Psyllid ID: psy10839

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MRCCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKFKDRITVKSTHRKLQ
cccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHcccccccccccccccHHccccEEEEccHHHHHHHHHHccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccc
ccccHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccccccccHHHHHHHHHccccccccccEccccHHHHccEEEEccHHHHHHHHHHccccHHHHHHHHHcccccHccccHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccEEEEccHHHcc
mrcceevwggflfegkKSVLFLCrdnymrspMIKSLFKEMLAMANQTNEWIVESAgigwwdvgkgmdprakercemygldTEHVVREItkddfykfdyiiatdetdlsflrleappdssaQLVKLGTFtrkakfqgpsdlpdpfflKTKELINALDDIIHRGYWYLRGFLdtlgievpettTLKIVTvrtspkikssTWNAWRLEMSSLQALVSRtkfkdritvksTHRKLQ
mrcceevwggflfegkksVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRkakfqgpsdlpdpfFLKTKELINALDDIIHRGYWYLRGFLDTLGievpetttlkivtvrtspkiksstwnaWRLEMSSLqalvsrtkfkdritvksthrklq
MRCCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKFKDRITVKSTHRKLQ
**CCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLE********LVKLGTFTRKAKFQ***DLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKF**************
*************EGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAP*DSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDT**************************WNAWRLEMSSLQALVSRTKFKDRITVK*******
MRCCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKFKDRI**********
*RCCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKFKDRITVKST*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRCCEEVWGGFLFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTLGIEVPETTTLKIVTVRTSPKIKSSTWNAWRLEMSSLQALVSRTKFKDRITVKSTHRKLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
P82890155 Low molecular weight phos no N/A 0.560 0.838 0.388 1e-18
P81693158 Low molecular weight phos yes N/A 0.538 0.791 0.328 2e-18
P11064158 Low molecular weight phos yes N/A 0.538 0.791 0.320 3e-18
P82891164 Low molecular weight phos no N/A 0.538 0.762 0.356 7e-16
P41498158 Low molecular weight phos no N/A 0.547 0.803 0.300 8e-16
Q5ZKG5158 Low molecular weight phos yes N/A 0.564 0.829 0.299 2e-15
Q9D358158 Low molecular weight phos no N/A 0.547 0.803 0.300 4e-15
P24666158 Low molecular weight phos no N/A 0.551 0.810 0.305 1e-14
Q5REM7158 Low molecular weight phos yes N/A 0.551 0.810 0.298 2e-14
P53433164 Low molecular weight prot yes N/A 0.547 0.774 0.322 1e-13
>sp|P82890|PPAC1_DROME Low molecular weight phosphotyrosine protein phosphatase 1 OS=Drosophila melanogaster GN=primo-1 PE=2 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 17  KSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEM 76
           + VL +C  N  RSP+ + +  + L  AN   +  V+SA IG W VG   DPRA    + 
Sbjct: 3   RKVLMICLGNICRSPIAEVVMVDTLEKAN-VKDVEVDSAAIGGWHVGNRADPRAISTLQK 61

Query: 77  YGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQG 136
           +GL   H+VR+I K DF +FDYI   DE ++S LR  AP  S A+L+ LG F  + K + 
Sbjct: 62  HGLKCTHIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAPKGSKAELLMLGDFGLEKKNR- 120

Query: 137 PSDLPDPFFLKTKE 150
              + DP++ +  E
Sbjct: 121 --IIEDPYYERGAE 132
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|P81693|PPAC_PIG Low molecular weight phosphotyrosine protein phosphatase OS=Sus scrofa GN=ACP1 PE=1 SV=2 Back     alignment and function description
>sp|P11064|PPAC_BOVIN Low molecular weight phosphotyrosine protein phosphatase OS=Bos taurus GN=ACP1 PE=1 SV=3 Back     alignment and function description
>sp|P82891|PPAC2_DROME Low molecular weight phosphotyrosine protein phosphatase 2 OS=Drosophila melanogaster GN=primo-2 PE=1 SV=1 Back     alignment and function description
>sp|P41498|PPAC_RAT Low molecular weight phosphotyrosine protein phosphatase OS=Rattus norvegicus GN=Acp1 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZKG5|PPAC_CHICK Low molecular weight phosphotyrosine protein phosphatase OS=Gallus gallus GN=ACP1 PE=2 SV=3 Back     alignment and function description
>sp|Q9D358|PPAC_MOUSE Low molecular weight phosphotyrosine protein phosphatase OS=Mus musculus GN=Acp1 PE=1 SV=3 Back     alignment and function description
>sp|P24666|PPAC_HUMAN Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens GN=ACP1 PE=1 SV=3 Back     alignment and function description
>sp|Q5REM7|PPAC_PONAB Low molecular weight phosphotyrosine protein phosphatase OS=Pongo abelii GN=ACP1 PE=1 SV=3 Back     alignment and function description
>sp|P53433|PTPA_STRCO Low molecular weight protein-tyrosine-phosphatase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ptpA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
195109394156 GI24420 [Drosophila mojavensis] gi|19391 0.482 0.717 0.442 6e-20
195146062159 GL24448 [Drosophila persimilis] gi|19410 0.543 0.792 0.407 7e-18
195399824155 GJ14279 [Drosophila virilis] gi|19414207 0.560 0.838 0.388 7e-18
195329182155 GM25909 [Drosophila sechellia] gi|194120 0.560 0.838 0.395 1e-17
194901374155 GG17025 [Drosophila erecta] gi|190651930 0.560 0.838 0.395 1e-17
390177726137 GA16170, isoform C [Drosophila pseudoobs 0.543 0.919 0.392 2e-17
292493393178 protein-tyrosine phosphatase, low molecu 0.612 0.797 0.349 2e-17
390177724154 GA16170, isoform B [Drosophila pseudoobs 0.538 0.811 0.395 2e-17
126325813158 PREDICTED: low molecular weight phosphot 0.551 0.810 0.335 5e-17
195452990155 GK13063 [Drosophila willistoni] gi|19416 0.538 0.806 0.395 6e-17
>gi|195109394|ref|XP_001999272.1| GI24420 [Drosophila mojavensis] gi|193915866|gb|EDW14733.1| GI24420 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (64%), Gaps = 1/113 (0%)

Query: 16  KKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCE 75
           +K +L +C  N  RSP+ +++  E LA A + +  +V+SA  G W VG   DPRA    +
Sbjct: 3   QKKILMICLGNICRSPIAETVMAETLAKA-KLDSVVVDSAATGSWHVGNRADPRALSTLQ 61

