Psyllid ID: psy10851
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 307204532 | 402 | LIM homeobox transcription factor 1 beta | 0.427 | 0.169 | 0.619 | 3e-14 | |
| 332025158 | 400 | LIM homeobox transcription factor 1-beta | 0.427 | 0.17 | 0.619 | 3e-14 | |
| 307189897 | 402 | LIM homeobox transcription factor 1 beta | 0.427 | 0.169 | 0.619 | 3e-14 | |
| 383861320 | 402 | PREDICTED: LIM homeobox transcription fa | 0.427 | 0.169 | 0.605 | 4e-14 | |
| 328779726 | 402 | PREDICTED: LIM homeobox transcription fa | 0.427 | 0.169 | 0.605 | 4e-14 | |
| 380030211 | 402 | PREDICTED: LOW QUALITY PROTEIN: LIM home | 0.427 | 0.169 | 0.605 | 4e-14 | |
| 242007294 | 389 | Homeobox protein ceh-14, putative [Pedic | 0.421 | 0.172 | 0.647 | 5e-14 | |
| 156543668 | 419 | PREDICTED: LIM homeobox transcription fa | 0.421 | 0.159 | 0.619 | 1e-13 | |
| 195440764 | 636 | GK10148 [Drosophila willistoni] gi|19416 | 0.578 | 0.144 | 0.509 | 1e-13 | |
| 350402518 | 402 | PREDICTED: LIM homeobox transcription fa | 0.427 | 0.169 | 0.591 | 2e-13 |
| >gi|307204532|gb|EFN83212.1| LIM homeobox transcription factor 1 beta [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 83.6 bits (205), Expect = 3e-14, Method: Compositional matrix adjust.
Identities = 44/71 (61%), Positives = 51/71 (71%), Gaps = 3/71 (4%)
Query: 36 QVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQQEGDKSLDKEDSEPHIKQEPHSE 95
+VREALAKDTGLSVRVVQVWFQNQRAKMKK+QRKAK + G DKE E + PHS+
Sbjct: 227 KVREALAKDTGLSVRVVQVWFQNQRAKMKKLQRKAKTEPGS---DKEPKEERRTESPHSD 283
Query: 96 GESEWVSLDWR 106
+L+ R
Sbjct: 284 HSHYLNALNMR 294
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332025158|gb|EGI65338.1| LIM homeobox transcription factor 1-beta [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307189897|gb|EFN74141.1| LIM homeobox transcription factor 1 beta [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383861320|ref|XP_003706134.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328779726|ref|XP_001120677.2| PREDICTED: LIM homeobox transcription factor 1-beta-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380030211|ref|XP_003698747.1| PREDICTED: LOW QUALITY PROTEIN: LIM homeobox transcription factor 1-beta-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242007294|ref|XP_002424476.1| Homeobox protein ceh-14, putative [Pediculus humanus corporis] gi|212507894|gb|EEB11738.1| Homeobox protein ceh-14, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|156543668|ref|XP_001605174.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195440764|ref|XP_002068210.1| GK10148 [Drosophila willistoni] gi|194164295|gb|EDW79196.1| GK10148 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|350402518|ref|XP_003486514.1| PREDICTED: LIM homeobox transcription factor 1-beta-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| FB|FBgn0036274 | 544 | CG4328 [Drosophila melanogaste | 0.402 | 0.117 | 0.575 | 7.7e-14 | |
| FB|FBgn0052105 | 640 | CG32105 [Drosophila melanogast | 0.402 | 0.1 | 0.651 | 1.7e-13 | |
| UNIPROTKB|F1S229 | 295 | LMX1A "Uncharacterized protein | 0.408 | 0.220 | 0.550 | 2.5e-11 | |
| UNIPROTKB|E1C2D6 | 386 | E1C2D6 "Uncharacterized protei | 0.503 | 0.207 | 0.465 | 2.5e-11 | |
| UNIPROTKB|I3L863 | 296 | LMX1A "Uncharacterized protein | 0.408 | 0.219 | 0.550 | 2.5e-11 | |
| UNIPROTKB|H9L043 | 280 | H9L043 "Uncharacterized protei | 0.471 | 0.267 | 0.481 | 4.4e-11 | |
| UNIPROTKB|F1MC25 | 382 | LMX1A "Uncharacterized protein | 0.408 | 0.170 | 0.550 | 5.2e-11 | |
| UNIPROTKB|F1PDJ1 | 382 | LMX1A "Uncharacterized protein | 0.408 | 0.170 | 0.550 | 5.2e-11 | |
| UNIPROTKB|Q8TE12 | 382 | LMX1A "LIM homeobox transcript | 0.408 | 0.170 | 0.550 | 5.2e-11 | |
| MGI|MGI:1888519 | 382 | Lmx1a "LIM homeobox transcript | 0.408 | 0.170 | 0.550 | 5.2e-11 |
| FB|FBgn0036274 CG4328 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 188 (71.2 bits), Expect = 7.7e-14, P = 7.7e-14
Identities = 42/73 (57%), Positives = 52/73 (71%)
Query: 36 QVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQQEGDKSL-DKEDSEPH------- 87
+VRE LAKDTGLS+R+VQVWFQNQRAK+KKIQ+KAKQ+ K D +DS+
Sbjct: 369 KVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQEPPSKGASDSQDSQESLDSSLAT 428
Query: 88 -IKQEPHSEGESE 99
IK E HS+ ES+
Sbjct: 429 KIKDEAHSDSESQ 441
|
|
| FB|FBgn0052105 CG32105 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S229 LMX1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C2D6 E1C2D6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L863 LMX1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9L043 H9L043 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MC25 LMX1A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDJ1 LMX1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TE12 LMX1A "LIM homeobox transcription factor 1-alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1888519 Lmx1a "LIM homeobox transcription factor 1 alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 2e-09 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 3e-08 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 4e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-07 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 2e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 9e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 9e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 2e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 3e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 4e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 6e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 6e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 7e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| pfam05920 | 40 | pfam05920, Homeobox_KN, Homeobox KN domain | 0.001 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.002 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.003 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.003 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.004 |
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
Score = 50.2 bits (121), Expect = 2e-09
Identities = 18/32 (56%), Positives = 24/32 (75%)
Query: 34 TTQVREALAKDTGLSVRVVQVWFQNQRAKMKK 65
+ + RE LAK GL+ R V+VWFQN+RAK K+
Sbjct: 26 SAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57
|
Length = 57 |
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| KOG0484|consensus | 125 | 99.89 | ||
| KOG2251|consensus | 228 | 99.87 | ||
| KOG0850|consensus | 245 | 99.86 | ||
