Psyllid ID: psy1098

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MDKLSDDNCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
cccccccccccccEEEcccccccccccccccEEEEEccEEEEEccccccccccEEEEEcccccEEEEEcccccccccccEEEEEEccEEEEEEcccccccccccEEEEEccccEEEEEcccccccccccccccccEEEEEccEEEEEccccccccccccccccccccccEEEEEcccccccEEEEEcccccccccccccEEEEEcccccccEEEEEccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEcccccccccccccccccccccccEEEEEEccccEEEEcEEcccccccccccccEEEEEEccEEEEEEccccccccccccEEEcccEEEEEcccccccccccEEEEEccEEEEEccEEcccEEEEc
ccccccccccccEEEEEccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEcccccccEcccEEEEEccccEEEEEcccccccccccccccccEEEEEccEEEEEEcccccccccccccccHHcccccEEEEccccccEEEEEEcccccccccccccEEEEEEccccccEEEEEEcccccccccEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEcccccccccccccccccccccccEEEEEccccEEEEEcccccccccccccccEEEEEEccEEEEEEccccccccccccEEcccEEEEEEcccccccccccccccccEEEEEccccccccEEEcc
mdklsddncpvyrwrriddpagpqprprhghraVAIKDLMLVFGGGNEGIVEELHVFntatnqwfiptlkgdippgcaaygivvdnTRVLIFGGMVEYGKYSSDLYELQASKWewkrlkpkpprfgsppcprlghsftliGNKVYlfgglansggdetkptpsykylddfYTLElksghttvwdmpgtygglpspreshtacswtdeyknTKLIIyggmsgnrlsDLFMLDinsmtwqkpqilgpqplprslhtacvigdrmfifggwvpilkdeSRSLHEKEWKcsnqlaclhlpemtwedlsvevtddflpkpraghcasvINSRMYIWSGRddykkawnnqvcckdlwylevekpgppgrIQLVRAATNnleicwpghpiadsyaiy
mdklsddncpvyrwrriddpagpqprprhGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFlpkpraghcasvinSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNnleicwpghpiadsyaiy
MDKLSDDNCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
*********PVYRWRR***************RAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRL***********CPRLGHSFTLIGNKVYLFGGLANS********PSYKYLDDFYTLELKSGHTTVWDMPGTYGGLP****SHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSY***
MDKLSDDNCPVYRWRRI***********HGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSV******LP**RAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
MDKLSDDNCPVYRWRRIDDPA*********HRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
*DKLSDDNCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKLSDDNCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
P51610 2035 Host cell factor 1 OS=Hom yes N/A 0.961 0.184 0.652 1e-154
Q61191 2045 Host cell factor 1 OS=Mus yes N/A 0.961 0.183 0.652 1e-153
P51611 2090 Host cell factor 1 OS=Mes N/A N/A 0.961 0.179 0.652 1e-153
Q9V4C8 1500 Host cell factor OS=Droso yes N/A 0.979 0.254 0.573 1e-142
Q9Y5Z7 792 Host cell factor 2 OS=Hom no N/A 0.966 0.476 0.558 1e-121
Q5RKG2 723 Host cell factor 2 OS=Rat no N/A 0.966 0.521 0.555 1e-120
Q9MA55 668 Acyl-CoA-binding domain-c no N/A 0.617 0.360 0.285 2e-23
Q9BQ90382 Kelch domain-containing p no N/A 0.587 0.599 0.321 3e-23
Q8VEM9382 Kelch domain-containing p no N/A 0.584 0.596 0.312 2e-22
Q6AYI2382 Kelch domain-containing p no N/A 0.584 0.596 0.312 2e-22
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function desciption
 Score =  544 bits (1401), Expect = e-154,   Method: Composition-based stats.
 Identities = 248/380 (65%), Positives = 304/380 (80%), Gaps = 5/380 (1%)

Query: 13  RWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGD 72
           RW+R+   +GP PRPRHGHRAVAIK+L++VFGGGNEGIV+ELHV+NTATNQWFIP ++GD
Sbjct: 18  RWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGD 77

Query: 73  IPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPR 132
           IPPGCAAYG V D TR+L+FGGMVEYGKYS+DLYELQAS+WEWKRLK K P+ G PPCPR
Sbjct: 78  IPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPR 137

Query: 133 LGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTV-WDMPGTYGG 191
           LGHSF+L+GNK YLFGGLAN   D     P  +YL+D Y LEL+ G   V WD+P TYG 
Sbjct: 138 LGHSFSLVGNKCYLFGGLANDSEDPKNNIP--RYLNDLYILELRPGSGVVAWDIPITYGV 195

Query: 192 LPSPRESHTACSWTD-EYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPR 250
           LP PRESHTA  +T+ + K +KL+IYGGMSG RL DL+ LDI+++TW KP + G  PLPR
Sbjct: 196 LPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPR 255

Query: 251 SLHTACVIGDRMFIFGGWVPILKDESR-SLHEKEWKCSNQLACLHLPEMTWEDLSVEVTD 309
           SLH+A  IG++M++FGGWVP++ D+ + + HEKEWKC+N LACL+L  M WE + ++  +
Sbjct: 256 SLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLE 315

Query: 310 DFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRA 369
           D +P+ RAGHCA  IN+R+YIWSGRD Y+KAWNNQVCCKDLWYLE EKP PP R+QLVRA
Sbjct: 316 DNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRA 375