Query: 76  MYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTF 128
            +GL+++H+VR+ITK DFY+FDYI   DE ++S LR  AP D  A+L+ LG F
Sbjct: 62  KHGLESKHIVRQITKQDFYEFDYIFGMDEDNMSDLRRLAPKDCKAELLMLGDF 114

Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195146062|ref|XP_002014009.1| GL24448 [Drosophila persimilis] gi|194102952|gb|EDW24995.1| GL24448 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195399824|ref|XP_002058519.1| GJ14279 [Drosophila virilis] gi|194142079|gb|EDW58487.1| GJ14279 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195329182|ref|XP_002031290.1| GM25909 [Drosophila sechellia] gi|194120233|gb|EDW42276.1| GM25909 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194901374|ref|XP_001980227.1| GG17025 [Drosophila erecta] gi|190651930|gb|EDV49185.1| GG17025 [Drosophila erecta] Back     alignment and taxonomy information
>gi|390177726|ref|XP_003736469.1| GA16170, isoform C [Drosophila pseudoobscura pseudoobscura] gi|388859168|gb|EIM52542.1| GA16170, isoform C [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|292493393|ref|YP_003528832.1| protein-tyrosine phosphatase, low molecular weight [Nitrosococcus halophilus Nc4] gi|291581988|gb|ADE16445.1| Protein-tyrosine phosphatase, low molecular weight [Nitrosococcus halophilus Nc4] Back     alignment and taxonomy information
>gi|390177724|ref|XP_001358418.2| GA16170, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859167|gb|EAL27557.2| GA16170, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|126325813|ref|XP_001364716.1| PREDICTED: low molecular weight phosphotyrosine protein phosphatase-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|195452990|ref|XP_002073589.1| GK13063 [Drosophila willistoni] gi|194169674|gb|EDW84575.1| GK13063 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
FB|FBgn0040077155 primo-1 "primo-1" [Drosophila 0.560 0.838 0.388 1.1e-18
UNIPROTKB|P81693158 ACP1 "Low molecular weight pho 0.482 0.708 0.359 2.8e-18
UNIPROTKB|P11064158 ACP1 "Low molecular weight pho 0.482 0.708 0.350 3.6e-18
ZFIN|ZDB-GENE-050327-12158 acp1 "acid phosphatase 1, solu 0.560 0.822 0.316 1.6e-17
UNIPROTKB|Q5ZKG5158 ACP1 "Low molecular weight pho 0.560 0.822 0.301 2.3e-16
RGD|2020158 Acp1 "acid phosphatase 1, solu 0.491 0.721 0.327 4.7e-16
FB|FBgn0040076164 primo-2 "primo-2" [Drosophila 0.538 0.762 0.356 6e-16
FB|FBgn0051469164 CG31469 [Drosophila melanogast 0.568 0.804 0.316 7.7e-16
MGI|MGI:87881158 Acp1 "acid phosphatase 1, solu 0.491 0.721 0.327 1.3e-15
WB|WBGene00022379164 Y94H6A.7 [Caenorhabditis elega 0.655 0.926 0.312 1.3e-15
FB|FBgn0040077 primo-1 "primo-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 1.1e-18, P = 1.1e-18
 Identities = 52/134 (38%), Positives = 75/134 (55%)

Query:    17 KSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEM 76
             + VL +C  N  RSP+ + +  + L  AN   +  V+SA IG W VG   DPRA    + 
Sbjct:     3 RKVLMICLGNICRSPIAEVVMVDTLEKAN-VKDVEVDSAAIGGWHVGNRADPRAISTLQK 61

Query:    77 YGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQG 136
             +GL   H+VR+I K DF +FDYI   DE ++S LR  AP  S A+L+ LG F  + K + 
Sbjct:    62 HGLKCTHIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAPKGSKAELLMLGDFGLEKKNR- 120

Query:   137 PSDLPDPFFLKTKE 150
                + DP++ +  E
Sbjct:   121 --IIEDPYYERGAE 132
GO:0004725 "protein tyrosine phosphatase activity" evidence=ISS;NAS
GO:0006470 "protein dephosphorylation" evidence=ISS;NAS
GO:0005737 "cytoplasm" evidence=IEA;NAS
GO:0003993 "acid phosphatase activity" evidence=IEA;ISS
GO:0004726 "non-membrane spanning protein tyrosine phosphatase activity" evidence=IEA
UNIPROTKB|P81693 ACP1 "Low molecular weight phosphotyrosine protein phosphatase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P11064 ACP1 "Low molecular weight phosphotyrosine protein phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050327-12 acp1 "acid phosphatase 1, soluble" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKG5 ACP1 "Low molecular weight phosphotyrosine protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2020 Acp1 "acid phosphatase 1, soluble" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0040076 primo-2 "primo-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051469 CG31469 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:87881 Acp1 "acid phosphatase 1, soluble" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00022379 Y94H6A.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd00115141 cd00115, LMWPc, Low molecular weight phosphatase f 5e-28
COG0394139 COG0394, Wzb, Protein-tyrosine-phosphatase [Signal 3e-21
pfam01451138 pfam01451, LMWPc, Low molecular weight phosphotyro 2e-20
smart00226134 smart00226, LMWPc, Low molecular weight phosphatas 2e-18
PRK10126147 PRK10126, PRK10126, tyrosine phosphatase; Provisio 1e-07
PRK11391144 PRK11391, etp, phosphotyrosine-protein phosphatase 6e-05
PRK13530133 PRK13530, PRK13530, arsenate reductase; Provisiona 0.002
>gnl|CDD|238063 cd00115, LMWPc, Low molecular weight phosphatase family; Back     alignment and domain information 
 Score =  103 bits (258), Expect = 5e-28
 Identities = 48/129 (37%), Positives = 72/129 (55%), Gaps = 12/129 (9%)

Query: 17  KSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEM 76
           K VLF+C  N  RSPM +++F+ +        +  V+SAG   W VG   DPRA      
Sbjct: 1   KKVLFVCTGNICRSPMAEAIFRHLAP----KLDIEVDSAGTSGWHVGGRPDPRAIAVLAE 56

Query: 77  YGLD-TEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQ 135
           +G+D + H  R++T+DDF +FD II  DE++L+ L  E PP   A++  LG +       
Sbjct: 57  HGIDISGHRARQLTEDDFDEFDLIITMDESNLAELL-EPPPGGRAKVELLGEYA------ 109