| KOG0843|consensus | 197 | 99.84 | ||
| KOG0842|consensus | 307 | 99.84 | ||
| KOG0485|consensus | 268 | 99.84 | ||
| KOG0488|consensus | 309 | 99.84 | ||
| KOG0489|consensus | 261 | 99.84 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.81 | |
| KOG0487|consensus | 308 | 99.8 | ||
| KOG0848|consensus | 317 | 99.78 | ||
| KOG0492|consensus | 246 | 99.78 | ||
| KOG0494|consensus | 332 | 99.77 | ||
| KOG0491|consensus | 194 | 99.72 | ||
| KOG0493|consensus | 342 | 99.72 | ||
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.71 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.71 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.71 | |
| KOG4577|consensus | 383 | 99.69 | ||
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.68 | |
| KOG0486|consensus | 351 | 99.67 | ||
| KOG3802|consensus | 398 | 99.65 | ||
| KOG0844|consensus | 408 | 99.65 | ||
| KOG0483|consensus | 198 | 99.64 | ||
| KOG0847|consensus | 288 | 99.57 | ||
| KOG0775|consensus | 304 | 99.54 | ||
| KOG0490|consensus | 235 | 99.48 | ||
| KOG0849|consensus | 354 | 99.44 | ||
| KOG0774|consensus | 334 | 99.37 | ||
| KOG1168|consensus | 385 | 99.33 | ||
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 99.08 | |
| KOG2252|consensus | 558 | 99.06 | ||
| KOG0490|consensus | 235 | 98.61 | ||
| KOG1146|consensus | 1406 | 98.35 | ||
| KOG0773|consensus | 342 | 97.76 | ||
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 97.64 | |
| KOG3623|consensus | 1007 | 97.0 | ||
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 96.82 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 92.83 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 91.87 | |
| PF06524 | 314 | NOA36: NOA36 protein; InterPro: IPR010531 This fam | 91.76 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 91.51 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 91.44 | |
| KOG1832|consensus | 1516 | 91.08 | ||
| KOG1146|consensus | 1406 | 90.79 | ||
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 90.31 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 88.17 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 88.12 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 87.62 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 87.19 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 86.92 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 86.69 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 86.33 | |
| KOG1832|consensus | 1516 | 85.55 | ||
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 85.53 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 85.3 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 85.28 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 85.11 | |
| PRK06930 | 170 | positive control sigma-like factor; Validated | 84.98 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 84.71 | |
| PF00424 | 91 | REV: REV protein (anti-repression trans-activator | 84.2 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 84.08 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 84.02 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 83.81 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 83.69 | |
| TIGR00927 | 1096 | 2A1904 K+-dependent Na+/Ca+ exchanger. | 83.62 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 83.6 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 83.43 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 83.15 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 83.03 | |
| TIGR02939 | 190 | RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s | 83.02 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 83.01 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 82.95 | |
| KOG3755|consensus | 769 | 82.84 | ||
| PRK12515 | 189 | RNA polymerase sigma factor; Provisional | 82.66 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 82.62 | |
| TIGR02948 | 187 | SigW_bacill RNA polymerase sigma-W factor. This si | 82.51 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 82.26 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 82.08 | |
| PRK05657 | 325 | RNA polymerase sigma factor RpoS; Validated | 81.26 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 80.99 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 80.98 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 80.78 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 80.62 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 80.19 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 80.18 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 80.12 |
| >KOG0484|consensus | Back alignment and domain information |
|---|
Probab=99.89 E-value=3.3e-23 Score=138.60 Aligned_cols=70 Identities=29% Similarity=0.307 Sum_probs=64.0
Q ss_pred cCCCCCCCCCCHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCCchhhhhhhhhHHHHHHHHHHHHHhhcC
Q psy10851 4 YWFQNFQTIRLLNLKVKLKTSFNSCCPGHKTTQVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQQEG 75 (159)
Q Consensus 4 ~~~kr~Rt~~s~~Q~~~Le~~F~~~~~~yp~~~~r~~La~~l~l~~~~V~vWFqNRR~k~rk~~~~~~~~~~ 75 (159)
++-||-||+||..||..|+..|... |||++-.|++||.++.|++..|||||||||+|.||+.+.......
T Consensus 15 rKQRRIRTTFTS~QLkELErvF~ET--HYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~~~~ 84 (125)
T KOG0484|consen 15 RKQRRIRTTFTSAQLKELERVFAET--HYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIAKMA 84 (125)
T ss_pred HHhhhhhhhhhHHHHHHHHHHHHhh--cCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHHHhh
Confidence 3457789999999999999999999 899999999999999999999999999999999999877665554
|
|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG0773|consensus | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06930 positive control sigma-like factor; Validated | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PF00424 REV: REV protein (anti-repression trans-activator protein); InterPro: IPR000625 REV is a viral anti-repression trans-activator protein, which appears to act post-transcriptionally [] to relieve negative repression of GAG and ENV production | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >KOG3755|consensus | Back alignment and domain information |
|---|
| >PRK12515 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02948 SigW_bacill RNA polymerase sigma-W factor | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK05657 RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.89 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.89 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.88 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.88 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.88 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.88 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.88 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.88 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.88 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.88 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.88 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.88 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.88 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.88 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.88 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.88 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.87 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.87 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.87 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.87 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.87 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.87 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.87 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.87 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.87 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.87 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.86 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.86 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.86 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.86 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.86 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.86 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.86 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.86 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.86 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.86 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.86 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.86 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.85 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.85 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.85 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.85 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.85 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.85 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.85 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.85 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.85 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.85 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.85 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.84 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.84 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.83 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.83 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.83 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.83 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.83 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.83 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.83 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.82 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.82 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.82 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.81 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.81 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.81 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.81 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.79 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.79 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.79 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.78 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.78 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.77 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.76 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.68 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.68 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.67 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.61 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.52 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 99.1 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 96.68 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 93.77 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 92.11 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 91.79 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 91.38 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 90.94 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 90.02 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 89.58 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 89.02 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 88.66 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 88.22 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 88.19 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 87.72 | |
| 3lph_A | 72 | Protein REV; helix-loop-helix, RNA-binding arginin | 86.26 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 86.1 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 85.82 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 85.82 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 85.61 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 85.21 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 85.2 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 84.27 | |
| 2x7l_M | 115 | HIV REV; nuclear export, immune system, post-trans | 84.16 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 84.15 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 84.0 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 82.85 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 81.73 |
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
Probab=99.89 E-value=5e-23 Score=134.01 Aligned_cols=70 Identities=26% Similarity=0.261 Sum_probs=63.8
Q ss_pred cCCCCCCCCCCHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCCchhhhhhhhhHHHHHHHHHHHHHhhcC
Q psy10851 4 YWFQNFQTIRLLNLKVKLKTSFNSCCPGHKTTQVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQQEG 75 (159)
Q Consensus 4 ~~~kr~Rt~~s~~Q~~~Le~~F~~~~~~yp~~~~r~~La~~l~l~~~~V~vWFqNRR~k~rk~~~~~~~~~~ 75 (159)
...||.|++||..|+.+|+.+|..+ + ||+..++..||..|||++.+|+|||||||+|+|+..........
T Consensus 5 ~~~rr~Rt~ft~~Q~~~Le~~F~~~-~-yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~~~~~~~ 74 (80)
T 2cue_A 5 SSGQRNRTSFTQEQIEALEKEFERT-H-YPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQ 74 (80)
T ss_dssp CSSCCCCCCSCHHHHHHHHHHHTTC-S-SCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred CCCCCCCCccCHHHHHHHHHHHhcc-C-CCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhhhhccCC
Confidence 3568899999999999999999999 6 99999999999999999999999999999999998776655443
|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >3lph_A Protein REV; helix-loop-helix, RNA-binding arginine rich motif, protein oligomerization, AIDS, HOST cytoplasm, HOST nucleus; 2.50A {Human immunodeficiency virus type 1} | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >2x7l_M HIV REV; nuclear export, immune system, post-transcriptional regulation; 3.17A {Human immunodeficiency virus type 3} | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 159 | ||||
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 2e-08 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 3e-08 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 7e-08 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 7e-08 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 7e-08 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 2e-07 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 3e-07 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 6e-07 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 8e-07 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 1e-06 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 1e-06 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 2e-06 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 3e-06 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 4e-06 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 5e-06 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 1e-05 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 2e-05 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 2e-05 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 2e-05 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 2e-05 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 2e-05 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 4e-05 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 4e-05 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 6e-05 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 6e-05 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 8e-05 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 1e-04 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 2e-04 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 2e-04 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 5e-04 |
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Lag1 longevity assurance homolog 6, LASS6 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 46.3 bits (110), Expect = 2e-08
Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%)
Query: 21 LKTSFNSCCPGHKTTQVREALAKDTGLSVRVVQVWFQNQRAKMKK 65
L+ F + H + E L+K VR +Q WF+ +R + K
Sbjct: 8 LEKVFTAITK-HPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKP 51
|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.92 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.92 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.91 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.91 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.91 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.91 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.9 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.9 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.9 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.9 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.9 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.89 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.89 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.88 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.88 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.87 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.87 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.87 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.87 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.86 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.86 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.82 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.82 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.82 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.81 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.81 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.79 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.79 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.78 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.77 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 94.41 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 92.99 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 92.49 | |
| d1iufa1 | 78 | Ars-binding protein 1, ABP1 {Fission yeast (Schizo | 92.04 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 91.48 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 81.52 |
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-b13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92 E-value=5.8e-26 Score=137.39 Aligned_cols=58 Identities=26% Similarity=0.326 Sum_probs=55.8
Q ss_pred CCCCCCCCCHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCCchhhhhhhhhHHHHHHH
Q psy10851 6 FQNFQTIRLLNLKVKLKTSFNSCCPGHKTTQVREALAKDTGLSVRVVQVWFQNQRAKMKK 65 (159)
Q Consensus 6 ~kr~Rt~~s~~Q~~~Le~~F~~~~~~yp~~~~r~~La~~l~l~~~~V~vWFqNRR~k~rk 65 (159)
.||+||+||..|+.+|+.+|..+ + ||+..+|..||..|||++++|+|||||||+|+||
T Consensus 1 Grr~Rt~ft~~Q~~~Le~~F~~~-~-yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk 58 (58)
T d2craa1 1 GRKKRIPYSKGQLRELEREYAAN-K-FITKDKRRKISAATSLSERQITIWFQNRRVKEKK 58 (58)
T ss_dssp CCCSCCCSCHHHHHHHHHHHHHC-S-SCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred CCCCCCCCCHHHHHHHHHHHhhc-C-CCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence 47899999999999999999999 6 9999999999999999999999999999999885
|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|