Psyllid ID: psy10739
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 187 | ||||||
| 348511215 | 523 | PREDICTED: importin subunit alpha-2 [Ore | 0.593 | 0.212 | 0.468 | 2e-22 | |
| 5802657 | 523 | pendulin [Oreochromis niloticus] | 0.593 | 0.212 | 0.468 | 2e-22 | |
| 223647006 | 526 | Importin subunit alpha-2 [Salmo salar] g | 0.582 | 0.207 | 0.477 | 6e-22 | |
| 410901792 | 521 | PREDICTED: importin subunit alpha-2-like | 0.625 | 0.224 | 0.433 | 1e-21 | |
| 405950951 | 617 | Importin subunit alpha-1 [Crassostrea gi | 0.545 | 0.165 | 0.483 | 1e-21 | |
| 427785233 | 516 | Putative karyopherin importin alpha [Rhi | 0.566 | 0.205 | 0.462 | 2e-21 | |
| 432871172 | 522 | PREDICTED: importin subunit alpha-2-like | 0.593 | 0.212 | 0.450 | 3e-21 | |
| 345488160 | 520 | PREDICTED: importin subunit alpha-2-like | 0.609 | 0.219 | 0.470 | 7e-21 | |
| 91077394 | 516 | PREDICTED: similar to importin alpha 1a | 0.593 | 0.215 | 0.491 | 1e-20 | |
| 380029460 | 520 | PREDICTED: importin subunit alpha-2-like | 0.582 | 0.209 | 0.464 | 2e-20 |
| >gi|348511215|ref|XP_003443140.1| PREDICTED: importin subunit alpha-2 [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
Score = 110 bits (276), Expect = 2e-22, Method: Compositional matrix adjust.
Identities = 52/111 (46%), Positives = 76/111 (68%)
Query: 71 RKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCM 130
R FKN GK +E+RR+R E+NVELRKA KDDQ+FKRRN+ + E + C
Sbjct: 7 RLNQFKNKGKDVNELRRRRVEVNVELRKAKKDDQIFKRRNVTAMPEDATSPLQERSQNCQ 66
Query: 131 SPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVP 181
+ TV E++ G+ S N + ++ AT++ARK+LS+++HPPID+LI AG++P
Sbjct: 67 GLRQWTVEEIVAGVNSGNSESQLQATQAARKLLSRDKHPPIDQLISAGLIP 117
|
Source: Oreochromis niloticus Species: Oreochromis niloticus Genus: Oreochromis Family: Cichlidae Order: Perciformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|5802657|gb|AAD51751.1| pendulin [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|223647006|gb|ACN10261.1| Importin subunit alpha-2 [Salmo salar] gi|223672871|gb|ACN12617.1| Importin subunit alpha-2 [Salmo salar] | Back alignment and taxonomy information |
|---|
| >gi|410901792|ref|XP_003964379.1| PREDICTED: importin subunit alpha-2-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|405950951|gb|EKC18904.1| Importin subunit alpha-1 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|427785233|gb|JAA58068.1| Putative karyopherin importin alpha [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|432871172|ref|XP_004071868.1| PREDICTED: importin subunit alpha-2-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|345488160|ref|XP_001605009.2| PREDICTED: importin subunit alpha-2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|91077394|ref|XP_975293.1| PREDICTED: similar to importin alpha 1a [Tribolium castaneum] gi|270001645|gb|EEZ98092.1| hypothetical protein TcasGA2_TC000505 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380029460|ref|XP_003698390.1| PREDICTED: importin subunit alpha-2-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 187 | ||||||
| ZFIN|ZDB-GENE-040718-22 | 546 | kpna2 "karyopherin alpha 2 (RA | 0.641 | 0.219 | 0.438 | 2.4e-23 | |
| UNIPROTKB|J3KS65 | 143 | KPNA2 "Importin subunit alpha- | 0.566 | 0.741 | 0.439 | 2.1e-20 | |
| UNIPROTKB|J3QLL0 | 134 | KPNA2 "Importin subunit alpha- | 0.566 | 0.791 | 0.439 | 2.1e-20 | |
| UNIPROTKB|F1M4P1 | 522 | F1M4P1 "Importin subunit alpha | 0.636 | 0.227 | 0.418 | 3.6e-20 | |
| UNIPROTKB|F1NJS6 | 528 | KPNA2 "Importin subunit alpha" | 0.647 | 0.229 | 0.419 | 4.7e-20 | |
| UNIPROTKB|P52292 | 529 | KPNA2 "Importin subunit alpha- | 0.566 | 0.200 | 0.439 | 1.3e-19 | |
| RGD|621419 | 529 | Kpna2 "karyopherin alpha 2" [R | 0.636 | 0.224 | 0.398 | 1.7e-19 | |
| UNIPROTKB|Q6P6T9 | 529 | Kpna2 "Importin subunit alpha" | 0.636 | 0.224 | 0.398 | 1.7e-19 | |
| UNIPROTKB|E2R6L9 | 529 | KPNA2 "Importin subunit alpha" | 0.636 | 0.224 | 0.398 | 1.7e-19 | |
| UNIPROTKB|J9P954 | 529 | J9P954 "Importin subunit alpha | 0.636 | 0.224 | 0.398 | 2.1e-19 |
| ZFIN|ZDB-GENE-040718-22 kpna2 "karyopherin alpha 2 (RAG cohort 1, importin alpha 1)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 258 (95.9 bits), Expect = 2.4e-23, Sum P(2) = 2.4e-23
Identities = 53/121 (43%), Positives = 76/121 (62%)
Query: 61 KMSQKVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEE 120
KMS R FKN GK E+RR+R E+NVELRKA KD+Q+ KRRN+ +
Sbjct: 21 KMSAANENTARLTQFKNKGKDATELRRRRIEVNVELRKAKKDEQILKRRNVSSFPDEATS 80
Query: 121 NVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVV 180
+ C + TV E++ G+ S+N + ++ AT++ARK+LS+ERHPPID +I AG++
Sbjct: 81 PLQEKSQNCQAQ-HWTVEEIVNGVNSNNLETQVQATQAARKLLSRERHPPIDRIISAGLI 139
Query: 181 P 181
P
Sbjct: 140 P 140
|
|
| UNIPROTKB|J3KS65 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QLL0 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M4P1 F1M4P1 "Importin subunit alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJS6 KPNA2 "Importin subunit alpha" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52292 KPNA2 "Importin subunit alpha-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|621419 Kpna2 "karyopherin alpha 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P6T9 Kpna2 "Importin subunit alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6L9 KPNA2 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P954 J9P954 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 187 | |||
| COG5064 | 526 | COG5064, SRP1, Karyopherin (importin) alpha [Intra | 1e-17 | |
| pfam01749 | 97 | pfam01749, IBB, Importin beta binding domain | 7e-16 | |
| COG5064 | 526 | COG5064, SRP1, Karyopherin (importin) alpha [Intra | 1e-13 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 7e-11 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 1e-09 | |
| pfam00514 | 41 | pfam00514, Arm, Armadillo/beta-catenin-like repeat | 3e-04 | |
| pfam00514 | 41 | pfam00514, Arm, Armadillo/beta-catenin-like repeat | 0.001 |
| >gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Score = 79.5 bits (196), Expect = 1e-17
Identities = 42/121 (34%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
Query: 62 MSQKVAAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEE 120
+ + R+ +FK G+ S DE+RR+R E VELRK +++ L KRRN+ + E E
Sbjct: 1 STSRFVPEARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAES 60
Query: 121 NVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVV 180
+ +E +P++ + + S + + ++ A RK+LSKE PPI +I+AGVV
Sbjct: 61 SFIPME----QQFYSELPQLTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVV 116
Query: 181 P 181
P
Sbjct: 117 P 117
|
Length = 526 |
| >gnl|CDD|201951 pfam01749, IBB, Importin beta binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.96 | |
| KOG0166|consensus | 514 | 99.91 | ||
| KOG0166|consensus | 514 | 99.9 | ||
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.89 | |
| PF01749 | 97 | IBB: Importin beta binding domain; InterPro: IPR00 | 99.87 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.41 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.39 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 98.83 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.83 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.63 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 98.32 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 98.04 | |
| KOG4224|consensus | 550 | 98.02 | ||
| KOG4224|consensus | 550 | 98.01 | ||
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 98.0 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.85 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 97.42 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 96.66 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 96.22 | |
| PF14668 | 73 | RICTOR_V: Rapamycin-insensitive companion of mTOR, | 95.97 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 95.58 | |
| PRK09687 | 280 | putative lyase; Provisional | 95.27 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 95.07 | |
| KOG1048|consensus | 717 | 94.9 | ||
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 94.82 | |
| KOG1048|consensus | 717 | 94.73 | ||
| KOG2160|consensus | 342 | 94.6 | ||
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 93.87 | |
| PRK09687 | 280 | putative lyase; Provisional | 92.91 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 92.76 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 91.91 | |
| KOG4199|consensus | 461 | 90.06 | ||
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 88.13 | |
| PF11538 | 40 | Snurportin1: Snurportin1; InterPro: IPR024721 Snur | 87.46 | |
| smart00567 | 30 | EZ_HEAT E-Z type HEAT repeats. Present in subunits | 84.36 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 84.17 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 83.56 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 83.39 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 82.81 | |
| KOG2171|consensus | 1075 | 81.61 |
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Probab=99.96 E-value=6.8e-30 Score=220.20 Aligned_cols=121 Identities=34% Similarity=0.504 Sum_probs=100.9
Q ss_pred cchhhhhHhhhhhhccCCC-hHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhcccCCCCCCCccCCHHHHH
Q psy10739 63 SQKVAAIDRKASFKNAGKS-FDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMI 141 (187)
Q Consensus 63 ~t~~~~~~R~~~fKn~g~d-~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~~~~~~~~~~~~l~~iv 141 (187)
.+..-|++|+.+||+||.. ++++||+|++.+|||||+||||.|.||||......+..+..- +-.......+|+|.
T Consensus 2 ~srf~p~~Rr~~fk~Kg~f~adelRr~ReeQQvElRkqKreE~LnKrRNl~dv~e~a~ss~i----~meqq~~~elp~lt 77 (526)
T COG5064 2 TSRFVPEARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAESSFI----PMEQQFYSELPQLT 77 (526)
T ss_pred CcccchHHHHhcccCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccchhhhccC----chhHHhhhhhHHHH
Confidence 3466788999999999864 899999999999999999999999999998433332222211 00112234689999
Q ss_pred HHhcCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739 142 EGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR 187 (187)
Q Consensus 142 ~~l~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~ 187 (187)
+.++|+|.+.|+.|+..|||+||+|.+||||.||++|+|||||+||
T Consensus 78 ~~l~SdDie~q~qav~kFR~~LS~E~~PPIq~VIdaGvVpRfvefm 123 (526)
T COG5064 78 QQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFM 123 (526)
T ss_pred HHHhhhHHHHHHHHHHHHHHHhccccCCCchhHHhccccHHHHHHH
Confidence 9999999999999999999999999999999999999999999996
|
|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF01749 IBB: Importin beta binding domain; InterPro: IPR002652 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >KOG2160|consensus | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG4199|consensus | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >PF11538 Snurportin1: Snurportin1; InterPro: IPR024721 Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor [] | Back alignment and domain information |
|---|
| >smart00567 EZ_HEAT E-Z type HEAT repeats | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 187 | ||||
| 3tpo_A | 529 | Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP | 9e-20 | ||
| 1wa5_B | 530 | Crystal Structure Of The Exportin Cse1p Complexed W | 2e-16 | ||
| 3rz9_A | 510 | Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt | 3e-12 | ||
| 3rz9_A | 510 | Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt | 2e-07 | ||
| 4ba3_A | 496 | Mimp_alphadibb_a89nls Length = 496 | 3e-12 | ||
| 4ba3_A | 496 | Mimp_alphadibb_a89nls Length = 496 | 2e-07 | ||
| 3ukw_B | 510 | Mouse Importin Alpha: Bimax1 Peptide Complex Length | 3e-12 | ||
| 3ukw_B | 510 | Mouse Importin Alpha: Bimax1 Peptide Complex Length | 7e-08 | ||
| 4htv_A | 509 | Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex | 4e-12 | ||
| 4htv_A | 509 | Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex | 7e-08 | ||
| 1ial_A | 453 | Importin Alpha, Mouse Length = 453 | 4e-12 | ||
| 1ial_A | 453 | Importin Alpha, Mouse Length = 453 | 1e-08 | ||
| 2ynr_A | 461 | Mimp_alphadibb_b54nls Length = 461 | 4e-12 | ||
| 2ynr_A | 461 | Mimp_alphadibb_b54nls Length = 461 | 1e-08 | ||
| 1q1s_C | 466 | Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid | 4e-12 | ||
| 1q1s_C | 466 | Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid | 2e-07 | ||
| 1ejl_I | 460 | Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti | 4e-12 | ||
| 1ejl_I | 460 | Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti | 2e-07 | ||
| 3btr_C | 427 | Ar-Nls:importin-Alpha Complex Length = 427 | 4e-12 | ||
| 3btr_C | 427 | Ar-Nls:importin-Alpha Complex Length = 427 | 2e-07 | ||
| 1y2a_C | 428 | Structure Of Mammalian Importin Bound To The Non-Cl | 4e-12 | ||
| 1y2a_C | 428 | Structure Of Mammalian Importin Bound To The Non-Cl | 2e-07 | ||
| 3ve6_A | 426 | Crystal Structure Analysis Of Venezuelan Equine Enc | 4e-12 | ||
| 3ve6_A | 426 | Crystal Structure Analysis Of Venezuelan Equine Enc | 2e-07 | ||
| 3tpm_A | 422 | Crystal Structure Of Mal Rpel Domain In Complex Wit | 4e-12 | ||
| 3tpm_A | 422 | Crystal Structure Of Mal Rpel Domain In Complex Wit | 3e-07 | ||
| 3l3q_A | 427 | Mouse Importin Alpha-Peptm Nls Peptide Complex Leng | 4e-12 | ||
| 3l3q_A | 427 | Mouse Importin Alpha-Peptm Nls Peptide Complex Leng | 2e-07 | ||
| 2c1m_A | 424 | Nup50:importin-Alpha Complex Length = 424 | 5e-12 | ||
| 2c1m_A | 424 | Nup50:importin-Alpha Complex Length = 424 | 3e-07 | ||
| 3fex_C | 467 | Crystal Structure Of The Cbc-Importin Alpha Complex | 1e-11 | ||
| 3fex_C | 467 | Crystal Structure Of The Cbc-Importin Alpha Complex | 7e-08 | ||
| 1bk5_A | 422 | Karyopherin Alpha From Saccharomyces Cerevisiae Len | 2e-10 | ||
| 1bk5_A | 422 | Karyopherin Alpha From Saccharomyces Cerevisiae Len | 6e-05 | ||
| 1bk6_A | 422 | Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng | 2e-10 | ||
| 1bk6_A | 422 | Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng | 6e-05 | ||
| 2c1t_A | 454 | Structure Of The Kap60p:nup2 Complex Length = 454 | 3e-10 | ||
| 2c1t_A | 454 | Structure Of The Kap60p:nup2 Complex Length = 454 | 5e-05 | ||
| 1ee4_A | 423 | Crystal Structure Of Yeast Karyopherin (Importin) A | 3e-10 | ||
| 1ee4_A | 423 | Crystal Structure Of Yeast Karyopherin (Importin) A | 6e-05 | ||
| 1un0_A | 443 | Crystal Structure Of Yeast Karyopherin (Importin) A | 3e-10 | ||
| 1un0_A | 443 | Crystal Structure Of Yeast Karyopherin (Importin) A | 6e-05 | ||
| 1ee5_A | 424 | Yeast Karyopherin (Importin) Alpha In A Complex Wit | 3e-10 | ||
| 1ee5_A | 424 | Yeast Karyopherin (Importin) Alpha In A Complex Wit | 5e-05 | ||
| 4b8j_A | 528 | Rimp_alpha1a Length = 528 | 3e-09 | ||
| 1qgk_B | 44 | Structure Of Importin Beta Bound To The Ibb Domain | 2e-08 | ||
| 2yns_A | 490 | Rimp_alpha_b54nls Length = 490 | 4e-08 | ||
| 2yns_A | 490 | Rimp_alpha_b54nls Length = 490 | 4e-08 | ||
| 3tj3_A | 447 | Structure Of Importin A5 Bound To The N-Terminus Of | 9e-08 | ||
| 3tj3_A | 447 | Structure Of Importin A5 Bound To The N-Terminus Of | 1e-05 | ||
| 2jdq_A | 450 | C-Terminal Domain Of Influenza A Virus Polymerase P | 9e-08 | ||
| 2jdq_A | 450 | C-Terminal Domain Of Influenza A Virus Polymerase P | 1e-05 | ||
| 4db6_A | 210 | Designed Armadillo Repeat Protein (Yiiim3aii) Lengt | 4e-06 | ||
| 4db9_A | 210 | Designed Armadillo Repeat Protein (Yiiim3aiii) Leng | 4e-06 | ||
| 4dba_A | 210 | Designed Armadillo Repeat Protein (Yiim3aii) Length | 4e-06 | ||
| 4db8_A | 252 | Designed Armadillo-Repeat Protein Length = 252 | 5e-06 | ||
| 1qgr_B | 27 | Structure Of Importin Beta Bound To The Ibb Domain | 2e-04 | ||
| 4hxt_A | 252 | Crystal Structure Of Engineered Protein. Northeast | 9e-04 |
| >pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 | Back alignment and structure |
|
| >pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 | Back alignment and structure |
| >pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 | Back alignment and structure |
| >pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 | Back alignment and structure |
| >pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 | Back alignment and structure |
| >pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 | Back alignment and structure |
| >pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 | Back alignment and structure |
| >pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 | Back alignment and structure |
| >pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 | Back alignment and structure |
| >pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 | Back alignment and structure |
| >pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 | Back alignment and structure |
| >pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 | Back alignment and structure |
| >pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 | Back alignment and structure |
| >pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 | Back alignment and structure |
| >pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 | Back alignment and structure |
| >pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 | Back alignment and structure |
| >pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 | Back alignment and structure |
| >pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 | Back alignment and structure |
| >pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 | Back alignment and structure |
| >pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 | Back alignment and structure |
| >pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 | Back alignment and structure |
| >pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 | Back alignment and structure |
| >pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 | Back alignment and structure |
| >pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 | Back alignment and structure |
| >pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 | Back alignment and structure |
| >pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 | Back alignment and structure |
| >pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 | Back alignment and structure |
| >pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 | Back alignment and structure |
| >pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 | Back alignment and structure |
| >pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 | Back alignment and structure |
| >pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 | Back alignment and structure |
| >pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 | Back alignment and structure |
| >pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 | Back alignment and structure |
| >pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 | Back alignment and structure |
| >pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 | Back alignment and structure |
| >pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 | Back alignment and structure |
| >pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 | Back alignment and structure |
| >pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 | Back alignment and structure |
| >pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 | Back alignment and structure |
| >pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 | Back alignment and structure |
| >pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 | Back alignment and structure |
| >pdb|1QGK|B Chain B, Structure Of Importin Beta Bound To The Ibb Domain Of Importin Alpha Length = 44 | Back alignment and structure |
| >pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 | Back alignment and structure |
| >pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 | Back alignment and structure |
| >pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 | Back alignment and structure |
| >pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 | Back alignment and structure |
| >pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 | Back alignment and structure |
| >pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 | Back alignment and structure |
| >pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 | Back alignment and structure |
| >pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 | Back alignment and structure |
| >pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 | Back alignment and structure |
| >pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 | Back alignment and structure |
| >pdb|1QGR|B Chain B, Structure Of Importin Beta Bound To The Ibb Domain Of Importin Alpha (Ii Crystal Form, Grown At Low Ph) Length = 27 | Back alignment and structure |
| >pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 187 | |||
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 1e-27 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 1e-12 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 5e-08 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 6e-08 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 9e-08 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 3e-07 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 1e-06 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 5e-05 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 3e-20 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 1e-13 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 3e-10 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-07 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-07 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 1e-06 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 1e-05 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-04 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 3e-18 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 5e-16 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 2e-11 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 3e-11 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 9e-17 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 6e-13 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 4e-12 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 3e-11 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 1e-10 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 1e-05 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 2e-16 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 1e-11 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 2e-09 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 1e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 6e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 8e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 2e-07 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 4e-06 | |
| 1qgk_B | 44 | Protein (importin alpha-2 subunit); transport rece | 4e-13 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 3e-11 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 2e-06 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 8e-06 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 4e-04 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 4e-10 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 2e-05 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 2e-05 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 4e-09 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 5e-09 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 2e-08 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 2e-08 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 3e-08 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 3e-07 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 4e-07 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 4e-07 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 1e-06 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 6e-06 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 7e-06 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-09 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 3e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-07 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 1e-06 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-06 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 8e-05 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-04 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 7e-04 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 7e-09 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 8e-09 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-08 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-08 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-08 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 4e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 9e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 2e-06 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 9e-06 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 5e-04 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 2e-07 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 8e-04 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 3e-07 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 3e-05 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 1e-06 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 2e-05 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 6e-04 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 4e-05 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 8e-05 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 6e-04 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 5e-05 | |
| 1qgr_B | 27 | Protein (importin alpha-2 subunit); transport rece | 3e-04 |
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
Score = 107 bits (267), Expect = 1e-27
Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 6/132 (4%)
Query: 59 NTKMSQKVAAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLD-- 115
+ K R+ +FKN G+ S DE+RR+R VELRKA +D+ L KRRN
Sbjct: 5 TDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDG 64
Query: 116 ---EIEEENVTVIEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPID 172
+ E+E+ + S ++ +P+M + + S + + ++ AT R++LS+E PPID
Sbjct: 65 ADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPID 124
Query: 173 ELIEAGVVPICV 184
+I+AGVVP V
Sbjct: 125 VVIQAGVVPRLV 136
|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >1qgk_B Protein (importin alpha-2 subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.50A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 | Back alignment and structure |
|---|
| >1qgr_B Protein (importin alpha-2 subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} Length = 27 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.96 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.81 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.8 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.67 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.63 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.63 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.6 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.54 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.49 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.39 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.38 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.37 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.37 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.37 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.34 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.3 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.29 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.29 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.28 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.28 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.27 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.27 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.26 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.26 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.25 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.22 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.21 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.16 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.14 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.12 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.1 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.87 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 98.77 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 98.74 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 98.7 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 98.61 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 97.94 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 97.85 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 97.44 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 97.14 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 96.98 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 96.75 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 96.75 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.73 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.69 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 96.63 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.62 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.5 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.49 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 96.19 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 95.7 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 95.61 | |
| 2p8q_B | 40 | Snurportin-1; heat repeat, IBB-domain, importin, k | 94.9 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 94.37 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 94.21 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 92.86 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 92.58 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 92.22 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 91.98 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 91.36 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 88.71 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 88.14 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 87.63 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 87.46 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 86.23 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 84.1 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 81.46 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 80.79 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 80.18 |
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
Probab=99.96 E-value=1.3e-30 Score=235.03 Aligned_cols=122 Identities=39% Similarity=0.615 Sum_probs=64.3
Q ss_pred hhhhhHhhhhhhccCCChHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhcccCCCCCCCccCCHHHHHHHh
Q psy10739 65 KVAAIDRKASFKNAGKSFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVIEPTCMSPIKMTVPEMIEGM 144 (187)
Q Consensus 65 ~~~~~~R~~~fKn~g~d~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~~~~~~~~~~~~l~~iv~~l 144 (187)
.+.|++|++.|||+|+|.+|+||||+|..|||||+||||+|+||||+....++..++.. +...........+++|++++
T Consensus 7 ~~~~~~r~~~~k~~~~~~~e~r~~R~~~~v~lRk~kr~e~l~krR~~~~~~~~~~~~~~-~~~~~~~~~~~~l~~lv~~l 85 (529)
T 3tpo_A 7 ANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQ-ENRNNQGTVNWSVEDIVKGI 85 (529)
T ss_dssp -------------------------------------CCSCSCCCCCC----------------CGGGSSCCHHHHHHHH
T ss_pred CCCcHHHHHHhccCCCChHHHHHHHhHHHHHHHHHHHHHHHHhccCCCCCcccccChhh-hccchhhhHHHHHHHHHHHh
Confidence 45789999999999999999999999999999999999999999998654444333332 22222334457899999999
Q ss_pred cCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739 145 KSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR 187 (187)
Q Consensus 145 ~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~ 187 (187)
+|+|++.|+.|++++||+||.++||||+.||++|+||+||+||
T Consensus 86 ~s~d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G~ip~Lv~lL 128 (529)
T 3tpo_A 86 NSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL 128 (529)
T ss_dssp TSSCHHHHHHHHHHHHHHHTSSSCCCHHHHHHTTHHHHHHHHH
T ss_pred cCCCHHHHHHHHHHHHHHHcCCCCchHHHHHHCCCHHHHHHHH
Confidence 9999999999999999999999999999999999999999875
|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2p8q_B Snurportin-1; heat repeat, IBB-domain, importin, karyopherin, transport; 2.35A {Homo sapiens} PDB: 2q5d_C 3lww_B | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 187 | ||||
| d1wa5b_ | 503 | a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S | 5e-26 | |
| d1wa5b_ | 503 | a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S | 0.001 | |
| d1wa5b_ | 503 | a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S | 0.002 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 1e-11 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 8e-04 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 0.002 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 1e-07 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 1e-04 |
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Karyopherin alpha species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 101 bits (251), Expect = 5e-26
Identities = 46/123 (37%), Positives = 72/123 (58%), Gaps = 6/123 (4%)
Query: 71 RKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDE-----IEEENVTV 124
R+ +FKN G+ S DE+RR+R VELRKA +D+ L KRRN + E+E+
Sbjct: 6 RRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVS 65
Query: 125 IEPTCMSPIKMTVPEMIEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICV 184
+ S ++ +P+M + + S + + ++ AT R++LS+E PPID +I+AGVVP V
Sbjct: 66 ADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLV 125
Query: 185 FQR 187
Sbjct: 126 EFM 128
|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.86 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.35 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.19 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.14 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.03 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.71 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.67 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.34 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.07 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 96.01 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 95.37 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 94.41 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 93.6 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 92.14 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 91.91 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 87.12 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 86.12 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 82.33 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 81.95 |
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Karyopherin alpha species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.86 E-value=1.4e-23 Score=182.72 Aligned_cols=121 Identities=36% Similarity=0.521 Sum_probs=84.5
Q ss_pred hhhHhhhhhhccCC-ChHHHhhhhhhHHHHHHhhchhhHHhhhhccccccchhhhhhccc-----CCCCCCCccCCHHHH
Q psy10739 67 AAIDRKASFKNAGK-SFDEMRRKRCEMNVELRKAHKDDQLFKRRNIDQLDEIEEENVTVI-----EPTCMSPIKMTVPEM 140 (187)
Q Consensus 67 ~~~~R~~~fKn~g~-d~~e~RrrR~e~~veLRK~kree~l~KrRn~~~~~~~~~s~~~~~-----~~~~~~~~~~~l~~i 140 (187)
.|++|++.||++|+ |++|+||||++..|||||+|||+.|.|||++....+...++...+ ...........++++
T Consensus 2 ~~~~~~~~~~~~~~~~~~e~r~kR~~~~veiRk~kr~e~l~kkR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ 81 (503)
T d1wa5b_ 2 VPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQM 81 (503)
T ss_dssp CCGGGCC-----------CCCCCTTSSCCCCSCCCCCSCCSCCCCC----------------------------CCHHHH
T ss_pred CchHHhHHhccCCCCChHHHHHHHHHHHHHHhHHHHHHHHHhhcCCCcccccccccchhccccchhhHHHHHHHHHHHHH
Confidence 47899999999997 999999999999999999999999999998643211111111100 001112234789999
Q ss_pred HHHhcCCCHHHHHHHHHHHHhhhcCCCCCcHHHHHHcCCcccccccC
Q psy10739 141 IEGMKSSNPKMRMIATRSARKMLSKERHPPIDELIEAGVVPICVFQR 187 (187)
Q Consensus 141 v~~l~S~d~~~ql~a~~~~RklLS~e~nPPId~VI~aGvVP~~V~~~ 187 (187)
+++++|+|++.++.|+..+|++||.+.+|||+.+|++|++|.||.+|
T Consensus 82 ~~~~~s~~~~~~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l 128 (503)
T d1wa5b_ 82 TQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFM 128 (503)
T ss_dssp HHHHSCSSHHHHHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTT
T ss_pred HHHhcCCCHHHHHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHH
Confidence 99999999999999999999999999999999999999999999875
|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|