Query: 136 GPSDLPDPF 144
           G  ++PDP+
Sbjct: 110 GDREVPDPY 118

Length = 141
>gnl|CDD|223471 COG0394, Wzb, Protein-tyrosine-phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|201802 pfam01451, LMWPc, Low molecular weight phosphotyrosine protein phosphatase Back     alignment and domain information
>gnl|CDD|197586 smart00226, LMWPc, Low molecular weight phosphatase family Back     alignment and domain information
>gnl|CDD|182256 PRK10126, PRK10126, tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|138553 PRK11391, etp, phosphotyrosine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237415 PRK13530, PRK13530, arsenate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG3217|consensus159 100.0
PRK11391144 etp phosphotyrosine-protein phosphatase; Provision 100.0
PRK10126147 tyrosine phosphatase; Provisional 100.0
COG0394139 Wzb Protein-tyrosine-phosphatase [Signal transduct 100.0
PF01451138 LMWPc: Low molecular weight phosphotyrosine protei 100.0
smart00226140 LMWPc Low molecular weight phosphatase family. 100.0
cd00115141 LMWPc Substituted updates: Aug 22, 2001 100.0
PRK13530133 arsenate reductase; Provisional 100.0
TIGR02689126 ars_reduc_gluta arsenate reductase, glutathione/gl 100.0
TIGR02691129 arsC_pI258_fam arsenate reductase (thioredoxin). T 100.0
COG4551109 Predicted protein tyrosine phosphatase [General fu 99.53
KOG2424|consensus195 96.26
COG341493 SgaB Phosphotransferase system, galactitol-specifi 95.51
COG5211197 SSU72 RNA polymerase II-interacting protein involv 94.39
PF04722195 Ssu72: Ssu72-like protein; InterPro: IPR006811 The 93.69
cd0556996 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of 93.58
PRK09590104 celB cellobiose phosphotransferase system IIB comp 93.21
PRK09548602 PTS system ascorbate-specific transporter subunits 92.23
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 91.55
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 91.4
PRK1031094 PTS system galactitol-specific transporter subunit 91.16
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 91.02
PRK10499106 PTS system N,N'-diacetylchitobiose-specific transp 90.3
TIGR0082985 FRU PTS system, fructose-specific, IIB component. 88.29
cd0556787 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of 86.19
PRK10427114 putative PTS system fructose-like transporter subu 85.96
cd0298077 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferr 84.7
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 84.03
COG1445122 FrwB Phosphotransferase system fructose-specific c 83.55
PRK05647200 purN phosphoribosylglycinamide formyltransferase; 82.51
PRK11404 482 putative PTS system transporter subunits IIBC; Pro 81.87
cd0013384 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is 81.85
>KOG3217|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-44  Score=289.16  Aligned_cols=154  Identities=31%  Similarity=0.596  Sum_probs=145.4

Q ss_pred             cccCCCeEEEEcCCCchHHHHHHHHHHHHHHhcCCCCcEEEEEeeeccCCCCCCCCHHHHHHHHHcCCCCCCceeccCcc
Q psy10839         12 LFEGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKD   91 (232)
Q Consensus        12 ~~~~~~~ILFVCtgNicRSpmAEailr~l~~~~gl~~~i~V~SAG~~~~~~G~~~dp~Ai~vL~e~GIdl~hrsr~lt~~   91 (232)
                      ..|.+.+|||||.||||||||||++|+++++++|+...|.|+||||+.||+|++|||+++.+|++|||.+.|.+|+++.+
T Consensus         2 ~e~~~~svlFvclGNiCRSP~AEaVFr~~v~K~~l~~~~~iDSagt~~yh~G~~PD~R~~s~lK~hGI~~~H~aRqit~~   81 (159)
T KOG3217|consen    2 AEQATKSVLFVCLGNICRSPIAEAVFRDLVKKRNLSEEWHIDSAGTSGYHTGRSPDPRTLSILKKHGIKIDHLARQITTS   81 (159)
T ss_pred             CcccceEEEEEEecccccCHHHHHHHHHHHHHcCcceeeeeccccccccccCCCCChHHHHHHHHcCCcchhhcccccHh
Confidence            35778899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCccEEEEecCCcHHHHHH---hCCCCCCccEEEecccccccCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHHHHHH
Q psy10839         92 DFYKFDYIIATDETDLSFLRL---EAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRG  168 (232)
Q Consensus        92 dl~~aDlII~Md~~~~~~L~~---~~P~~~~~Kv~ll~~f~~~~~~~~~~dIpDP~~~~~~~~fe~~~~~~~~I~~~v~~  168 (232)
                      |+.+||||++||++|.++|.+   ..|....+||.||++|+..    ....|+||||++... |+.+   |+||.+.|++
T Consensus        82 DF~~FDYI~~MDesN~~dL~~~a~~~~~~~kakV~Llgsy~~~----~~~~I~DPyYg~~~~-Fe~v---y~qi~~~c~~  153 (159)
T KOG3217|consen   82 DFREFDYILAMDESNLRDLLRKASNQPKGSKAKVLLLGSYDKN----GQKIIEDPYYGGDSK-FETV---YQQIVDCCKA  153 (159)
T ss_pred             HhhhcceeEEecHHHHHHHHHHhccCCCCcceEEEEeeccCCC----CCeecCCCCCCcccc-HHHH---HHHHHHHHHH
Confidence            999999999999999999988   5676678999999999986    378899999999999 9999   9999999999


Q ss_pred             HHHHH
Q psy10839        169 FLDTL  173 (232)
Q Consensus       169 ll~~L  173 (232)
                      |+...
T Consensus       154 ~l~s~  158 (159)
T KOG3217|consen  154 FLKSI  158 (159)
T ss_pred             HHHhc
Confidence            98753

>PRK11391 etp phosphotyrosine-protein phosphatase; Provisional Back     alignment and domain information
>PRK10126 tyrosine phosphatase; Provisional Back     alignment and domain information
>COG0394 Wzb Protein-tyrosine-phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF01451 LMWPc: Low molecular weight phosphotyrosine protein phosphatase; InterPro: IPR023485 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>smart00226 LMWPc Low molecular weight phosphatase family Back     alignment and domain information
>cd00115 LMWPc Substituted updates: Aug 22, 2001 Back     alignment and domain information
>PRK13530 arsenate reductase; Provisional Back     alignment and domain information
>TIGR02689 ars_reduc_gluta arsenate reductase, glutathione/glutaredoxin type Back     alignment and domain information
>TIGR02691 arsC_pI258_fam arsenate reductase (thioredoxin) Back     alignment and domain information
>COG4551 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG2424|consensus Back     alignment and domain information
>COG3414 SgaB Phosphotransferase system, galactitol-specific IIB component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5211 SSU72 RNA polymerase II-interacting protein involved in transcription start site selection [Transcription] Back     alignment and domain information
>PF04722 Ssu72: Ssu72-like protein; InterPro: IPR006811 The highly conserved and essential protein Ssu72 has intrinsic phosphatase activity and plays an essential role in the transcription cycle Back     alignment and domain information
>cd05569 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>PRK09548 PTS system ascorbate-specific transporter subunits IICB; Provisional Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK10310 PTS system galactitol-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>PRK10499 PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>TIGR00829 FRU PTS system, fructose-specific, IIB component Back     alignment and domain information
>cd05567 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK10427 putative PTS system fructose-like transporter subunit EIIB; Provisional Back     alignment and domain information
>cd02980 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE) Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>PRK11404 putative PTS system transporter subunits IIBC; Provisional Back     alignment and domain information
>cd00133 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1dg9_A157 Crystal Structure Of Bovine Low Molecular Weight Pt 2e-19
1c0e_A157 Active Site S19a Mutant Of Bovine Heart Phosphotyro 5e-19
1xww_A157 Crystal Structure Of Human B-Form Low Molecular Wei 7e-19
2p4u_A168 Crystal Structure Of Acid Phosphatase 1 (Acp1) From 2e-18
5pnt_A157 Crystal Structure Of A Human Low Molecular Weight P 7e-16
2cwd_A161 Crystal Structure Of Tt1001 Protein From Thermus Th 3e-14
1p8a_A146 Solution Structure Of The Low Molecular Weight Prot 6e-14
1d1p_A160 Crystal Structure Of A Yeast Low Molecular Weight P 2e-13
4etm_A173 Crystal Structure Of Yfkj From Bacillus Subtilis Le 4e-13
1d2a_A160 Crystal Structure Of A Yeast Low Molecular Weight P 3e-12
1d1q_A161 Crystal Structure Of A Yeast Low Molecular Weight P 3e-12
3ido_A178 Crystal Structure Of Protein Tyrosine Phosphatase F 1e-11
3jvi_A161 Product State Mimic Crystal Structure Of Protein Ty 1e-11
3rof_A158 Crystal Structure Of The S. Aureus Protein Tyrosine 3e-09
2luo_A164 Nmr Solution Structure Of Apo-Mptpa Length = 164 2e-07
1u2p_A163 Crystal Structure Of Mycobacterium Tuberculosis Low 2e-07
2gi4_A156 Solution Structure Of The Low Molecular Weight Prot 6e-07
>pdb|1DG9|A Chain A, Crystal Structure Of Bovine Low Molecular Weight Ptpase Complexed With Hepes Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 80/131 (61%), Gaps = 6/131 (4%)
Query: 17  KSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEM 76
           KSVLF+C  N  RSP+ +++F++++   N ++ W+++S  +  W+VG+  DPRA      
Sbjct: 6   KSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRN 65
Query: 77  YGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPP--DSSAQLVKLGTFTRKAKF 134
           +G++T H  R++TK+DF  FDYI+  DE++L  L  ++    +  A++  LG++  + + 
Sbjct: 66  HGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQL 125
Query: 135 QGPSDLPDPFF 145
                + DP++
Sbjct: 126 I----IEDPYY 132
>pdb|1C0E|A Chain A, Active Site S19a Mutant Of Bovine Heart Phosphotyrosyl Phosphatase Length = 157 Back     alignment and structure
>pdb|1XWW|A Chain A, Crystal Structure Of Human B-Form Low Molecular Weight Phosphotyrosyl Phosphatase At 1.6 Angstrom Resolution Length = 157 Back     alignment and structure
>pdb|2P4U|A Chain A, Crystal Structure Of Acid Phosphatase 1 (Acp1) From Mus Musculus Length = 168 Back     alignment and structure
>pdb|5PNT|A Chain A, Crystal Structure Of A Human Low Molecular Weight Phosphotyrosyl Phosphatase. Implications For Substrate Specificity Length = 157 Back     alignment and structure
>pdb|2CWD|A Chain A, Crystal Structure Of Tt1001 Protein From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|1P8A|A Chain A, Solution Structure Of The Low Molecular Weight Protein Tyrosine Phosphatase From Tritrichomonas Foetus Length = 146 Back     alignment and structure
>pdb|1D1P|A Chain A, Crystal Structure Of A Yeast Low Molecular Weight Protein Tyrosine Phosphatase (Ltp1) Length = 160 Back     alignment and structure
>pdb|4ETM|A Chain A, Crystal Structure Of Yfkj From Bacillus Subtilis Length = 173 Back     alignment and structure
>pdb|1D2A|A Chain A, Crystal Structure Of A Yeast Low Molecular Weight Protein Tyrosine Phosphatase (Ltp1) Complexed With The Activator Adenine Length = 160 Back     alignment and structure
>pdb|1D1Q|A Chain A, Crystal Structure Of A Yeast Low Molecular Weight Protein Tyrosine Phosphatase (Ltp1) Complexed With The Substrate Pnpp Length = 161 Back     alignment and structure
>pdb|3IDO|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase From Entamoeba Histolytica With A Phosphotyrosine Crude Mimic Hepes Molecule In The Active Site Length = 178 Back     alignment and structure
>pdb|3JVI|A Chain A, Product State Mimic Crystal Structure Of Protein Tyrosine Phosphatase From Entamoeba Histolytica Length = 161 Back     alignment and structure
>pdb|3ROF|A Chain A, Crystal Structure Of The S. Aureus Protein Tyrosine Phosphatase Ptpa Length = 158 Back     alignment and structure
>pdb|2LUO|A Chain A, Nmr Solution Structure Of Apo-Mptpa Length = 164 Back     alignment and structure
>pdb|1U2P|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Low Molecular Protein Tyrosine Phosphatase (Mptpa) At 1.9a Resolution Length = 163 Back     alignment and structure
>pdb|2GI4|A Chain A, Solution Structure Of The Low Molecular Weight Protein Tyrosine Phosphatase From Campylobacter Jejuni Length = 156 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3jvi_A161 Protein tyrosine phosphatase; niaid, ssgcid, seatt 8e-35
3n8i_A157 Low molecular weight phosphotyrosine protein PHOS; 1e-32
1d1q_A161 Tyrosine phosphatase (E.C.3.1.3.48); beta-alpha-be 4e-32
2cwd_A161 Low molecular weight phosphotyrosine protein PHOS; 5e-31
2gi4_A156 Possible phosphotyrosine protein phosphatase; low 2e-29
1p8a_A146 Protein tyrosine phosphatase; hydrolase; NMR {Trit 1e-28
1u2p_A163 Ptpase, low molecular weight protein-tyrosine- pho 2e-28
2fek_A167 Low molecular weight protein-tyrosine- phosphatase 4e-28
4etn_A184 LMPTP, low molecular weight protein-tyrosine-phosp 7e-27
3rof_A158 Low molecular weight protein-tyrosine-phosphatase; 7e-26
2wmy_A150 WZB, putative acid phosphatase WZB; hydrolase; 2.2 2e-25
2wja_A168 Putative acid phosphatase WZB; hydrolase; 2.50A {E 4e-25
1jl3_A139 Arsenate reductase; alpha-beta fold, PTP-loop, oxi 2e-07
3rh0_A148 Arsenate reductase; oxidoreductase; 1.72A {Coryneb 3e-07
1jf8_A131 Arsenate reductase; ptpase I fold, P-loop, sulfini 1e-06
1y1l_A124 Arsenate reductase (ARSC); detoxification, cadmium 3e-06
2l17_A134 Synarsc, arsenate reductase; alpha/beta sandwich, 1e-05
3t38_A213 Arsenate reductase; low molecular weight tyrosine 1e-04
>3jvi_A Protein tyrosine phosphatase; niaid, ssgcid, seattle structural genomics center for infect disease, parasitic protozoan, dysentery; 1.80A {Entamoeba histolytica} PDB: 3js5_A* 3ily_A 3ido_A* Length = 161 Back     alignment and structure
 Score =  120 bits (304), Expect = 8e-35
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 3/131 (2%)

Query: 15  GKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERC 74
           G   +LF+C  N  RSP  +++ K+++   + T ++I +SAG   +  G+  D R ++  
Sbjct: 3   GSMKLLFVCLGNICRSPAAEAVMKKVIQNHHLTEKYICDSAGTCSYHEGQQADSRMRKVG 62

Query: 75  EMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKF 134
           +  G   + + R +   DF  FDYI A D  +   L    P     ++ K+  F    K 
Sbjct: 63  KSRGYQVDSISRPVVSSDFKNFDYIFAMDNDNYYELLDRCPEQYKQKIFKMVDFCTTIKT 122

Query: 135 QGPSDLPDPFF 145
               ++PDP++
Sbjct: 123 T---EVPDPYY 130
>3n8i_A Low molecular weight phosphotyrosine protein PHOS; tyrosine phosphatase, hydrolase, protein-ligand complex; HET: NLA; 1.50A {Homo sapiens} PDB: 5pnt_A* 1xww_A 1bvh_A 1dg9_A* 1phr_A 1pnt_A 1z12_A 1z13_A 1c0e_A 2p4u_A Length = 157 Back     alignment and structure
>1d1q_A Tyrosine phosphatase (E.C.3.1.3.48); beta-alpha-beta, hydrolase; HET: 4NP; 1.70A {Saccharomyces cerevisiae} SCOP: c.44.1.1 PDB: 1d2a_A* 1d1p_A* Length = 161 Back     alignment and structure
>2cwd_A Low molecular weight phosphotyrosine protein PHOS; tyrosine phosphatase, structural genomics; 1.90A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2gi4_A Possible phosphotyrosine protein phosphatase; low molecular weight, protein tyrosine phosphatase, bacterial phosphatase; NMR {Campylobacter jejuni} Length = 156 Back     alignment and structure
>1p8a_A Protein tyrosine phosphatase; hydrolase; NMR {Tritrichomonas foetus} SCOP: c.44.1.1 Length = 146 Back     alignment and structure
>1u2p_A Ptpase, low molecular weight protein-tyrosine- phosphatase; hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 1u2q_A Length = 163 Back     alignment and structure
>2fek_A Low molecular weight protein-tyrosine- phosphatase WZB; phosphate binding, hydrolase; NMR {Escherichia coli K12} Length = 167 Back     alignment and structure
>4etn_A LMPTP, low molecular weight protein-tyrosine-phosphatase; dephosphorylation, hydrolase; 1.10A {Bacillus subtilis} PDB: 4eti_A 1zgg_A Length = 184 Back     alignment and structure
>3rof_A Low molecular weight protein-tyrosine-phosphatase; phosphatase, hydrolase; 1.03A {Staphylococcus aureus} Length = 158 Back     alignment and structure
>2wmy_A WZB, putative acid phosphatase WZB; hydrolase; 2.21A {Escherichia coli} Length = 150 Back     alignment and structure
>2wja_A Putative acid phosphatase WZB; hydrolase; 2.50A {Escherichia coli} Length = 168 Back     alignment and structure
>1jl3_A Arsenate reductase; alpha-beta fold, PTP-loop, oxidoreductase; 1.60A {Bacillus subtilis} SCOP: c.44.1.1 PDB: 1z2d_A 1z2e_A 2ipa_B Length = 139 Back     alignment and structure
>3rh0_A Arsenate reductase; oxidoreductase; 1.72A {Corynebacterium glutamicum} Length = 148 Back     alignment and structure
>1jf8_A Arsenate reductase; ptpase I fold, P-loop, sulfinic acid, oxidoreductase; 1.12A {Staphylococcus aureus} SCOP: c.44.1.1 PDB: 1jfv_A 2fxi_A 1lju_A* 1rxi_A 1rxe_A 1ljl_A 2cd7_A 1lk0_A Length = 131 Back     alignment and structure
>1y1l_A Arsenate reductase (ARSC); detoxification, cadmium, oxidized form, structural genomics, PSI, protein structure initiative; 2.80A {Archaeoglobus fulgidus} SCOP: c.44.1.1 Length = 124 Back     alignment and structure
>2l17_A Synarsc, arsenate reductase; alpha/beta sandwich, oxidoreductase; NMR {Synechocystis} PDB: 2l18_A 2l19_A Length = 134 Back     alignment and structure
>3t38_A Arsenate reductase; low molecular weight tyrosine phosphatase fold, reduction of to arsenite, oxidoreductase; 2.20A {Corynebacterium glutamicum} Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3jvi_A161 Protein tyrosine phosphatase; niaid, ssgcid, seatt 100.0
4etm_A173 LMPTP, low molecular weight protein-tyrosine-phosp 100.0
3n8i_A157 Low molecular weight phosphotyrosine protein PHOS; 100.0
1u2p_A163 Ptpase, low molecular weight protein-tyrosine- pho 100.0
1d1q_A161 Tyrosine phosphatase (E.C.3.1.3.48); beta-alpha-be 100.0
2gi4_A156 Possible phosphotyrosine protein phosphatase; low 100.0
2cwd_A161 Low molecular weight phosphotyrosine protein PHOS; 100.0
3rof_A158 Low molecular weight protein-tyrosine-phosphatase; 100.0
4etn_A184 LMPTP, low molecular weight protein-tyrosine-phosp 100.0
4egs_A180 Ribose 5-phosphate isomerase RPIB; tyrosine phosph 100.0
2wmy_A150 WZB, putative acid phosphatase WZB; hydrolase; 2.2 100.0
1p8a_A146 Protein tyrosine phosphatase; hydrolase; NMR {Trit 100.0
2wja_A168 Putative acid phosphatase WZB; hydrolase; 2.50A {E 100.0
2fek_A167 Low molecular weight protein-tyrosine- phosphatase 100.0
2l17_A134 Synarsc, arsenate reductase; alpha/beta sandwich, 100.0
1jf8_A131 Arsenate reductase; ptpase I fold, P-loop, sulfini 100.0
3rh0_A148 Arsenate reductase; oxidoreductase; 1.72A {Coryneb 100.0
1jl3_A139 Arsenate reductase; alpha-beta fold, PTP-loop, oxi 100.0
1y1l_A124 Arsenate reductase (ARSC); detoxification, cadmium 100.0
3t38_A213 Arsenate reductase; low molecular weight tyrosine 100.0
1tvm_A113 PTS system, galactitol-specific IIB component; pho 95.95
2m1z_A106 LMO0427 protein; homolog PTS system IIB component, 95.81
1e2b_A106 Enzyme IIB-cellobiose; phosphotransferase system, 94.56
2kyr_A111 Fructose-like phosphotransferase enzyme IIB compo; 94.27
2r48_A106 Phosphotransferase system (PTS) mannose-specific i 93.46
2r4q_A106 Phosphotransferase system (PTS) fructose-specific 93.08
3p9y_A198 CG14216, LD40846P; phosphatase, CIS proline, LMW P 92.8
3czc_A110 RMPB; alpha/beta sandwich, phosphotransferase syst 92.57
4h3k_B214 RNA polymerase II subunit A C-terminal domain PHO 91.78
1vkr_A125 Mannitol-specific PTS system enzyme iiabc compone; 91.06
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 89.86
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 89.04
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 85.96
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 84.22
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 82.54
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 81.2
>3jvi_A Protein tyrosine phosphatase; niaid, ssgcid, seattle structural genomics center for infect disease, parasitic protozoan, dysentery; 1.80A {Entamoeba histolytica} PDB: 3js5_A* 3ily_A 3ido_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-49  Score=327.17  Aligned_cols=156  Identities=24%  Similarity=0.406  Sum_probs=143.7

Q ss_pred             cCCCeEEEEcCCCchHHHHHHHHHHHHHHhcCCCCcEEEEEeeeccCCCCCCCCHHHHHHHHHcCCCCCCceeccCcccc
Q psy10839         14 EGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDF   93 (232)
Q Consensus        14 ~~~~~ILFVCtgNicRSpmAEailr~l~~~~gl~~~i~V~SAG~~~~~~G~~~dp~Ai~vL~e~GIdl~hrsr~lt~~dl   93 (232)
                      |+|++|||||+||+|||||||++|+++++++|+++.|+|+||||.++++|+++||+++++|+++|||++|+|++|+++++
T Consensus         2 ~~m~~vLFVC~gN~cRSpmAE~~~~~~~~~~gl~~~~~v~SAGt~~~~~G~~~~~~a~~~l~~~Gid~~~~ar~l~~~~~   81 (161)
T 3jvi_A            2 PGSMKLLFVCLGNICRSPAAEAVMKKVIQNHHLTEKYICDSAGTCSYHEGQQADSRMRKVGKSRGYQVDSISRPVVSSDF   81 (161)
T ss_dssp             --CEEEEEEESSSSSHHHHHHHHHHHHHHHTTCGGGEEEEEEESCCTTTTCBCCHHHHHHHHHTTCCCCCBCCBCCHHHH
T ss_pred             CCCcEEEEECCCchhHHHHHHHHHHHHHHHcCCCCcEEEEeeecCCcccCCCCCHHHHHHHHHcCcCCCCeeeECCHHHh
Confidence            46789999999999999999999999999999988999999999998899999999999999999999999999999999


Q ss_pred             CCccEEEEecCCcHHHHHHhCCCCCCccEEEecccccccCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHHHHHHHHHHH
Q psy10839         94 YKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLDTL  173 (232)
Q Consensus        94 ~~aDlII~Md~~~~~~L~~~~P~~~~~Kv~ll~~f~~~~~~~~~~dIpDP~~~~~~~~fe~~~~~~~~I~~~v~~ll~~L  173 (232)
                      .+|||||+||+.|++.|.+.+|....+||++|++|.+.   ..+|+||||||++.+. |+++   +++|+++|+.|+++|
T Consensus        82 ~~~DlIl~Md~~~~~~l~~~~p~~~~~kv~ll~~~~~~---~~~~~I~DPy~~~~~~-f~~~---~~~I~~~~~~ll~~l  154 (161)
T 3jvi_A           82 KNFDYIFAMDNDNYYELLDRCPEQYKQKIFKMVDFCTT---IKTTEVPDPYYGGEKG-FHRV---IDILEDACENLIIKL  154 (161)
T ss_dssp             HHCSEEEESSHHHHHHHHHHSCGGGGGGEEEGGGGCSS---CCCSSCCCCC--CHHH-HHHH---HHHHHHHHHHHHHHH
T ss_pred             cCCCEEEEeChHHHHHHHHhcCccccceEEehhhhcCC---cCCCCCcCCCCCCHHH-HHHH---HHHHHHHHHHHHHHH
Confidence            99999999999999999999994357899999999864   3479999999999999 9999   999999999999999


Q ss_pred             hhh
Q psy10839        174 GIE  176 (232)
Q Consensus       174 ~~~  176 (232)
                      +++
T Consensus       155 ~~~  157 (161)
T 3jvi_A          155 EEG  157 (161)
T ss_dssp             HHS
T ss_pred             Hhc
Confidence            775
>4etm_A LMPTP, low molecular weight protein-tyrosine-phosphatase; dephosphorylation, hydrolase; 1.60A {Bacillus subtilis} Back     alignment and structure
>3n8i_A Low molecular weight phosphotyrosine protein PHOS; tyrosine phosphatase, hydrolase, protein-ligand complex; HET: NLA; 1.50A {Homo sapiens} SCOP: c.44.1.1 PDB: 5pnt_A* 1xww_A 1bvh_A 1dg9_A* 1phr_A 1pnt_A 1z12_A 1z13_A 1c0e_A 2p4u_A Back     alignment and structure
>1u2p_A Ptpase, low molecular weight protein-tyrosine- phosphatase; hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 1u2q_A Back     alignment and structure
>1d1q_A Tyrosine phosphatase (E.C.3.1.3.48); beta-alpha-beta, hydrolase; HET: 4NP; 1.70A {Saccharomyces cerevisiae} SCOP: c.44.1.1 PDB: 1d2a_A* 1d1p_A* Back     alignment and structure
>2gi4_A Possible phosphotyrosine protein phosphatase; low molecular weight, protein tyrosine phosphatase, bacterial phosphatase; NMR {Campylobacter jejuni} Back     alignment and structure
>2cwd_A Low molecular weight phosphotyrosine protein PHOS; tyrosine phosphatase, structural genomics; 1.90A {Thermus thermophilus} Back     alignment and structure
>3rof_A Low molecular weight protein-tyrosine-phosphatase; phosphatase, hydrolase; 1.03A {Staphylococcus aureus} Back     alignment and structure
>4etn_A LMPTP, low molecular weight protein-tyrosine-phosphatase; dephosphorylation, hydrolase; 1.10A {Bacillus subtilis} PDB: 4eti_A 1zgg_A Back     alignment and structure
>4egs_A Ribose 5-phosphate isomerase RPIB; tyrosine phosphatase, dephosphorylation, hydrolase; 2.30A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2wmy_A WZB, putative acid phosphatase WZB; hydrolase; 2.21A {Escherichia coli} Back     alignment and structure
>1p8a_A Protein tyrosine phosphatase; hydrolase; NMR {Tritrichomonas foetus} SCOP: c.44.1.1 Back     alignment and structure
>2wja_A Putative acid phosphatase WZB; hydrolase; 2.50A {Escherichia coli} Back     alignment and structure
>2fek_A Low molecular weight protein-tyrosine- phosphatase WZB; phosphate binding, hydrolase; NMR {Escherichia coli K12} Back     alignment and structure
>2l17_A Synarsc, arsenate reductase; alpha/beta sandwich, oxidoreductase; NMR {Synechocystis} PDB: 2l18_A 2l19_A Back     alignment and structure
>1jf8_A Arsenate reductase; ptpase I fold, P-loop, sulfinic acid, oxidoreductase; 1.12A {Staphylococcus aureus} SCOP: c.44.1.1 PDB: 1jfv_A 2fxi_A 1lju_A* 1rxi_A 1rxe_A 1ljl_A 2cd7_A 1lk0_A Back     alignment and structure
>3rh0_A Arsenate reductase; oxidoreductase; 1.72A {Corynebacterium glutamicum} Back     alignment and structure
>1jl3_A Arsenate reductase; alpha-beta fold, PTP-loop, oxidoreductase; 1.60A {Bacillus subtilis} SCOP: c.44.1.1 PDB: 1z2d_A 1z2e_A 2ipa_B Back     alignment and structure
>1y1l_A Arsenate reductase (ARSC); detoxification, cadmium, oxidized form, structural genomics, PSI, protein structure initiative; 2.80A {Archaeoglobus fulgidus} SCOP: c.44.1.1 Back     alignment and structure
>3t38_A Arsenate reductase; low molecular weight tyrosine phosphatase fold, reduction of to arsenite, oxidoreductase; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1tvm_A PTS system, galactitol-specific IIB component; phosphotransferase system (PTS), P-loop; NMR {Escherichia coli} Back     alignment and structure
>2m1z_A LMO0427 protein; homolog PTS system IIB component, transferase; NMR {Listeria monocytogenes egd-e} Back     alignment and structure
>1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D Back     alignment and structure
>2kyr_A Fructose-like phosphotransferase enzyme IIB compo; ALP protein, structural genomics, PSI-2; NMR {Escherichia coli} Back     alignment and structure
>2r48_A Phosphotransferase system (PTS) mannose-specific iibca component; PTS system, fructose specific IIB PFAM02379, PSI-2, MCSG; 1.80A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>2r4q_A Phosphotransferase system (PTS) fructose-specific iiabc component; fructose specific IIB subunit, PF structural genomics, PSI-2; HET: MSE; 1.60A {Bacillus subtilis subsp} SCOP: c.44.2.2 Back     alignment and structure
>3p9y_A CG14216, LD40846P; phosphatase, CIS proline, LMW PTP-like fold, RNA polymerase hydrolase; HET: N7P SEP SET IMD PG4; 2.10A {Drosophila melanogaster} PDB: 3fdf_A 3fmv_A 3omx_A 3omw_A Back     alignment and structure
>3czc_A RMPB; alpha/beta sandwich, phosphotransferase system, transferase, transport; 2.02A {Streptococcus mutans} Back     alignment and structure
>4h3k_B RNA polymerase II subunit A C-terminal domain PHO SSU72; heat repeat, phosphatase, RNA polymerase II, hydrolase; HET: SEP; 2.00A {Homo sapiens} PDB: 3o2q_B* 4h3h_B* 3o2s_B Back     alignment and structure
>1vkr_A Mannitol-specific PTS system enzyme iiabc compone; phosphotransferase, transferase, kinase, sugar transport; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1vrv_A* 2few_B* Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1d1qa_159 c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast 5e-19
d1dg9a_157 c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos tauru 6e-19
d1p8aa_146 c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas 6e-17
d1jl3a_137 c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus su 1e-06
d1jf8a_130 c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococ 2e-06
d1y1la_124 c.44.1.1 (A:) Arsenate reductase ArsC {Archaeoglob 2e-04
>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphotyrosine protein phosphatases I-like
superfamily: Phosphotyrosine protein phosphatases I
family: Low-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 78.8 bits (193), Expect = 5e-19
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 6/157 (3%)

Query: 16  KKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWI-VESAGIGWWDVGKGMDPRAKERC 74
           K SV F+   N+ RSPM +++FK  +  AN  N +  ++S G   + VG+  D R    C
Sbjct: 5   KISVAFIALGNFCRSPMAEAIFKHEVEKANLENRFNKIDSFGTSNYHVGESPDHRTVSIC 64

Query: 75  EMYGLDTEHVVREITKDDFYKFDYIIATDETDLSFLRLEAPPDSSAQLVKLGTFTRKAKF 134
           + +G+   H  ++I    F ++DYII  DE++++ L+   P  S A++   G +      
Sbjct: 65  KQHGVKINHKGKQIKTKHFDEYDYIIGMDESNINNLKKIQPEGSKAKVCLFGDWNTNDGT 124

Query: 135 QGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLD 171
                + DP++   ++       I +      + FL 
Sbjct: 125 VQT-IIEDPWYGDIQDFEYNFKQITYF----SKQFLK 156
>d1dg9a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]} Length = 157 Back     information, alignment and structure
>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus [TaxId: 5724]} Length = 146 Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1jf8a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} Length = 130 Back     information, alignment and structure
>d1y1la_ c.44.1.1 (A:) Arsenate reductase ArsC {Archaeoglobus fulgidus [TaxId: 2234]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1dg9a_157 Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 991 100.0
d1d1qa_159 Tyrosine phosphatase {Baker's yeast (Saccharomyces 100.0
d1p8aa_146 Tyrosine phosphatase {Tritrichomonas foetus [TaxId 100.0
d1jf8a_130 Arsenate reductase ArsC {Staphylococcus aureus [Ta 100.0
d1y1la_124 Arsenate reductase ArsC {Archaeoglobus fulgidus [T 100.0
d1jl3a_137 Arsenate reductase ArsC {Bacillus subtilis [TaxId: 100.0
d1vkra_97 PTS system mannitol-specific EIICBA component {Esc 96.55
d2r4qa1103 Fructose-specific enzyme IIABC component FruA, mid 86.48
d2r48a1103 Mannose-specific enzyme IIBCA component ManP, N-te 85.88
d1iiba_103 Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56 85.06
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.74
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 84.4
>d1dg9a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphotyrosine protein phosphatases I-like
superfamily: Phosphotyrosine protein phosphatases I
family: Low-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=4.5e-45  Score=294.70  Aligned_cols=153  Identities=29%  Similarity=0.598  Sum_probs=142.6

Q ss_pred             cCCCeEEEEcCCCchHHHHHHHHHHHHHHhcCCCCcEEEEEeeeccCCCCCCCCHHHHHHHHHcCCCCCCceeccCcccc
Q psy10839         14 EGKKSVLFLCRDNYMRSPMIKSLFKEMLAMANQTNEWIVESAGIGWWDVGKGMDPRAKERCEMYGLDTEHVVREITKDDF   93 (232)
Q Consensus        14 ~~~~~ILFVCtgNicRSpmAEailr~l~~~~gl~~~i~V~SAG~~~~~~G~~~dp~Ai~vL~e~GIdl~hrsr~lt~~dl   93 (232)
                      +..++|||||+||+|||||||++|++++.++|+++.+.|.|||+.+++.|.+++|.++.+|+++|+|++|++++++.+++
T Consensus         3 ~~~k~ILFVCtgN~cRSpmAEal~~~~~~~~~l~~~~~v~SaG~~~~~~g~~~~~~a~~~l~~~gid~~~~~~~~~~~~~   82 (157)
T d1dg9a_           3 QVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDF   82 (157)
T ss_dssp             CCCEEEEEEESSSSSHHHHHHHHHHHHHHHTTCGGGEEEEEEESCSTTTTCCCCHHHHHHHHHTTCCCCCCCCBCCTTHH
T ss_pred             CCCCeEEEEeCCcHHHHHHHHHHHHHHHHhcCCCccceEeecccccccCCCcCCHHHHHHHHhcCcccccchhhhhHHhh
Confidence            35678999999999999999999999999999988999999999998889999999999999999999888999999999


Q ss_pred             CCccEEEEecCCcHHHHHHhCCCC--CCccEEEecccccccCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHHHHHHHHH
Q psy10839         94 YKFDYIIATDETDLSFLRLEAPPD--SSAQLVKLGTFTRKAKFQGPSDLPDPFFLKTKELINALDDIIHRGYWYLRGFLD  171 (232)
Q Consensus        94 ~~aDlII~Md~~~~~~L~~~~P~~--~~~Kv~ll~~f~~~~~~~~~~dIpDP~~~~~~~~fe~~~~~~~~I~~~v~~ll~  171 (232)
                      .++|+||+|+..|+..|.+.+|..  ...|+++|++|.+.    ..++|||||+++.+. |+++   +++|+++|+.|++
T Consensus        83 ~~~DlIl~m~~~~~~~l~~~~p~~~~~~~kv~~l~~~~~~----~~~~I~DPy~~~~~~-f~~~---~~~I~~~v~~ll~  154 (157)
T d1dg9a_          83 VTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQ----KQLIIEDPYYGNDAD-FETV---YQQCVRCCRAFLE  154 (157)
T ss_dssp             HHCSEEEESSHHHHHHHHHHHTTCTTCCCEEEEGGGGCTT----CCCCCCCCTTSCHHH-HHHH---HHHHHHHHHHHHH
T ss_pred             hcccccccchHHHHHHHHHhCCccccchheeeehhhhCCC----CCCcCCCCCCCCHHH-HHHH---HHHHHHHHHHHHH
Confidence            999999999999999999998863  35789999999875    579999999999999 9999   9999999999999


Q ss_pred             HHh
Q psy10839        172 TLG  174 (232)
Q Consensus       172 ~L~  174 (232)
                      +|+
T Consensus       155 ~lk  157 (157)
T d1dg9a_         155 KVR  157 (157)
T ss_dssp             HHC
T ss_pred             HhC
Confidence            875
>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1jf8a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y1la_ c.44.1.1 (A:) Arsenate reductase ArsC {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure