999999999999999999999875



>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure