Psyllid ID: psy10835


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRRGV
ccccccHHHHHHHHccccEEEEEcccEEEEEcEEEEEEEEEEEEccEEEEEccEEEcccccEEEEcccEEEEEEcccccc
cccccccHHHHHHHcccEEEEEEccccEEEEEEEEEcccccEEEEEEEEEEccEEEEEEEEEEEcHHHEEEEEEcccccc
MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLknkygdtfirgnnvlyistqkrrgv
msrkeslsqfiqqihgrpvvVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNkygdtfirgnnvlyistqkrrgv
MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRRGV
*********FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIS*******
******L***IQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLY**TQ*****
*********FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRRGV
***KESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRRGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
P6231380 U6 snRNA-associated Sm-li yes N/A 0.95 0.95 0.855 2e-32
P6231280 U6 snRNA-associated Sm-li yes N/A 0.95 0.95 0.855 2e-32
B0DWN399 U6 snRNA-associated Sm-li N/A N/A 0.887 0.717 0.661 7e-23
Q552U188 Probable U6 snRNA-associa yes N/A 0.862 0.784 0.681 1e-21
Q9UUI175 U6 snRNA-associated Sm-li yes N/A 0.862 0.92 0.623 2e-21
Q4PG7185 U6 snRNA-associated Sm-li N/A N/A 0.95 0.894 0.592 1e-20
A6R36380 U6 snRNA-associated Sm-li N/A N/A 0.925 0.925 0.594 7e-20
A1DM2780 U6 snRNA-associated Sm-li N/A N/A 0.85 0.85 0.647 1e-19
Q4WNI080 U6 snRNA-associated Sm-li yes N/A 0.85 0.85 0.647 2e-19
A8NHT895 U6 snRNA-associated Sm-li N/A N/A 0.887 0.747 0.661 2e-19
>sp|P62313|LSM6_MOUSE U6 snRNA-associated Sm-like protein LSm6 OS=Mus musculus GN=Lsm6 PE=3 SV=1 Back     alignment and function desciption
 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/76 (85%), Positives = 71/76 (93%)

Query: 3  RKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDT 62
          RK++ S F++QI GRPVVVKL SGVDYRGVL+CLDGYMNIALEQTEEY+NGQLKNKYGD 
Sbjct: 4  RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63

Query: 63 FIRGNNVLYISTQKRR 78
          FIRGNNVLYISTQKRR
Sbjct: 64 FIRGNNVLYISTQKRR 79




Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 di-snRNP, U4/U6.U5 tri-snRNP, and free U6 snRNP). It binds directly to the 3'-terminal U-tract of U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. LSM2-LSM8 probably also is involved degradation of nuclear pre-mRNA by targeting them for decapping, and in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA.
Mus musculus (taxid: 10090)
>sp|P62312|LSM6_HUMAN U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens GN=LSM6 PE=1 SV=1 Back     alignment and function description
>sp|B0DWN3|LSM6_LACBS U6 snRNA-associated Sm-like protein LSm6 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LSM6 PE=3 SV=1 Back     alignment and function description
>sp|Q552U1|LSM6_DICDI Probable U6 snRNA-associated Sm-like protein LSm6 OS=Dictyostelium discoideum GN=lsm6 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUI1|LSM6_SCHPO U6 snRNA-associated Sm-like protein LSm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm6 PE=1 SV=1 Back     alignment and function description
>sp|Q4PG71|LSM6_USTMA U6 snRNA-associated Sm-like protein LSm6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LSM6 PE=3 SV=2 Back     alignment and function description
>sp|A6R363|LSM6_AJECN U6 snRNA-associated Sm-like protein LSm6 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=LSM6 PE=3 SV=1 Back     alignment and function description
>sp|A1DM27|LSM6_NEOFI U6 snRNA-associated Sm-like protein LSm6 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lsm6 PE=3 SV=2 Back     alignment and function description
>sp|Q4WNI0|LSM6_ASPFU U6 snRNA-associated Sm-like protein LSm6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lsm6 PE=3 SV=2 Back     alignment and function description
>sp|A8NHT8|LSM6_COPC7 U6 snRNA-associated Sm-like protein LSm6 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LSM6 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
24202106579 membrane-associated protein, putative [P 0.975 0.987 0.935 8e-36
11074992479 PREDICTED: u6 snRNA-associated Sm-like p 0.975 0.987 0.923 2e-35
15655074180 PREDICTED: U6 snRNA-associated Sm-like p 0.975 0.975 0.923 2e-35
332023213 608 U6 snRNA-associated Sm-like protein LSm6 0.975 0.128 0.910 2e-35
30719520579 U6 snRNA-associated Sm-like protein LSm6 0.975 0.987 0.923 2e-35
35762516379 putative membrane-associated protein [Da 0.975 0.987 0.923 3e-35
32869710080 PREDICTED: u6 snRNA-associated Sm-like p 1.0 1.0 0.875 3e-35
30718408079 U6 snRNA-associated Sm-like protein LSm6 0.975 0.987 0.910 5e-35
5838709879 AGAP005314-PA [Anopheles gambiae str. PE 0.975 0.987 0.910 7e-35
9108230579 PREDICTED: similar to AGAP005314-PA [Tri 0.975 0.987 0.897 2e-34
>gi|242021065|ref|XP_002430967.1| membrane-associated protein, putative [Pediculus humanus corporis] gi|212516187|gb|EEB18229.1| membrane-associated protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/78 (93%), Positives = 76/78 (97%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