Query: 370 ATNNLEICWPGHPIADSYAI 389
            TN+LE+ W     ADSY +
Sbjct: 376 NTNSLEVSWGAVATADSYLL 395
Involved in control of the cell cycle. Also antagonizes transactivation by ZBTB17 and GABP2; represses ZBTB17 activation of the p15(INK4b) promoter and inhibits its ability to recruit p300. Coactivator for EGR2 and GABP2. Tethers the chromatin modifying Set1/Ash2 histone H3 'Lys-4' methyltransferase (H3K4me) and Sin3 histone deacetylase (HDAC) complexes (involved in the activation and repression of transcription, respectively) together. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. In case of human herpes simplex virus (HSV) infection, HCFC1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and POU2F1 thereby enabling the transcription of the viral immediate early genes.
Homo sapiens (taxid: 9606)
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description
>sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 Back     alignment and function description
>sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 Back     alignment and function description
>sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 Back     alignment and function description
>sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
328710585 955 PREDICTED: hypothetical protein LOC10016 0.974 0.397 0.657 1e-158
157120092 1735 host cell factor C1 [Aedes aegypti] gi|1 0.979 0.220 0.633 1e-157
307210243 1605 Host cell factor [Harpegnathos saltator] 0.971 0.236 0.652 1e-155
190570282 1993 host cell factor C1b [Danio rerio] 0.961 0.188 0.65 1e-154
407262677 1081 PREDICTED: host cell factor 1-like, part 0.984 0.355 0.638 1e-153
301615629 2110 PREDICTED: host cell factor 1-like [Xeno 0.961 0.177 0.647 1e-152
380805899 1749 host cell factor 1, partial [Macaca mula 0.961 0.214 0.652 1e-152
403306881 2028 PREDICTED: host cell factor 1 [Saimiri b 0.961 0.184 0.652 1e-152
170649627 2033 host cell factor 1 (predicted) [Calliceb 0.961 0.184 0.652 1e-152
147905089 2101 uncharacterized protein LOC494675 [Xenop 0.961 0.178 0.644 1e-152
>gi|328710585|ref|XP_003244305.1| PREDICTED: hypothetical protein LOC100167009 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/382 (65%), Positives = 306/382 (80%), Gaps = 2/382 (0%)

Query: 8   NCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIP 67
           + PV +W++I DP GPQPRPRHGHRAVAIKDL++VFGGGNEGIV+ELHV+N A NQWFIP
Sbjct: 42  STPVLKWKKILDPIGPQPRPRHGHRAVAIKDLLIVFGGGNEGIVDELHVYNAANNQWFIP 101

Query: 68  TLKGDIPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGS 127
              GDIPPGCAAYG+VVDNTR+LIFGGMVEYGKYS++LYELQAS+W W +L+P+PP +  
Sbjct: 102 QTSGDIPPGCAAYGLVVDNTRLLIFGGMVEYGKYSNELYELQASRWHWSKLQPRPPLYHM 161

Query: 128 PPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPG 187
            PCPRLGHSFTLIGNKVYLFGGLAN   D     P  +YL+D YTL++ S     WD+P 
Sbjct: 162 SPCPRLGHSFTLIGNKVYLFGGLANDSNDPKNNIP--RYLNDLYTLDISSPDALAWDIPE 219

Query: 188 TYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQP 247
           T G  P PRESHTA ++TD     KLIIYGGMSG RL DL+ LDI++M+W +P +LGP+P
Sbjct: 220 TVGDFPPPRESHTAVAYTDSRGKCKLIIYGGMSGCRLGDLWTLDIDTMSWNRPIVLGPKP 279

Query: 248 LPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEV 307
           LPRSLHTA  I +RMF+FGGWVP +++    +HEKEWKC+NQLACL+L  MTWE+L++++
Sbjct: 280 LPRSLHTAVTIKNRMFVFGGWVPFVEEVKLPIHEKEWKCTNQLACLNLETMTWEELNMDM 339

Query: 308 TDDFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLV 367
            +D +P+ RAGHCA+ I +RMY+WSGRD Y+KAWNNQVCCKDLWYLEV+KP    R QLV
Sbjct: 340 NEDNMPRARAGHCAANIQTRMYVWSGRDGYRKAWNNQVCCKDLWYLEVDKPQKCARNQLV 399

Query: 368 RAATNNLEICWPGHPIADSYAI 389
           RA+TN LEI W   P AD+Y +
Sbjct: 400 RASTNALEIVWNSVPTADAYIL 421

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157120092|ref|XP_001659586.1| host cell factor C1 [Aedes aegypti] gi|108875064|gb|EAT39289.1| AAEL008905-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307210243|gb|EFN86893.1| Host cell factor [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|190570282|ref|NP_001122009.1| host cell factor C1b [Danio rerio] Back     alignment and taxonomy information
>gi|407262677|ref|XP_003946385.1| PREDICTED: host cell factor 1-like, partial [Mus musculus] Back     alignment and taxonomy information
>gi|301615629|ref|XP_002937269.1| PREDICTED: host cell factor 1-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|380805899|gb|AFE74825.1| host cell factor 1, partial [Macaca mulatta] Back     alignment and taxonomy information
>gi|403306881|ref|XP_003943948.1| PREDICTED: host cell factor 1 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|170649627|gb|ACB21214.1| host cell factor 1 (predicted) [Callicebus moloch] Back     alignment and taxonomy information
>gi|147905089|ref|NP_001087989.1| uncharacterized protein LOC494675 [Xenopus laevis] gi|52138924|gb|AAH82658.1| LOC494675 protein [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
ZFIN|ZDB-GENE-030912-10 1802 hcfc1a "host cell factor C1a" 0.961 0.208 0.644 2.6e-143
UNIPROTKB|P51610 2035 HCFC1 "Host cell factor 1" [Ho 0.961 0.184 0.652 3.7e-143
UNIPROTKB|F1RZU3 2074 HCFC1 "Uncharacterized protein 0.961 0.180 0.655 3.8e-143
UNIPROTKB|A6NEM2 2080 HCFC1 "HCF N-terminal chain 5" 0.961 0.180 0.652 5e-143
MGI|MGI:105942 2045 Hcfc1 "host cell factor C1" [M 0.961 0.183 0.652 5.2e-143
UNIPROTKB|P51611 2090 HCFC1 "Host cell factor 1" [Me 0.961 0.179 0.652 6.8e-143
RGD|1563804 2091 Hcfc1 "host cell factor C1" [R 0.961 0.179 0.652 6.9e-143
UNIPROTKB|E1BGF3 2001 Bt.44379 "Uncharacterized prot 0.941 0.183 0.658 3.6e-141
FB|FBgn0039904 1500 Hcf "Host cell factor" [Drosop 0.979 0.254 0.573 3.9e-131
UNIPROTKB|E1BZ01 725 E1BZ01 "Uncharacterized protei 0.958 0.515 0.580 2.3e-126
ZFIN|ZDB-GENE-030912-10 hcfc1a "host cell factor C1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1401 (498.2 bits), Expect = 2.6e-143, P = 2.6e-143
 Identities = 245/380 (64%), Positives = 305/380 (80%)

Query:    13 RWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGD 72
             RW+R+   +GP PRPRHGHRAVAIK+LM+VFGGGNEGIV+ELHV+NTATNQWFIP ++GD
Sbjct:    17 RWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGD 76

Query:    73 IPPGCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPR 132
             IPPGCAAYG V D TR+L+FGGMVEYGKYS+DLYELQAS+WEWK+LKPK P+ G PPCPR
Sbjct:    77 IPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKKLKPKAPKNGVPPCPR 136

Query:   133 LGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTV-WDMPGTYGG 191
             LGHSF+L+GNK YLFGGLAN   D     P  +YL+D YTLEL+ G +   WD+P TYG 
Sbjct:   137 LGHSFSLVGNKCYLFGGLANDSEDPKNNIP--RYLNDLYTLELRPGSSVAGWDVPVTYGV 194

Query:   192 LPSPRESHTACSWTDEY-KNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPR 250
             LP PRESHTA  +T++  K ++L+IYGGMSG RL DL+ LDI+++TW KP I G  PLPR
Sbjct:   195 LPPPRESHTAVIYTEKVTKKSRLVIYGGMSGCRLGDLWTLDIDTLTWNKPAISGAAPLPR 254

Query:   251 SLHTACVIGDRMFIFGGWVPILKDESR-SLHEKEWKCSNQLACLHLPEMTWEDLSVEVTD 309
             SLH+A  I ++M++FGGWVP++ D+ + + HEKEWKC+N LACL+L  + WE + ++  +
Sbjct:   255 SLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTLAWETVLMDTLE 314

Query:   310 DFLPKPRAGHCASVINSRMYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRA 369
             D +P+ RAGHCA  IN+R+YIWSGRD Y+KAWNNQVCCKDLWYLE E+P PP R+QLVRA
Sbjct:   315 DNIPRARAGHCAVAINNRLYIWSGRDGYRKAWNNQVCCKDLWYLETERPNPPSRVQLVRA 374

Query:   370 ATNNLEICWPGHPIADSYAI 389
              TN+LE+ W     AD+Y +
Sbjct:   375 NTNSLEVSWGAVSTADTYLL 394
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|P51610 HCFC1 "Host cell factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZU3 HCFC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6NEM2 HCFC1 "HCF N-terminal chain 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105942 Hcfc1 "host cell factor C1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P51611 HCFC1 "Host cell factor 1" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
RGD|1563804 Hcfc1 "host cell factor C1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGF3 Bt.44379 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0039904 Hcf "Host cell factor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZ01 E1BZ01 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51610HCFC1_HUMANNo assigned EC number0.65260.96150.1842yesN/A
Q9V4C8HCF_DROMENo assigned EC number0.57360.97940.2546yesN/A
Q61191HCFC1_MOUSENo assigned EC number0.65260.96150.1833yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-17
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-15
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 8e-05
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 1e-04
PLN02772398 PLN02772, PLN02772, guanylate kinase 2e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-04
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 4e-04
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 5e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 7e-04
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 0.002
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.003
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.004
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information 
 Score = 80.8 bits (199), Expect = 6e-17
 Identities = 91/307 (29%), Positives = 126/307 (41%), Gaps = 39/307 (12%)

Query: 14  WRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGG---NEGIVEELHVFNTATNQWFIPTLK 70
           W +++   G  P PR  H    + D +  FGG    NE I ++L+VF+  T+ W I    
Sbjct: 9   WIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSIAPAN 68

Query: 71  GDIPP-GCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPP 129
           GD+P   C    +V   T++ IFGG  E  ++S D Y     K EW  L  K    G P 
Sbjct: 69  GDVPRISCLGVRMVAVGTKLYIFGGRDEKREFS-DFYSYDTVKNEWTFLT-KLDEEGGPE 126

Query: 130 CPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTY 189
             R  HS     N VY+FGG++  GG    P         F T+E  +    + D  G +
Sbjct: 127 A-RTFHSMASDENHVYVFGGVSK-GGLMKTPE-------RFRTIEAYN----IAD--GKW 171

Query: 190 GGLPSPRESHTACS-----------WTDEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQ 238
             LP P E+                W   Y     I+ GG S    + +   D  S  W 
Sbjct: 172 VQLPDPGENFEKRGGAGFAVVQGKIWV-VYGFATSILPGGKSDYESNAVQFFDPASGKWT 230

Query: 239 KPQILGPQPLPRSLHTACVIGDRMFIFGGWV-PILKDESRSLHEKEWKCSNQLACLHLPE 297
           + +  G +P  RS+    V+G  + IFGG V P LK      H      SN+   L    
Sbjct: 231 EVETTGAKPSARSVFAHAVVGKYIIIFGGEVWPDLKG-----HLGPGTLSNEGYALDTET 285

Query: 298 MTWEDLS 304
           + WE L 
Sbjct: 286 LVWEKLG 292

Length = 341
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
KOG4152|consensus 830 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441|consensus571 100.0
KOG4693|consensus392 100.0
KOG4441|consensus571 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693|consensus392 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG0379|consensus482 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG1230|consensus521 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG0379|consensus 482 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 99.97
KOG1230|consensus 521 99.97
KOG4152|consensus 830 99.96
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.83
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.78
KOG2437|consensus723 99.77
KOG2437|consensus 723 99.54
PF03089337 RAG2: Recombination activating protein 2; InterPro 99.35
PF1396450 Kelch_6: Kelch motif 99.15
PF1396450 Kelch_6: Kelch motif 99.13
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.99
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.91
PLN02772 398 guanylate kinase 98.9
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.86
PF1341549 Kelch_3: Galactose oxidase, central domain 98.86
PLN02772398 guanylate kinase 98.85
PF1341549 Kelch_3: Galactose oxidase, central domain 98.84
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.83
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.8
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.77
PF1385442 Kelch_5: Kelch motif 98.65
PF1385442 Kelch_5: Kelch motif 98.59
smart0061247 Kelch Kelch domain. 98.52
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.49
PF03089 337 RAG2: Recombination activating protein 2; InterPro 98.48
smart0061247 Kelch Kelch domain. 98.42
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.09
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.97
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.86
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.74
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.68
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.42
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.26
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.02
KOG2055|consensus514 96.68
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.38
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.98
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 95.85
KOG2055|consensus514 94.95
PF12768281 Rax2: Cortical protein marker for cell polarity 94.6
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 94.55
PF12768281 Rax2: Cortical protein marker for cell polarity 94.24
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.1
PRK13684334 Ycf48-like protein; Provisional 93.74
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.52
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.37
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.08
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.02
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.84
smart00284255 OLF Olfactomedin-like domains. 91.0
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 90.82
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.7
PF12217367 End_beta_propel: Catalytic beta propeller domain o 90.55
PLN00033398 photosystem II stability/assembly factor; Provisio 90.32
PRK13684334 Ycf48-like protein; Provisional 90.25
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.85
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.11
KOG0649|consensus325 88.89
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.75
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.47
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 88.36
KOG0649|consensus325 86.01
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 85.89
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 85.83
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 85.3
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 84.48
PLN00033398 photosystem II stability/assembly factor; Provisio 83.27
COG4946 668 Uncharacterized protein related to the periplasmic 82.8
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 81.65
COG4946 668 Uncharacterized protein related to the periplasmic 81.58
COG1520370 FOG: WD40-like repeat [Function unknown] 81.26
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 81.15
KOG0281|consensus499 81.09
smart00284255 OLF Olfactomedin-like domains. 81.02
PRK04792448 tolB translocation protein TolB; Provisional 80.05
>KOG4152|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-61  Score=430.74  Aligned_cols=376  Identities=64%  Similarity=1.281  Sum_probs=350.6

Q ss_pred             eeEEecCCCCCCCCCCCceeeeEEeCCEEEEEccCCCCcccceEEEECCCCcEEeeeecCCCCCCCceeeEEEeCCEEEE
Q psy1098          12 YRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLI   91 (390)
Q Consensus        12 ~~W~~~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~iyv   91 (390)
                      -+|+++.+..++.|.+|.+|-++.+.+-|+||||.+++..+.++.||..+++|...+..|+.|.+++.|.++..+++||+
T Consensus        17 ~rWrrV~~~tGPvPrpRHGHRAVaikELiviFGGGNEGiiDELHvYNTatnqWf~PavrGDiPpgcAA~GfvcdGtrilv   96 (830)
T KOG4152|consen   17 VRWRRVQQSTGPVPRPRHGHRAVAIKELIVIFGGGNEGIIDELHVYNTATNQWFAPAVRGDIPPGCAAFGFVCDGTRILV   96 (830)
T ss_pred             cceEEEecccCCCCCccccchheeeeeeEEEecCCcccchhhhhhhccccceeecchhcCCCCCchhhcceEecCceEEE
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcceeCCceeecceEEEEcCcceeEEecCCCCCCCCCCCCCccceEEEECCEEEEEcCccCCCCCCCCCCCcccccccee
Q psy1098          92 FGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFY  171 (390)
Q Consensus        92 ~GG~~~~~~~~~~v~~~d~~~~~W~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~  171 (390)
                      |||+.+.++++||+|.+....+.|.++.+.++.++.+|++|.+|+....+++.|+|||...+..+...++|  +|+||+|
T Consensus        97 FGGMvEYGkYsNdLYELQasRWeWkrlkp~~p~nG~pPCPRlGHSFsl~gnKcYlFGGLaNdseDpknNvP--rYLnDlY  174 (830)
T KOG4152|consen   97 FGGMVEYGKYSNDLYELQASRWEWKRLKPKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNVP--RYLNDLY  174 (830)
T ss_pred             EccEeeeccccchHHHhhhhhhhHhhcCCCCCCCCCCCCCccCceeEEeccEeEEeccccccccCcccccc--hhhcceE
Confidence            99999999999999999999999999999999999999999999999999999999999998888999999  9999999


Q ss_pred             eeecCCCc-eeeeeccccCCCCCCCCceeeeEEee-ccCCCcEEEEEcCCCCCccCcEEEEecCCCeEeecccCCCCCCC
Q psy1098         172 TLELKSGH-TTVWDMPGTYGGLPSPRESHTACSWT-DEYKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLP  249 (390)
Q Consensus       172 ~~d~~~~~-~~~W~~~~~~~~~p~~r~~~~~~~~~-~~~~~~~i~v~GG~~~~~~~~v~~~d~~~~~W~~~~~~~~~p~~  249 (390)
                      .+++..+. .-.|..+...+.+|.+|..|+++.+. ++.+..+++|+||+.+.++.|+|.+|+++.+|.+.+..+..|.|
T Consensus       175 ~leL~~Gsgvv~W~ip~t~Gv~P~pRESHTAViY~eKDs~~skmvvyGGM~G~RLgDLW~Ldl~Tl~W~kp~~~G~~PlP  254 (830)
T KOG4152|consen  175 ILELRPGSGVVAWDIPITYGVLPPPRESHTAVIYTEKDSKKSKMVVYGGMSGCRLGDLWTLDLDTLTWNKPSLSGVAPLP  254 (830)
T ss_pred             EEEeccCCceEEEecccccCCCCCCcccceeEEEEeccCCcceEEEEcccccccccceeEEecceeecccccccCCCCCC
Confidence            99998433 34599988899999999999999984 56668899999999999999999999999999999988999999


Q ss_pred             CceeeEEEECCEEEEEcCcccCCCcc-ccccccccceecCceEEeecCCCeeeecccc-cccCCCCCCCCCcceeeeCCE
Q psy1098         250 RSLHTACVIGDRMFIFGGWVPILKDE-SRSLHEKEWKCSNQLACLHLPEMTWEDLSVE-VTDDFLPKPRAGHCASVINSR  327 (390)
Q Consensus       250 r~~~~~~~~~~~i~i~GG~~~~~~~~-~~~~~~~~~~~~~~~~~~d~~~~~W~~v~~~-~~~~~~p~~r~~~~~~~~~~~  327 (390)
                      |+.|+++.++++||||||+.....++ ....++.+|+|.+.+-++++++..|+.+-.. ......|.+|.||+++.++.+
T Consensus       255 RSLHsa~~IGnKMyvfGGWVPl~~~~~~~~~hekEWkCTssl~clNldt~~W~tl~~d~~ed~tiPR~RAGHCAvAigtR  334 (830)
T KOG4152|consen  255 RSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTSSLACLNLDTMAWETLLMDTLEDNTIPRARAGHCAVAIGTR  334 (830)
T ss_pred             cccccceeecceeEEecceeeeeccccccccccceeeeccceeeeeecchheeeeeeccccccccccccccceeEEeccE
Confidence            99999999999999999998655433 4456889999999999999999999987543 223338999999999999999


Q ss_pred             EEEEeccCCccccccceeeeCeeEEEEecCCCCCCceeEEecccceEEEeccCccccceeee
Q psy1098         328 MYIWSGRDDYKKAWNNQVCCKDLWYLEVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAI  389 (390)
Q Consensus       328 l~v~GG~~~~~~~~~~~~~~~d~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  389 (390)
                      ||+..|.+++.+.+++.++++|+|.+++++|+.+.++|++++..+.++++|..++++|+|++
T Consensus       335 lYiWSGRDGYrKAwnnQVCCkDlWyLdTekPp~P~~VQL~rA~tNSlevsW~~V~ta~gYlL  396 (830)
T KOG4152|consen  335 LYIWSGRDGYRKAWNNQVCCKDLWYLDTEKPPPPARVQLVRANTNSLEVSWGAVATADGYLL  396 (830)
T ss_pred             EEEEeccchhhHhhccccchhhhhhhcccCCCCCceEEEEecccceeEEechhhccccceeE
Confidence            99999999999999999999999999999999999999999999999999999999999985

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
4go6_A45 Crystal Structure Of Hcf-1 Self-Association Sequenc 1e-05
>pdb|4GO6|A Chain A, Crystal Structure Of Hcf-1 Self-Association Sequence 1 Length = 45 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 25/36 (69%)
Query: 354 EVEKPGPPGRIQLVRAATNNLEICWPGHPIADSYAI 389
           E EKP PP R+QLVRA TN+LE+ W     ADSY +
Sbjct: 3   ETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLL 38

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-43
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-34
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-29
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-18
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-17
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-24
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-16
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 9e-07
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-15
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-14
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 2e-06
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-10
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-06
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-19
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 8e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-17
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 9e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-08
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 7e-17
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-14
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-14
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-13
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  157 bits (398), Expect = 9e-43
 Identities = 50/341 (14%), Positives = 94/341 (27%), Gaps = 52/341 (15%)

Query: 8   NCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIP 67
           N  V    ++       P  R         + +   GG N   V E+   +   ++  + 
Sbjct: 370 NLTVDEDYQL--LECECPINRKFGDVDVAGNDVFYMGGSNPYRVNEILQLSIHYDKIDMK 427

Query: 68  TLK---GDIPPG--CAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKP 122
            ++    ++P    C  +  +  N ++L+ GG     +  SD +       EW  +    
Sbjct: 428 NIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI---- 483

Query: 123 PRFGSPPCPRLGHSFTLIGN-KVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGHTT 181
               S    R  HS   + +  V + GG+                        +      
Sbjct: 484 ---KSLSHTRFRHSACSLPDGNVLILGGVTEGP--------------AMLLYNVTEEI-- 524

Query: 182 VWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGN-RLSD---LFMLDINSMTW 237
            +                    + D      +I+ GG      +SD   +F  D  + T 
Sbjct: 525 -FKDVTPKDEFFQNSLVSAGLEF-DPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATE 582

Query: 238 QKPQI--LGPQPLPRSLHTACVIGD-RMFIFGGWVPILKDESRSLHEKEWKCSNQLACLH 294
               I  L      R       I   ++ I GG  P             +  +N +  L 
Sbjct: 583 PITVIKKLQHPLFQRYGSQIKYITPRKLLIVGGTSP----------SGLFDRTNSIISLD 632

Query: 295 LPEMTWEDLSV-EVTDDFLPKPRAGHCASVINS-RMYIWSG 333
               T   + +     +      AG      +   ++I  G
Sbjct: 633 PLSETLTSIPISRRIWEDHSLMLAGFSLVSTSMGTIHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 98.24
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.84
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.67
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.66
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.66
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.32
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.26
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.23
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.21
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.1
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.04
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.03
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.03
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.95
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.87
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.78
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.74
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.72
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.63
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.43
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.32
3jrp_A379 Fusion protein of protein transport protein SEC13 96.21
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.18
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.15
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.11
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.08
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.01
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.93
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.88
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.86
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.83
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.76
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.73
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.62
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.53
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.51
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.5
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.46
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.46
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.45
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.41
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.38
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.37
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.35
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.27
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.26
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.12
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.11
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.1
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.08
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.08
3jrp_A379 Fusion protein of protein transport protein SEC13 95.08
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.06
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.99
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.89
3jro_A 753 Fusion protein of protein transport protein SEC13 94.72
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.71
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.7
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.68
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.59
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.49
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 94.39
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.35
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.3
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.25
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.1
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.1
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.08
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.91
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.79
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 93.78
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.75
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.57
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.55
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.43
3jro_A 753 Fusion protein of protein transport protein SEC13 93.31
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 93.24
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.24
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.17
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.9
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.7
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.47
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.4
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.3
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.27
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 91.98
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.96
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.94
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.87
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.8
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.79
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.78
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.63
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.56
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 91.53
3ott_A758 Two-component system sensor histidine kinase; beta 91.52
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.39
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.39
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.37
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.31
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 91.22
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.11
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.03
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 90.91
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 90.89
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 90.83
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 90.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.39
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 90.23
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.08
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 90.04
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 89.99
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 89.98
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 89.95
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 89.86
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 89.83
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 89.8
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 89.79
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 89.77
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 89.64
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 89.64
3ott_A758 Two-component system sensor histidine kinase; beta 89.28
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 89.15
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 88.72
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.48
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 88.44
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.06
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 87.89
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 87.22
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 87.19
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 87.11
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 87.06
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 86.76
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 86.45
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 86.26
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 86.14
1itv_A195 MMP9; adaptive molecular recognition, beta propell 85.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 85.87
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 85.86
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 85.64
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 85.63
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 85.42
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 84.83
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 84.81
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 84.74
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 84.6
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 84.31
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 84.29
2xyi_A430 Probable histone-binding protein CAF1; transcripti 84.14
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 84.01
1itv_A195 MMP9; adaptive molecular recognition, beta propell 83.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 83.5
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 82.96
2ymu_A577 WD-40 repeat protein; unknown function, two domain 82.9
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 82.62
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 82.34
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 81.89
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 81.68
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 81.59
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 81.57
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 81.57
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 81.5
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 81.44
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 81.01
2pm7_B297 Protein transport protein SEC13, protein transport 80.99
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.87
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 80.43
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 80.17
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 80.06
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 80.05
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=6.3e-45  Score=331.89  Aligned_cols=284  Identities=18%  Similarity=0.228  Sum_probs=233.1

Q ss_pred             CCCCCCceeeeEEeCCEEEEEccCCCCcccceEEEECCCCcEEeeeecCCCCCCCceeeEEEeCCEEEEEccee---CCc
Q psy1098          23 PQPRPRHGHRAVAIKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGMV---EYG   99 (390)
Q Consensus        23 ~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~---~~~   99 (390)
                      ..|.+|..|+++.++++||++||......+++++||+.+++|+.++   .+|.+|.+|+++..+++||++||..   ...
T Consensus        10 ~~~~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~   86 (308)
T 1zgk_A           10 SSGLVPRGSHAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGN   86 (308)
T ss_dssp             -----------CCCCCCEEEECCBSSSBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEE
T ss_pred             cCCeeeCCccccCCCCEEEEEeCcCCCCcceEEEEcCCCCeEeECC---CCCcccccceEEEECCEEEEECCCcCCCCCC
Confidence            4567899999999999999999986567889999999999999997   7899999999999999999999985   344


Q ss_pred             eeecceEEEEcCcceeEEecCCCCCCCCCCCCCccceEEEECCEEEEEcCccCCCCCCCCCCCccccccceeeeecCCCc
Q psy1098         100 KYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGGDETKPTPSYKYLDDFYTLELKSGH  179 (390)
Q Consensus       100 ~~~~~v~~~d~~~~~W~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~  179 (390)
                      ...+++++||+.+++|++++++       |.+|..|+++.++++||++||....           ...+++++||+.+  
T Consensus        87 ~~~~~~~~~d~~~~~W~~~~~~-------p~~r~~~~~~~~~~~iyv~GG~~~~-----------~~~~~~~~yd~~~--  146 (308)
T 1zgk_A           87 TDSSALDCYNPMTNQWSPCAPM-------SVPRNRIGVGVIDGHIYAVGGSHGC-----------IHHNSVERYEPER--  146 (308)
T ss_dssp             EECCCEEEEETTTTEEEECCCC-------SSCCBTCEEEEETTEEEEECCEETT-----------EECCCEEEEETTT--
T ss_pred             eecceEEEECCCCCeEeECCCC-------CcCccccEEEEECCEEEEEcCCCCC-----------cccccEEEECCCC--
Confidence            5678999999999999999875       5899999999999999999998764           6788999999987  


Q ss_pred             eeeeeccccCCCCCCCCceeeeEEeeccCCCcEEEEEcCCCCCc-cCcEEEEecCCCeEeecccCCCCCCCCceeeEEEE
Q psy1098         180 TTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGNR-LSDLFMLDINSMTWQKPQILGPQPLPRSLHTACVI  258 (390)
Q Consensus       180 ~~~W~~~~~~~~~p~~r~~~~~~~~~~~~~~~~i~v~GG~~~~~-~~~v~~~d~~~~~W~~~~~~~~~p~~r~~~~~~~~  258 (390)
                       ++|+.+   +++|.+|..|+++.+     +++||++||.++.. ++++++||+.+++|+.   ...+|.+|..|+++++
T Consensus       147 -~~W~~~---~~~p~~r~~~~~~~~-----~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~---~~~~p~~r~~~~~~~~  214 (308)
T 1zgk_A          147 -DEWHLV---APMLTRRIGVGVAVL-----NRLLYAVGGFDGTNRLNSAECYYPERNEWRM---ITAMNTIRSGAGVCVL  214 (308)
T ss_dssp             -TEEEEC---CCCSSCCBSCEEEEE-----TTEEEEECCBCSSCBCCCEEEEETTTTEEEE---CCCCSSCCBSCEEEEE
T ss_pred             -CeEeEC---CCCCccccceEEEEE-----CCEEEEEeCCCCCCcCceEEEEeCCCCeEee---CCCCCCccccceEEEE
Confidence             699984   468999999999998     99999999987654 7899999999999999   5578999999999999


Q ss_pred             CCEEEEEcCcccCCCccccccccccceecCceEEeecCCCeeeecccccccCCCCCCCCCcceeeeCCEEEEEeccCCcc
Q psy1098         259 GDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPKPRAGHCASVINSRMYIWSGRDDYK  338 (390)
Q Consensus       259 ~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~v~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~  338 (390)
                      +++|||+||.+...             ..+++++||+.+++|+++..      +|.+|.+|+++.++++|||+||.++..
T Consensus       215 ~~~iyv~GG~~~~~-------------~~~~v~~yd~~~~~W~~~~~------~p~~r~~~~~~~~~~~i~v~GG~~~~~  275 (308)
T 1zgk_A          215 HNCIYAAGGYDGQD-------------QLNSVERYDVETETWTFVAP------MKHRRSALGITVHQGRIYVLGGYDGHT  275 (308)
T ss_dssp             TTEEEEECCBCSSS-------------BCCCEEEEETTTTEEEECCC------CSSCCBSCEEEEETTEEEEECCBCSSC
T ss_pred             CCEEEEEeCCCCCC-------------ccceEEEEeCCCCcEEECCC------CCCCccceEEEEECCEEEEEcCcCCCc
Confidence            99999999986432             26899999999999999987      999999999999999999999987532


Q ss_pred             cc--ccceeeeCeeEEEEecCCCC
Q psy1098         339 KA--WNNQVCCKDLWYLEVEKPGP  360 (390)
Q Consensus       339 ~~--~~~~~~~~d~w~~~~~~~~~  360 (390)
                      ..  ...+.+.++.|....++|..
T Consensus       276 ~~~~v~~yd~~~~~W~~~~~~p~~  299 (308)
T 1zgk_A          276 FLDSVECYDPDTDTWSEVTRMTSG  299 (308)
T ss_dssp             BCCEEEEEETTTTEEEEEEECSSC
T ss_pred             ccceEEEEcCCCCEEeecCCCCCC
Confidence            11  11122334555555444443
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 0.003
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.7 bits (145), Expect = 5e-11
 Identities = 41/313 (13%), Positives = 84/313 (26%), Gaps = 53/313 (16%)

Query: 36  IKDLMLVFGGGNEGIVEELHVFNTATNQWFIPTLKGDIPPGCAAYGIVVDNTRVLIFGGM 95
           +  L+   GG     +  L  +N +   W       D+    +     V    +   GG 
Sbjct: 3   VGRLIYTAGGYFRQSLSYLEAYNPSNGTW---LRLADLQVPRSGLAGCVVGGLLYAVGG- 58

Query: 96  VEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGG 155
                 S D     ++   +  +  +         PR      +I   +Y  GG      
Sbjct: 59  ---RNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIH 115

Query: 156 DETKP-----TPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDE--- 207
             +          +  +    T  +  G   +  +    GG       ++A  +  E   
Sbjct: 116 HNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNE 175

Query: 208 -----------------YKNTKLIIYGGMSGNRLSDLFMLDINSMTWQKPQILGPQPLPR 250
                              +  +   GG  G     L  ++   +  +    + P    R
Sbjct: 176 WRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQ--DQLNSVERYDVETETWTFVAPMKHRR 233

Query: 251 SLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDD 310
           S     V   R+++ GG+                   + + C      TW +++      
Sbjct: 234 SALGITVHQGRIYVLGGY-------------DGHTFLDSVECYDPDTDTWSEVTR----- 275

Query: 311 FLPKPRAGHCASV 323
            +   R+G   +V
Sbjct: 276 -MTSGRSGVGVAV 287
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.01
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.57
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.56
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.38
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.03
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.98
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.6
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.46
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.32
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.16
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.11
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.08
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.03
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.9
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.52
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.4
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 91.73
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.64
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.37
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.3
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.22
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 90.86
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 90.39
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 90.34
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.01
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.74
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.38
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.32
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.08
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 87.74
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 86.86
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 86.52
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 86.33
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 82.17
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 81.65
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.38
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-39  Score=291.15  Aligned_cols=264  Identities=20%  Similarity=0.371  Sum_probs=230.7

Q ss_pred             CCCCCCCCCCceeEEecCCCCCCCCCCCceeeeEEeCCEEEEEccCCC-----CcccceEEEECCCCcEEeeeecCCCCC
Q psy1098           1 MDKLSDDNCPVYRWRRIDDPAGPQPRPRHGHRAVAIKDLMLVFGGGNE-----GIVEELHVFNTATNQWFIPTLKGDIPP   75 (390)
Q Consensus         1 ~~~~~~~~~~~~~W~~~~~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~-----~~~~~~~~~d~~~~~W~~~~~~~~~p~   75 (390)
                      ++++..||+.+++|++++    ++|.+|.+|++++++++|||+||.+.     ...+++++||+.+++|+.++   .+|.
T Consensus        18 ~~~~~~yd~~t~~W~~~~----~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~---~~p~   90 (288)
T d1zgka1          18 LSYLEAYNPSNGTWLRLA----DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA---PMSV   90 (288)
T ss_dssp             CCCEEEEETTTTEEEECC----CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECC---CCSS
T ss_pred             CceEEEEECCCCeEEECC----CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccc---cccc
Confidence            356778999999999997    78999999999999999999999542     24678999999999999988   7899


Q ss_pred             CCceeeEEEeCCEEEEEcceeCCceeecceEEEEcCcceeEEecCCCCCCCCCCCCCccceEEEECCEEEEEcCccCCCC
Q psy1098          76 GCAAYGIVVDNTRVLIFGGMVEYGKYSSDLYELQASKWEWKRLKPKPPRFGSPPCPRLGHSFTLIGNKVYLFGGLANSGG  155 (390)
Q Consensus        76 ~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~~d~~~~~W~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~  155 (390)
                      +|..|+++..+++||++||... ....++++.||+.++.|......       +.+|..|+++..++.++++||....  
T Consensus        91 ~r~~~~~~~~~~~i~~~gg~~~-~~~~~~~~~~~~~~~~~~~~~~~-------~~~r~~~~~~~~~~~~~~~GG~~~~--  160 (288)
T d1zgka1          91 PRNRIGVGVIDGHIYAVGGSHG-CIHHNSVERYEPERDEWHLVAPM-------LTRRIGVGVAVLNRLLYAVGGFDGT--  160 (288)
T ss_dssp             CCBTCEEEEETTEEEEECCEET-TEECCCEEEEETTTTEEEECCCC-------SSCCBSCEEEEETTEEEEECCBCSS--
T ss_pred             eecceeccccceeeEEecceec-ccccceeeeeccccCcccccccc-------ccccccceeeeeeecceEecCcccc--
Confidence            9999999999999999999864 45678899999999999987764       4789999999999999999998765  


Q ss_pred             CCCCCCCccccccceeeeecCCCceeeeeccccCCCCCCCCceeeeEEeeccCCCcEEEEEcCCCCC-ccCcEEEEecCC
Q psy1098         156 DETKPTPSYKYLDDFYTLELKSGHTTVWDMPGTYGGLPSPRESHTACSWTDEYKNTKLIIYGGMSGN-RLSDLFMLDINS  234 (390)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~d~~~~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~~~~~~i~v~GG~~~~-~~~~v~~~d~~~  234 (390)
                               ...++++.||+.+   ++|..   ....+..+..++++..     +++|+++||..+. .+++.++||+.+
T Consensus       161 ---------~~~~~~~~~d~~~---~~~~~---~~~~~~~~~~~~~~~~-----~~~i~i~GG~~~~~~~~~~~~~~~~~  220 (288)
T d1zgka1         161 ---------NRLNSAECYYPER---NEWRM---ITAMNTIRSGAGVCVL-----HNCIYAAGGYDGQDQLNSVERYDVET  220 (288)
T ss_dssp             ---------CBCCCEEEEETTT---TEEEE---CCCCSSCCBSCEEEEE-----TTEEEEECCBCSSSBCCCEEEEETTT
T ss_pred             ---------cccceEEEeeccc---ccccc---ccccccccccccccce-----eeeEEEecCccccccccceeeeeecc
Confidence                     5667899999876   68887   4456777888888888     8999999998765 478999999999


Q ss_pred             CeEeecccCCCCCCCCceeeEEEECCEEEEEcCcccCCCccccccccccceecCceEEeecCCCeeeecccccccCCCCC
Q psy1098         235 MTWQKPQILGPQPLPRSLHTACVIGDRMFIFGGWVPILKDESRSLHEKEWKCSNQLACLHLPEMTWEDLSVEVTDDFLPK  314 (390)
Q Consensus       235 ~~W~~~~~~~~~p~~r~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~v~~~~~~~~~p~  314 (390)
                      .+|+.   .+++|.+|..|++++++++|||+||.+...             ..+++++||+++++|+++.+      +|.
T Consensus       221 ~~~~~---~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~-------------~~~~v~~yd~~~~~W~~~~~------~p~  278 (288)
T d1zgka1         221 ETWTF---VAPMKHRRSALGITVHQGRIYVLGGYDGHT-------------FLDSVECYDPDTDTWSEVTR------MTS  278 (288)
T ss_dssp             TEEEE---CCCCSSCCBSCEEEEETTEEEEECCBCSSC-------------BCCEEEEEETTTTEEEEEEE------CSS
T ss_pred             eeeec---ccCccCcccceEEEEECCEEEEEecCCCCe-------------ecceEEEEECCCCEEEECCC------CCC
Confidence            99999   567899999999999999999999975432             36789999999999999998      999


Q ss_pred             CCCCcceee
Q psy1098         315 PRAGHCASV  323 (390)
Q Consensus       315 ~r~~~~~~~  323 (390)
                      +|.+|++|+
T Consensus       279 ~R~~~~~~~  287 (288)
T d1zgka1         279 GRSGVGVAV  287 (288)
T ss_dssp             CCBSCEEEE
T ss_pred             CcEeEEEEE
Confidence            999998876
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure