Psyllid ID: psy10835
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| 242021065 | 79 | membrane-associated protein, putative [P | 0.975 | 0.987 | 0.935 | 8e-36 | |
| 110749924 | 79 | PREDICTED: u6 snRNA-associated Sm-like p | 0.975 | 0.987 | 0.923 | 2e-35 | |
| 156550741 | 80 | PREDICTED: U6 snRNA-associated Sm-like p | 0.975 | 0.975 | 0.923 | 2e-35 | |
| 332023213 | 608 | U6 snRNA-associated Sm-like protein LSm6 | 0.975 | 0.128 | 0.910 | 2e-35 | |
| 307195205 | 79 | U6 snRNA-associated Sm-like protein LSm6 | 0.975 | 0.987 | 0.923 | 2e-35 | |
| 357625163 | 79 | putative membrane-associated protein [Da | 0.975 | 0.987 | 0.923 | 3e-35 | |
| 328697100 | 80 | PREDICTED: u6 snRNA-associated Sm-like p | 1.0 | 1.0 | 0.875 | 3e-35 | |
| 307184080 | 79 | U6 snRNA-associated Sm-like protein LSm6 | 0.975 | 0.987 | 0.910 | 5e-35 | |
| 58387098 | 79 | AGAP005314-PA [Anopheles gambiae str. PE | 0.975 | 0.987 | 0.910 | 7e-35 | |
| 91082305 | 79 | PREDICTED: similar to AGAP005314-PA [Tri | 0.975 | 0.987 | 0.897 | 2e-34 |
| >gi|242021065|ref|XP_002430967.1| membrane-associated protein, putative [Pediculus humanus corporis] gi|212516187|gb|EEB18229.1| membrane-associated protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 154 bits (388), Expect = 8e-36, Method: Compositional matrix adjust.
Identities = 73/78 (93%), Positives = 76/78 (97%)
Query: 1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
MSRKE+LSQFIQQIHGRPVVVKL SGVDYRGVL+CLDGYMNIALEQTEEY+NGQLKNKYG
Sbjct: 1 MSRKEALSQFIQQIHGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYG 60
Query: 61 DTFIRGNNVLYISTQKRR 78
D FIRGNNVLYISTQKRR
Sbjct: 61 DAFIRGNNVLYISTQKRR 78
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|110749924|ref|XP_001121733.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like [Apis mellifera] gi|350419231|ref|XP_003492114.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Bombus impatiens] gi|380023576|ref|XP_003695594.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Apis florea] gi|383861934|ref|XP_003706439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|156550741|ref|XP_001606104.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332023213|gb|EGI63469.1| U6 snRNA-associated Sm-like protein LSm6 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307195205|gb|EFN77189.1| U6 snRNA-associated Sm-like protein LSm6 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|357625163|gb|EHJ75691.1| putative membrane-associated protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328697100|ref|XP_003240231.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 1 [Acyrthosiphon pisum] gi|328697102|ref|XP_003240232.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307184080|gb|EFN70615.1| U6 snRNA-associated Sm-like protein LSm6 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|58387098|ref|XP_315329.2| AGAP005314-PA [Anopheles gambiae str. PEST] gi|170059581|ref|XP_001865425.1| Lsm6 protein [Culex quinquefasciatus] gi|55238130|gb|EAA11294.2| AGAP005314-PA [Anopheles gambiae str. PEST] gi|167878291|gb|EDS41674.1| Lsm6 protein [Culex quinquefasciatus] gi|312381097|gb|EFR26918.1| hypothetical protein AND_25803 [Anopheles darlingi] gi|403182446|gb|EJY57393.1| AAEL017161-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|91082305|ref|XP_974175.1| PREDICTED: similar to AGAP005314-PA [Tribolium castaneum] gi|270007198|gb|EFA03646.1| hypothetical protein TcasGA2_TC013740 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| FB|FBgn0034564 | 79 | CG9344 [Drosophila melanogaste | 0.975 | 0.987 | 0.884 | 2e-33 | |
| UNIPROTKB|P62312 | 80 | LSM6 "U6 snRNA-associated Sm-l | 0.95 | 0.95 | 0.855 | 8.8e-31 | |
| MGI|MGI:1925901 | 80 | Lsm6 "LSM6 homolog, U6 small n | 0.95 | 0.95 | 0.855 | 8.8e-31 | |
| ZFIN|ZDB-GENE-040625-50 | 80 | lsm6 "LSM6 homolog, U6 small n | 0.95 | 0.95 | 0.815 | 6.2e-30 | |
| WB|WBGene00003080 | 77 | lsm-6 [Caenorhabditis elegans | 0.962 | 1.0 | 0.714 | 4.5e-27 | |
| TAIR|locus:2080487 | 91 | LSM6A "AT3G59810" [Arabidopsis | 0.837 | 0.736 | 0.820 | 1.9e-26 | |
| TAIR|locus:2043969 | 91 | LSM6B "AT2G43810" [Arabidopsis | 0.862 | 0.758 | 0.768 | 4e-26 | |
| DICTYBASE|DDB_G0275719 | 88 | lsm6 "putative U6 small nuclea | 0.862 | 0.784 | 0.681 | 1.5e-21 | |
| POMBASE|SPAC2F3.17c | 75 | lsm6 "U6 snRNP-associated prot | 0.85 | 0.906 | 0.632 | 2.4e-21 | |
| GENEDB_PFALCIPARUM|PF13_0142 | 77 | PF13_0142 "u6 snRNA-associated | 0.837 | 0.870 | 0.582 | 3.6e-18 |
| FB|FBgn0034564 CG9344 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
Identities = 69/78 (88%), Positives = 73/78 (93%)
Query: 1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
MSRKE+LSQFI QIHGRPV VKL +GVDYRGVL+CLDGYMNI LEQTEEY+NGQLKNKYG
Sbjct: 1 MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYG 60
Query: 61 DTFIRGNNVLYISTQKRR 78
D FIRGNNVLYISTQKRR
Sbjct: 61 DAFIRGNNVLYISTQKRR 78
|
|
| UNIPROTKB|P62312 LSM6 "U6 snRNA-associated Sm-like protein LSm6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1925901 Lsm6 "LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-50 lsm6 "LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003080 lsm-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080487 LSM6A "AT3G59810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043969 LSM6B "AT2G43810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0275719 lsm6 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC2F3.17c lsm6 "U6 snRNP-associated protein Lsm6 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF13_0142 PF13_0142 "u6 snRNA-associated sm-like protein, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| cd01726 | 68 | cd01726, LSm6, Like-Sm protein 6 | 5e-38 | |
| cd01722 | 69 | cd01722, Sm_F, Sm protein F | 6e-22 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 1e-16 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 2e-16 | |
| cd01731 | 69 | cd01731, archaeal_Sm1, archaeal Sm protein 1 | 3e-15 | |
| PRK00737 | 72 | PRK00737, PRK00737, small nuclear ribonucleoprotei | 3e-14 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 6e-12 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 2e-10 | |
| cd01723 | 76 | cd01723, LSm4, Like-Sm protein 4 | 4e-06 | |
| cd01733 | 78 | cd01733, LSm10, Like-Sm protein 10 | 2e-05 | |
| cd01719 | 70 | cd01719, Sm_G, Sm protein G | 3e-05 | |
| cd11678 | 69 | cd11678, archaeal_LSm, archaeal Like-Sm protein | 5e-05 | |
| cd01725 | 89 | cd01725, LSm2, Like-Sm protein 2 | 0.002 | |
| cd01728 | 74 | cd01728, LSm1, Like-Sm protein 1 | 0.002 |
| >gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 | Back alignment and domain information |
|---|
Score = 120 bits (304), Expect = 5e-38
Identities = 48/66 (72%), Positives = 59/66 (89%)
Query: 8 SQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGN 67
S+F+++I G+PVVVKL +GV+YRGVL+CLDGYMN+ LE TEEY++GQL KYGD FIRGN
Sbjct: 3 SKFLKKIIGKPVVVKLKNGVEYRGVLACLDGYMNLVLEDTEEYVDGQLVAKYGDAFIRGN 62
Query: 68 NVLYIS 73
NVLYIS
Sbjct: 63 NVLYIS 68
|
The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm657 is believed to be an assembly intermediate for both the LSm1-7 and LSm2-8 rings. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 68 |
| >gnl|CDD|212469 cd01722, Sm_F, Sm protein F | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212470 cd01723, LSm4, Like-Sm protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212480 cd01733, LSm10, Like-Sm protein 10 | Back alignment and domain information |
|---|
| >gnl|CDD|212466 cd01719, Sm_G, Sm protein G | Back alignment and domain information |
|---|
| >gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein | Back alignment and domain information |
|---|
| >gnl|CDD|212472 cd01725, LSm2, Like-Sm protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.93 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.93 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.92 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.92 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.92 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.91 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.91 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.91 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.9 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.9 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.88 | |
| KOG1783|consensus | 77 | 99.88 | ||
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| KOG3482|consensus | 79 | 99.88 | ||
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.87 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.87 | |
| KOG1780|consensus | 77 | 99.86 | ||
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.86 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.84 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.83 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.83 | |
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.79 | |
| KOG3460|consensus | 91 | 99.73 | ||
| KOG3293|consensus | 134 | 99.73 | ||
| KOG1775|consensus | 84 | 99.67 | ||
| KOG1781|consensus | 108 | 99.63 | ||
| KOG3448|consensus | 96 | 99.61 | ||
| KOG3172|consensus | 119 | 99.52 | ||
| KOG3168|consensus | 177 | 99.47 | ||
| KOG1782|consensus | 129 | 99.46 | ||
| KOG1774|consensus | 88 | 99.44 | ||
| KOG3428|consensus | 109 | 99.41 | ||
| KOG1784|consensus | 96 | 99.41 | ||
| KOG3459|consensus | 114 | 98.79 | ||
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 98.24 | |
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 98.19 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 97.35 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 97.06 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 96.93 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 96.89 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 96.87 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 96.48 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 96.18 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 96.12 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 95.66 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 95.64 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 95.04 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 94.92 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 94.87 | |
| PRK02001 | 152 | hypothetical protein; Validated | 94.45 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 94.24 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 93.72 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 92.55 | |
| PRK14642 | 197 | hypothetical protein; Provisional | 92.39 | |
| cd01734 | 83 | YlxS_C YxlS is a Bacillus subtilis gene of unknown | 91.76 | |
| PRK14640 | 152 | hypothetical protein; Provisional | 91.52 | |
| PRK14633 | 150 | hypothetical protein; Provisional | 91.41 | |
| KOG1073|consensus | 361 | 91.41 | ||
| PRK14645 | 154 | hypothetical protein; Provisional | 91.12 | |
| COG0779 | 153 | Uncharacterized protein conserved in bacteria [Fun | 90.8 | |
| PRK14643 | 164 | hypothetical protein; Provisional | 90.75 | |
| PRK00092 | 154 | ribosome maturation protein RimP; Reviewed | 90.49 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 90.3 | |
| PF02576 | 141 | DUF150: Uncharacterised BCR, YhbC family COG0779; | 90.04 | |
| PRK14632 | 172 | hypothetical protein; Provisional | 90.02 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 89.79 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 89.37 | |
| PRK14647 | 159 | hypothetical protein; Provisional | 88.71 | |
| PRK14637 | 151 | hypothetical protein; Provisional | 87.95 | |
| PRK06955 | 300 | biotin--protein ligase; Provisional | 87.87 | |
| PRK14631 | 174 | hypothetical protein; Provisional | 87.18 | |
| PRK14641 | 173 | hypothetical protein; Provisional | 86.04 | |
| PRK13325 | 592 | bifunctional biotin--[acetyl-CoA-carboxylase] liga | 86.03 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 83.63 | |
| PRK14630 | 143 | hypothetical protein; Provisional | 81.51 |
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
Probab=99.93 E-value=1e-26 Score=136.16 Aligned_cols=70 Identities=34% Similarity=0.610 Sum_probs=65.4
Q ss_pred CChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEe
Q psy10835 5 ESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIST 74 (80)
Q Consensus 5 ~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~ 74 (80)
..|+++|+++++++|.|+|+||++|+|+|.+||+|||++|+||.|..+++..+.+|.++|||++|++|.+
T Consensus 3 ~~P~~~L~~~~~k~V~V~lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~~~~~~~lg~v~iRG~~V~~i~~ 72 (72)
T PRK00737 3 QRPLDVLNNALNSPVLVRLKGGREFRGELQGYDIHMNLVLDNAEEIQDGEVVRKLGKVVIRGDNVVYVSP 72 (72)
T ss_pred cchHHHHHHhCCCEEEEEECCCCEEEEEEEEEcccceeEEeeEEEEcCCCeEeEcCcEEEeCCEEEEEcC
Confidence 5899999999999999999999999999999999999999999997666667789999999999999963
|
|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >KOG1783|consensus | Back alignment and domain information |
|---|
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3482|consensus | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >KOG1780|consensus | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >KOG3460|consensus | Back alignment and domain information |
|---|
| >KOG3293|consensus | Back alignment and domain information |
|---|
| >KOG1775|consensus | Back alignment and domain information |
|---|
| >KOG1781|consensus | Back alignment and domain information |
|---|
| >KOG3448|consensus | Back alignment and domain information |
|---|
| >KOG3172|consensus | Back alignment and domain information |
|---|
| >KOG3168|consensus | Back alignment and domain information |
|---|
| >KOG1782|consensus | Back alignment and domain information |
|---|
| >KOG1774|consensus | Back alignment and domain information |
|---|
| >KOG3428|consensus | Back alignment and domain information |
|---|
| >KOG1784|consensus | Back alignment and domain information |
|---|
| >KOG3459|consensus | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14642 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold | Back alignment and domain information |
|---|
| >PRK14640 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1073|consensus | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0779 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14643 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00092 ribosome maturation protein RimP; Reviewed | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] | Back alignment and domain information |
|---|
| >PRK14632 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14647 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06955 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14631 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14641 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK14630 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 80 | ||||
| 3swn_B | 77 | Structure Of The Lsm657 Complex: An Assembly Interm | 6e-23 | ||
| 4emk_B | 75 | Crystal Structure Of Splsm567 Length = 75 | 1e-21 | ||
| 3cw1_F | 86 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 5e-14 | ||
| 1loj_A | 87 | Crystal Structure Of A Methanobacterial Sm-Like Arc | 1e-08 | ||
| 1jbm_A | 86 | Heptameric Crystal Structure Of Mth649, An Sm-Like | 1e-08 | ||
| 1jri_A | 85 | The Crystal Structure Of An Sm-Like Archaeal Protei | 1e-08 | ||
| 1i81_A | 83 | Crystal Structure Of A Heptameric Lsm Protein From | 2e-08 | ||
| 1i5l_A | 77 | Crystal Structure Of An Sm-Like Protein (Af-Sm1) Fr | 3e-07 | ||
| 1n9s_A | 93 | Crystal Structure Of Yeast Smf In Spacegroup P43212 | 4e-07 | ||
| 1n9r_A | 93 | Crystal Structure Of A Heptameric Ring Complex Of Y | 8e-07 | ||
| 1i8f_A | 81 | The Crystal Structure Of A Heptameric Archaeal Sm P | 2e-06 | ||
| 1h64_1 | 75 | Crystal Structure Of The Sm-Related Protein Of P. A | 6e-05 | ||
| 1m8v_A | 77 | Structure Of Pyrococcus Abyssii Sm Protein In Compl | 6e-05 | ||
| 1th7_A | 81 | Crystal Structure Of An Archaeal Sm Protein From Su | 7e-04 | ||
| 4emh_A | 105 | Crystal Structure Of Splsm4 Length = 105 | 8e-04 |
| >pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 77 | Back alignment and structure |
|
| >pdb|4EMK|B Chain B, Crystal Structure Of Splsm567 Length = 75 | Back alignment and structure |
| >pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 86 | Back alignment and structure |
| >pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump) Length = 87 | Back alignment and structure |
| >pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like Archaeal Protein From Methanobacterium Thermautotrophicum Length = 86 | Back alignment and structure |
| >pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein With Two Heptamers In The Asymmetric Unit. Length = 85 | Back alignment and structure |
| >pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From Methanobacterium Thermoautotrophicum Length = 83 | Back alignment and structure |
| >pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From Archaeoglobus Fulgidus Complexed With Short Poly-U Rna Length = 77 | Back alignment and structure |
| >pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212 Length = 93 | Back alignment and structure |
| >pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast Smf In Spacegroup P4122 Length = 93 | Back alignment and structure |
| >pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm Protein: Implications For The Eukaryotic Snrnp Core Length = 81 | Back alignment and structure |
| >pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi The Biological Unit Is A Heptamer Length = 75 | Back alignment and structure |
| >pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex With A Uridine Heptamer Length = 77 | Back alignment and structure |
| >pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From Sulfolobus Solfataricus Length = 81 | Back alignment and structure |
| >pdb|4EMH|A Chain A, Crystal Structure Of Splsm4 Length = 105 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 6e-27 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 2e-26 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 2e-26 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 3e-26 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 5e-26 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 2e-25 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 1e-24 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 3e-24 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 8e-22 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 2e-21 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 7e-20 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 5e-17 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 5e-17 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 2e-15 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 2e-15 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 6e-13 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 1e-10 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 2e-10 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 2e-10 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 4e-10 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 5e-08 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 2e-04 |
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
Score = 92.9 bits (231), Expect = 6e-27
Identities = 35/76 (46%), Positives = 48/76 (63%)
Query: 1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
MS + F+ + G+PV+VKL G++Y+G L +DGYMN+ L TEEYI+G L G
Sbjct: 1 MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG 60
Query: 61 DTFIRGNNVLYISTQK 76
+ IR NNVLYI +
Sbjct: 61 EVLIRCNNVLYIRGVE 76
|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Length = 75 | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.96 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.94 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.94 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.93 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.93 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.93 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.93 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.93 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.93 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.93 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.92 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.92 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.92 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.91 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.9 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.9 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.9 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.9 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.89 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.89 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.87 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.86 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.85 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.83 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 99.14 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 97.63 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 97.58 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 97.55 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 97.42 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 97.28 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 97.26 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.97 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 96.88 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 96.69 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 96.62 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 96.29 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 96.24 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 96.21 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 96.2 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 95.32 | |
| 1ib8_A | 164 | Conserved protein SP14.3; nucleic acid binding pro | 91.38 | |
| 2eay_A | 233 | Biotin [acetyl-COA-carboxylase] ligase; biotin bio | 91.18 | |
| 3rux_A | 270 | BIRA bifunctional protein; biotin-protein ligase, | 89.7 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 87.82 | |
| 2ej9_A | 237 | Putative biotin ligase; biotin biosynthesis, monom | 87.52 | |
| 2dxu_A | 235 | Biotin--[acetyl-COA-carboxylase] ligase; biotin bi | 87.08 | |
| 2rm4_A | 103 | CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- | 86.97 |
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
Probab=99.96 E-value=2.7e-29 Score=150.65 Aligned_cols=78 Identities=45% Similarity=0.787 Sum_probs=71.2
Q ss_pred CCCCCChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEeeccc
Q psy10835 1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRR 78 (80)
Q Consensus 1 m~~~~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~~~~~ 78 (80)
||++..|+++|++++|++|+|+|+||++|+|+|.|||+|||++|+||+|+.+++..+.+|.++|||++|++|++++..
T Consensus 1 ms~~~~P~~~L~~~~~k~V~V~Lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~g~~~~~lg~v~IRG~nI~~i~~~d~~ 78 (86)
T 3s6n_F 1 MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE 78 (86)
T ss_dssp --CCCCHHHHHHHHTTSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEETTEEEEEESSEEECGGGEEEEEECC--
T ss_pred CCcCcCcHHHHHHhCCCeEEEEEcCCeEEEEEEEEEcCceEEEEeeEEEEcCCceeeEccEEEEeCCeEEEEEeCCcc
Confidence 899999999999999999999999999999999999999999999999987777778899999999999999998754
|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 | Back alignment and structure |
|---|
| >2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... | Back alignment and structure |
|---|
| >2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 80 | ||||
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 1e-20 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 1e-19 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-19 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 2e-19 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 9e-19 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 7e-18 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 2e-17 | |
| d1b34a_ | 80 | b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s | 2e-17 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 3e-16 | |
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 5e-16 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 4e-14 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 1e-13 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 1e-06 |
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Archaeal homoheptameric Sm protein species: Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]
Score = 75.1 bits (185), Expect = 1e-20
Identities = 23/64 (35%), Positives = 37/64 (57%)
Query: 10 FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNV 69
+ + PV+V+L G ++RG L D +MN+ L EE NG++ K G IRG+ V
Sbjct: 7 VLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTV 66
Query: 70 LYIS 73
+++S
Sbjct: 67 VFVS 70
|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.94 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.93 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.93 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.93 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.92 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.92 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.91 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.91 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.89 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.89 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.85 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.85 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.82 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 96.9 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 96.9 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 96.89 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 96.56 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 96.51 | |
| d1ib8a1 | 74 | Hypothetical protein SP14.3 (SP0552) {Streptococcu | 93.75 | |
| d2qqra1 | 59 | Jumonji domain-containing protein 2A {Human (Homo | 84.78 |
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Archaeal homoheptameric Sm protein species: Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]
Probab=99.94 E-value=7.4e-28 Score=138.64 Aligned_cols=71 Identities=32% Similarity=0.546 Sum_probs=66.9
Q ss_pred CCChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEe
Q psy10835 4 KESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIST 74 (80)
Q Consensus 4 ~~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~ 74 (80)
|..|+++|++++|++|+|+|+||++|+|+|.+||+|||++|+||+|+..++..+.+|.++|||++|++|++
T Consensus 1 p~~Pl~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~~g~~~IRG~~I~~Isp 71 (72)
T d1i4k1_ 1 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSP 71 (72)
T ss_dssp CCCHHHHHHTTTTSEEEEEEGGGCEEEEEEEEECTTCCEEEEEEEEESSSSEEEEEEEEEECGGGEEEEEC
T ss_pred CCChHHHHHHhCCCEEEEEECCCCEEEEEEEEEcCCCCeEEeeEEEEecCCeEeEcceEEEeCCeEEEEEc
Confidence 57899999999999999999999999999999999999999999998777677889999999999999975
|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|