          MSRKE+LSQFIQQIHGRPVVVKL SGVDYRGVL+CLDGYMNIALEQTEEY+NGQLKNKYG
Sbjct: 1  MSRKEALSQFIQQIHGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYG 60

Query: 61 DTFIRGNNVLYISTQKRR 78
          D FIRGNNVLYISTQKRR
Sbjct: 61 DAFIRGNNVLYISTQKRR 78




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|110749924|ref|XP_001121733.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like [Apis mellifera] gi|350419231|ref|XP_003492114.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Bombus impatiens] gi|380023576|ref|XP_003695594.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Apis florea] gi|383861934|ref|XP_003706439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156550741|ref|XP_001606104.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332023213|gb|EGI63469.1| U6 snRNA-associated Sm-like protein LSm6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307195205|gb|EFN77189.1| U6 snRNA-associated Sm-like protein LSm6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357625163|gb|EHJ75691.1| putative membrane-associated protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|328697100|ref|XP_003240231.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 1 [Acyrthosiphon pisum] gi|328697102|ref|XP_003240232.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307184080|gb|EFN70615.1| U6 snRNA-associated Sm-like protein LSm6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|58387098|ref|XP_315329.2| AGAP005314-PA [Anopheles gambiae str. PEST] gi|170059581|ref|XP_001865425.1| Lsm6 protein [Culex quinquefasciatus] gi|55238130|gb|EAA11294.2| AGAP005314-PA [Anopheles gambiae str. PEST] gi|167878291|gb|EDS41674.1| Lsm6 protein [Culex quinquefasciatus] gi|312381097|gb|EFR26918.1| hypothetical protein AND_25803 [Anopheles darlingi] gi|403182446|gb|EJY57393.1| AAEL017161-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91082305|ref|XP_974175.1| PREDICTED: similar to AGAP005314-PA [Tribolium castaneum] gi|270007198|gb|EFA03646.1| hypothetical protein TcasGA2_TC013740 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
FB|FBgn003456479 CG9344 [Drosophila melanogaste 0.975 0.987 0.884 2e-33
UNIPROTKB|P6231280 LSM6 "U6 snRNA-associated Sm-l 0.95 0.95 0.855 8.8e-31
MGI|MGI:192590180 Lsm6 "LSM6 homolog, U6 small n 0.95 0.95 0.855 8.8e-31
ZFIN|ZDB-GENE-040625-5080 lsm6 "LSM6 homolog, U6 small n 0.95 0.95 0.815 6.2e-30
WB|WBGene0000308077 lsm-6 [Caenorhabditis elegans 0.962 1.0 0.714 4.5e-27
TAIR|locus:208048791 LSM6A "AT3G59810" [Arabidopsis 0.837 0.736 0.820 1.9e-26
TAIR|locus:204396991 LSM6B "AT2G43810" [Arabidopsis 0.862 0.758 0.768 4e-26
DICTYBASE|DDB_G027571988 lsm6 "putative U6 small nuclea 0.862 0.784 0.681 1.5e-21
POMBASE|SPAC2F3.17c75 lsm6 "U6 snRNP-associated prot 0.85 0.906 0.632 2.4e-21
GENEDB_PFALCIPARUM|PF13_014277 PF13_0142 "u6 snRNA-associated 0.837 0.870 0.582 3.6e-18
FB|FBgn0034564 CG9344 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 69/78 (88%), Positives = 73/78 (93%)

Query:     1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
             MSRKE+LSQFI QIHGRPV VKL +GVDYRGVL+CLDGYMNI LEQTEEY+NGQLKNKYG
Sbjct:     1 MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYG 60

Query:    61 DTFIRGNNVLYISTQKRR 78
             D FIRGNNVLYISTQKRR
Sbjct:    61 DAFIRGNNVLYISTQKRR 78




GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0005688 "U6 snRNP" evidence=NAS
UNIPROTKB|P62312 LSM6 "U6 snRNA-associated Sm-like protein LSm6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1925901 Lsm6 "LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-50 lsm6 "LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00003080 lsm-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2080487 LSM6A "AT3G59810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043969 LSM6B "AT2G43810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275719 lsm6 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC2F3.17c lsm6 "U6 snRNP-associated protein Lsm6 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0142 PF13_0142 "u6 snRNA-associated sm-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6BR90LSM6_DEBHANo assigned EC number0.51380.90.8470yesN/A
P57670RUXX_THEACNo assigned EC number0.38090.78750.7590yesN/A
P0CR24LSM6_CRYNJNo assigned EC number0.57970.86250.7840yesN/A
Q465S1RUXX_METBFNo assigned EC number0.40350.71250.7916yesN/A
A5DRQ6LSM6_LODELNo assigned EC number0.52560.91250.9125N/AN/A
O26745RUXX_METTHNo assigned EC number0.40350.71250.7037yesN/A
Q06406LSM6_YEASTNo assigned EC number0.41090.86250.8023yesN/A
A4RQ29LSM6_MAGO7No assigned EC number0.56710.83750.8072N/AN/A
Q552U1LSM6_DICDINo assigned EC number0.68110.86250.7840yesN/A
A1DM27LSM6_NEOFINo assigned EC number0.64700.850.85N/AN/A
O29386RUXX_ARCFUNo assigned EC number0.38980.73750.7662yesN/A
Q2HAN0LSM6_CHAGBNo assigned EC number0.61760.850.8292N/AN/A
Q4WNI0LSM6_ASPFUNo assigned EC number0.64700.850.85yesN/A
Q9UUI1LSM6_SCHPONo assigned EC number0.62310.86250.92yesN/A
Q97BU5RUXX_THEVONo assigned EC number0.350.750.7228yesN/A
Q75BR7LSM6_ASHGONo assigned EC number0.44440.850.8yesN/A
Q12U30RUXX_METBUNo assigned EC number0.41070.70.7777yesN/A
Q8TL47RUXX_METACNo assigned EC number0.38590.71250.7916yesN/A
A7UXE4LSM6_NEUCRNo assigned EC number0.58100.9250.9024N/AN/A
Q6CPS7LSM6_KLULANo assigned EC number0.39740.9250.925yesN/A
Q1DRN0LSM6_COCIMNo assigned EC number0.60290.850.85N/AN/A
C6A1T2RUXX_THESMNo assigned EC number0.41370.7250.7631yesN/A
A1CE19LSM6_ASPCLNo assigned EC number0.61190.83750.8589N/AN/A
Q0W8R9RUXX_UNCMANo assigned EC number0.36840.71250.7916yesN/A
Q8PZZ9RUXX_METMANo assigned EC number0.38590.71250.7916yesN/A
A6R363LSM6_AJECNNo assigned EC number0.59450.9250.925N/AN/A
P62312LSM6_HUMANNo assigned EC number0.85520.950.95yesN/A
P62313LSM6_MOUSENo assigned EC number0.85520.950.95yesN/A
O74016RUXX_PYRHONo assigned EC number0.38330.750.8yesN/A
Q4PG71LSM6_USTMANo assigned EC number0.59210.950.8941N/AN/A
Q6FYB6LSM6_CANGANo assigned EC number0.46750.91250.9240yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
cd0172668 cd01726, LSm6, Like-Sm protein 6 5e-38
cd0172269 cd01722, Sm_F, Sm protein F 6e-22
pfam0142366 pfam01423, LSM, LSM domain 1e-16
smart0065167 smart00651, Sm, snRNP Sm proteins 2e-16
cd0173169 cd01731, archaeal_Sm1, archaeal Sm protein 1 3e-15
PRK0073772 PRK00737, PRK00737, small nuclear ribonucleoprotei 3e-14
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 6e-12
cd0060063 cd00600, Sm_like, Sm and related proteins 2e-10
cd0172376 cd01723, LSm4, Like-Sm protein 4 4e-06
cd0173378 cd01733, LSm10, Like-Sm protein 10 2e-05
cd0171970 cd01719, Sm_G, Sm protein G 3e-05
cd1167869 cd11678, archaeal_LSm, archaeal Like-Sm protein 5e-05
cd0172589 cd01725, LSm2, Like-Sm protein 2 0.002
cd0172874 cd01728, LSm1, Like-Sm protein 1 0.002
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information
 Score =  120 bits (304), Expect = 5e-38
 Identities = 48/66 (72%), Positives = 59/66 (89%)

Query: 8  SQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGN 67
          S+F+++I G+PVVVKL +GV+YRGVL+CLDGYMN+ LE TEEY++GQL  KYGD FIRGN
Sbjct: 3  SKFLKKIIGKPVVVKLKNGVEYRGVLACLDGYMNLVLEDTEEYVDGQLVAKYGDAFIRGN 62

Query: 68 NVLYIS 73
          NVLYIS
Sbjct: 63 NVLYIS 68


The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm657 is believed to be an assembly intermediate for both the LSm1-7 and LSm2-8 rings. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 68

>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 Back     alignment and domain information
>gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|212470 cd01723, LSm4, Like-Sm protein 4 Back     alignment and domain information
>gnl|CDD|212480 cd01733, LSm10, Like-Sm protein 10 Back     alignment and domain information
>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
>gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein Back     alignment and domain information
>gnl|CDD|212472 cd01725, LSm2, Like-Sm protein 2 Back     alignment and domain information
>gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.93
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.93
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.92
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.92
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.92
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.91
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.91
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.91
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.89
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.88
KOG1783|consensus77 99.88
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
KOG3482|consensus79 99.88
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.87
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.87
KOG1780|consensus77 99.86
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.86
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.84
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.83
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.83
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.79
KOG3460|consensus91 99.73
KOG3293|consensus134 99.73
KOG1775|consensus84 99.67
KOG1781|consensus108 99.63
KOG3448|consensus96 99.61
KOG3172|consensus119 99.52
KOG3168|consensus177 99.47
KOG1782|consensus129 99.46
KOG1774|consensus88 99.44
KOG3428|consensus109 99.41
KOG1784|consensus96 99.41
KOG3459|consensus114 98.79
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 98.24
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 98.19
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 97.35
PRK0039579 hfq RNA-binding protein Hfq; Provisional 97.06
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 96.93
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 96.89
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 96.87
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 96.48
PF06372166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 96.18
COG192377 Hfq Uncharacterized host factor I protein [General 96.12
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 95.66
PRK14091165 RNA-binding protein Hfq; Provisional 95.64
PRK14638150 hypothetical protein; Provisional 95.04
PRK14639140 hypothetical protein; Provisional 94.92
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 94.87
PRK02001152 hypothetical protein; Validated 94.45
PRK14091165 RNA-binding protein Hfq; Provisional 94.24
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 93.72
PRK14644136 hypothetical protein; Provisional 92.55
PRK14642197 hypothetical protein; Provisional 92.39
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 91.76
PRK14640152 hypothetical protein; Provisional 91.52
PRK14633150 hypothetical protein; Provisional 91.41
KOG1073|consensus 361 91.41
PRK14645154 hypothetical protein; Provisional 91.12
COG0779153 Uncharacterized protein conserved in bacteria [Fun 90.8
PRK14643164 hypothetical protein; Provisional 90.75
PRK00092154 ribosome maturation protein RimP; Reviewed 90.49
PRK14636176 hypothetical protein; Provisional 90.3
PF02576141 DUF150: Uncharacterised BCR, YhbC family COG0779; 90.04
PRK14632172 hypothetical protein; Provisional 90.02
PRK14634155 hypothetical protein; Provisional 89.79
PRK14646155 hypothetical protein; Provisional 89.37
PRK14647159 hypothetical protein; Provisional 88.71
PRK14637151 hypothetical protein; Provisional 87.95
PRK06955300 biotin--protein ligase; Provisional 87.87
PRK14631174 hypothetical protein; Provisional 87.18
PRK14641173 hypothetical protein; Provisional 86.04
PRK13325 592 bifunctional biotin--[acetyl-CoA-carboxylase] liga 86.03
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 83.63
PRK14630143 hypothetical protein; Provisional 81.51
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
Probab=99.93  E-value=1e-26  Score=136.16  Aligned_cols=70  Identities=34%  Similarity=0.610  Sum_probs=65.4

Q ss_pred             CChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEe
Q psy10835          5 ESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIST   74 (80)
Q Consensus         5 ~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~   74 (80)
                      ..|+++|+++++++|.|+|+||++|+|+|.+||+|||++|+||.|..+++..+.+|.++|||++|++|.+
T Consensus         3 ~~P~~~L~~~~~k~V~V~lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~~~~~~~lg~v~iRG~~V~~i~~   72 (72)
T PRK00737          3 QRPLDVLNNALNSPVLVRLKGGREFRGELQGYDIHMNLVLDNAEEIQDGEVVRKLGKVVIRGDNVVYVSP   72 (72)
T ss_pred             cchHHHHHHhCCCEEEEEECCCCEEEEEEEEEcccceeEEeeEEEEcCCCeEeEcCcEEEeCCEEEEEcC
Confidence            5899999999999999999999999999999999999999999997666667789999999999999963



>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>KOG1783|consensus Back     alignment and domain information
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3482|consensus Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>KOG1780|consensus Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>KOG3460|consensus Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG1775|consensus Back     alignment and domain information
>KOG1781|consensus Back     alignment and domain information
>KOG3448|consensus Back     alignment and domain information
>KOG3172|consensus Back     alignment and domain information
>KOG3168|consensus Back     alignment and domain information
>KOG1782|consensus Back     alignment and domain information
>KOG1774|consensus Back     alignment and domain information
>KOG3428|consensus Back     alignment and domain information
>KOG1784|consensus Back     alignment and domain information
>KOG3459|consensus Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PRK14642 hypothetical protein; Provisional Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>KOG1073|consensus Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>PRK14637 hypothetical protein; Provisional Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information
>PRK14641 hypothetical protein; Provisional Back     alignment and domain information
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>PRK14630 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3swn_B77 Structure Of The Lsm657 Complex: An Assembly Interm 6e-23
4emk_B75 Crystal Structure Of Splsm567 Length = 75 1e-21
3cw1_F86 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 5e-14
1loj_A87 Crystal Structure Of A Methanobacterial Sm-Like Arc 1e-08
1jbm_A86 Heptameric Crystal Structure Of Mth649, An Sm-Like 1e-08
1jri_A85 The Crystal Structure Of An Sm-Like Archaeal Protei 1e-08
1i81_A83 Crystal Structure Of A Heptameric Lsm Protein From 2e-08
1i5l_A77 Crystal Structure Of An Sm-Like Protein (Af-Sm1) Fr 3e-07
1n9s_A93 Crystal Structure Of Yeast Smf In Spacegroup P43212 4e-07
1n9r_A93 Crystal Structure Of A Heptameric Ring Complex Of Y 8e-07
1i8f_A81 The Crystal Structure Of A Heptameric Archaeal Sm P 2e-06
1h64_175 Crystal Structure Of The Sm-Related Protein Of P. A 6e-05
1m8v_A77 Structure Of Pyrococcus Abyssii Sm Protein In Compl 6e-05
1th7_A81 Crystal Structure Of An Archaeal Sm Protein From Su 7e-04
4emh_A105 Crystal Structure Of Splsm4 Length = 105 8e-04
>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 77 Back     alignment and structure

Iteration: 1

Score = 102 bits (254), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 44/74 (59%), Positives = 60/74 (81%) Query: 1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60 M S ++F+ ++ G+ V+++L SGVDY+G+LSCLDGYMN+ALE+TEEY+NG+ N YG Sbjct: 1 MGMDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYG 60 Query: 61 DTFIRGNNVLYIST 74 D FIRGNNVLY+S Sbjct: 61 DAFIRGNNVLYVSA 74
>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567 Length = 75 Back     alignment and structure
>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 86 Back     alignment and structure
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump) Length = 87 Back     alignment and structure
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like Archaeal Protein From Methanobacterium Thermautotrophicum Length = 86 Back     alignment and structure
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein With Two Heptamers In The Asymmetric Unit. Length = 85 Back     alignment and structure
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From Methanobacterium Thermoautotrophicum Length = 83 Back     alignment and structure
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From Archaeoglobus Fulgidus Complexed With Short Poly-U Rna Length = 77 Back     alignment and structure
>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212 Length = 93 Back     alignment and structure
>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast Smf In Spacegroup P4122 Length = 93 Back     alignment and structure
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm Protein: Implications For The Eukaryotic Snrnp Core Length = 81 Back     alignment and structure
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi The Biological Unit Is A Heptamer Length = 75 Back     alignment and structure
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex With A Uridine Heptamer Length = 77 Back     alignment and structure
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From Sulfolobus Solfataricus Length = 81 Back     alignment and structure
>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4 Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 6e-27
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 2e-26
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 2e-26
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 3e-26
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 5e-26
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 2e-25
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 1e-24
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 3e-24
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 8e-22
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 2e-21
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 7e-20
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 5e-17
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 5e-17
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 2e-15
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 2e-15
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 6e-13
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 1e-10
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 2e-10
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 2e-10
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 4e-10
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 5e-08
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 2e-04
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
 Score = 92.9 bits (231), Expect = 6e-27
 Identities = 35/76 (46%), Positives = 48/76 (63%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
          MS   +   F+  + G+PV+VKL  G++Y+G L  +DGYMN+ L  TEEYI+G L    G
Sbjct: 1  MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG 60

Query: 61 DTFIRGNNVLYISTQK 76
          +  IR NNVLYI   +
Sbjct: 61 EVLIRCNNVLYIRGVE 76


>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Length = 75 Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.96
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.94
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.94
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.93
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.93
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.93
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.93
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.93
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.93
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.93
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.92
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.92
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.92
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.91
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.9
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.9
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.9
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.9
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.89
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.89
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.87
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.86
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.85
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.83
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 99.14
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 97.63
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 97.58
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 97.55
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 97.42
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 97.28
1ycy_A71 Conserved hypothetical protein; structural genomic 97.26
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 96.97
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 96.88
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 96.69
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 96.62
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 96.29
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 96.24
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 96.21
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 96.2
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 95.32
1ib8_A164 Conserved protein SP14.3; nucleic acid binding pro 91.38
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 91.18
3rux_A270 BIRA bifunctional protein; biotin-protein ligase, 89.7
1bia_A321 BIRA bifunctional protein; transcription regulatio 87.82
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monom 87.52
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 87.08
2rm4_A103 CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- 86.97
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
Probab=99.96  E-value=2.7e-29  Score=150.65  Aligned_cols=78  Identities=45%  Similarity=0.787  Sum_probs=71.2

Q ss_pred             CCCCCChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEeeccc
Q psy10835          1 MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKRR   78 (80)
Q Consensus         1 m~~~~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~~~~~   78 (80)
                      ||++..|+++|++++|++|+|+|+||++|+|+|.|||+|||++|+||+|+.+++..+.+|.++|||++|++|++++..
T Consensus         1 ms~~~~P~~~L~~~~~k~V~V~Lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~g~~~~~lg~v~IRG~nI~~i~~~d~~   78 (86)
T 3s6n_F            1 MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE   78 (86)
T ss_dssp             --CCCCHHHHHHHHTTSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEETTEEEEEESSEEECGGGEEEEEECC--
T ss_pred             CCcCcCcHHHHHHhCCCeEEEEEcCCeEEEEEEEEEcCceEEEEeeEEEEcCCceeeEccEEEEeCCeEEEEEeCCcc
Confidence            899999999999999999999999999999999999999999999999987777778899999999999999998754



>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 1e-20
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 1e-19
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-19
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 2e-19
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 9e-19
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 7e-18
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 2e-17
d1b34a_80 b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s 2e-17
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 3e-16
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 5e-16
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 4e-14
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 1e-13
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 1e-06
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]
 Score = 75.1 bits (185), Expect = 1e-20
 Identities = 23/64 (35%), Positives = 37/64 (57%)

Query: 10 FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNV 69
           + +    PV+V+L  G ++RG L   D +MN+ L   EE  NG++  K G   IRG+ V
Sbjct: 7  VLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTV 66

Query: 70 LYIS 73
          +++S
Sbjct: 67 VFVS 70


>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.94
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.93
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.93
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.93
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.92
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.92
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.91
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.91
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.89
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.89
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.85
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.85
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.82
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 96.9
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 96.9
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 96.89
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 96.56
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 96.51
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 93.75
d2qqra159 Jumonji domain-containing protein 2A {Human (Homo 84.78
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]
Probab=99.94  E-value=7.4e-28  Score=138.64  Aligned_cols=71  Identities=32%  Similarity=0.546  Sum_probs=66.9

Q ss_pred             CCChHHHHHhhhCCceEEEecCCcccceeeeeecccchhhhhhhhhhhccEeeccccCeEEecCcEEEEEe
Q psy10835          4 KESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIST   74 (80)
Q Consensus         4 ~~~p~~~L~~~~~k~V~V~L~~g~~~~G~L~~~D~~mNivL~~~~~~~~~~~~~~~g~v~irG~~I~~I~~   74 (80)
                      |..|+++|++++|++|+|+|+||++|+|+|.+||+|||++|+||+|+..++..+.+|.++|||++|++|++
T Consensus         1 p~~Pl~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~~g~~~IRG~~I~~Isp   71 (72)
T d1i4k1_           1 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSP   71 (72)
T ss_dssp             CCCHHHHHHTTTTSEEEEEEGGGCEEEEEEEEECTTCCEEEEEEEEESSSSEEEEEEEEEECGGGEEEEEC
T ss_pred             CCChHHHHHHhCCCEEEEEECCCCEEEEEEEEEcCCCCeEEeeEEEEecCCeEeEcceEEEeCCeEEEEEc
Confidence            57899999999999999999999999999999999999999999998777677889999999999999975



>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure