Psyllid ID: psy11065


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MCSIEFQQSRRWQQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSGANFDKLRSTVLANRS
cccHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEcccHHHHHHHHHcccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccEEEEEccccHHHHHHHHHcccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
mcsiefqqsrrwqqgigrnndnfgnmrefnengdgrggmWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQmreddpsdrrcmlsgspDQVQEARARIEELIDSVMVEqfsganfdKLRSTVLANRS
mcsiefqqsrrwqqgigrnndnfgnMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMReddpsdrrcmlsgspdQVQEARARIEELIDSVMVeqfsganfdklrstvlanrs
MCSIEFQQSRRWQQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCvpkaavgvvigkggDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSGANFDKLRSTVLANRS
**********************************GRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKL*****************************************LIDSVMVEQF*****************
**SI********************************************VCVPKAAVGVVIGKGGDMIKKLQNETGA***************RCMLSGSPDQVQEARARIEE***************************
**********RWQQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSGANFDKLRSTVLANRS
MCSIEFQQSRRWQQGIGRNNDN*********************WEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQF*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCSIEFQQSRRWQQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSGANFDKLRSTVLANRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q91WJ8 651 Far upstream element-bind yes N/A 0.724 0.153 0.392 2e-10
Q32PX7 639 Far upstream element-bind yes N/A 0.615 0.133 0.437 3e-10
Q96AE4 644 Far upstream element-bind yes N/A 0.724 0.155 0.383 1e-09
Q96I24 572 Far upstream element-bind no N/A 0.463 0.111 0.478 1e-09
Q92945 711 Far upstream element-bind no N/A 0.5 0.097 0.428 2e-08
Q3U0V1 748 Far upstream element-bind no N/A 0.5 0.092 0.428 2e-08
Q99PF5 721 Far upstream element-bind no N/A 0.731 0.140 0.372 3e-08
Q8UVD9 769 Far upstream element-bind no N/A 0.731 0.131 0.363 9e-08
O19049463 Heterogeneous nuclear rib no N/A 0.623 0.185 0.340 9e-07
Q9UNW9492 RNA-binding protein Nova- no N/A 0.528 0.148 0.346 3e-06
>sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 12/112 (10%)

Query: 7   QQSRRWQQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDM 66
           QQ++     + R+   F  +R  NE G   GG      E I V +P+ AVG+VIG+ G+M
Sbjct: 241 QQAKEMVLELIRDQGGFREVR--NEYGSRIGGN-----EGIDVPIPRFAVGIVIGRNGEM 293

Query: 67  IKKLQNETGARVQFVQMREDDPS--DRRCMLSGSPDQVQEARARIEELIDSV 116
           IKK+QN+ G R+QF   + DD +  DR   ++G PD+ Q A   I +L+ SV
Sbjct: 294 IKKIQNDAGVRIQF---KPDDGTTPDRIAQITGPPDRCQHAAEIITDLLRSV 342




Regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter. May act both as activator and repressor of transcription.
Mus musculus (taxid: 10090)
>sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 Back     alignment and function description
>sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 Back     alignment and function description
>sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 Back     alignment and function description
>sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 Back     alignment and function description
>sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 Back     alignment and function description
>sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 Back     alignment and function description
>sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 Back     alignment and function description
>sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 Back     alignment and function description
>sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
340728851 738 PREDICTED: far upstream element-binding 0.666 0.124 0.572 1e-21
350412234 736 PREDICTED: far upstream element-binding 0.666 0.125 0.572 1e-21
328783034 735 PREDICTED: far upstream element-binding 0.753 0.141 0.539 1e-21
307187117 690 Far upstream element-binding protein 1 [ 0.731 0.146 0.525 2e-21
270010095 756 hypothetical protein TcasGA2_TC009450 [T 0.463 0.084 0.739 2e-21
189238744 727 PREDICTED: similar to P-element somatic 0.463 0.088 0.739 2e-21
383858339 736 PREDICTED: far upstream element-binding 0.666 0.125 0.572 2e-21
307211366 751 Far upstream element-binding protein 1 [ 0.695 0.127 0.564 4e-21
322790271 744 hypothetical protein SINV_11556 [Solenop 0.615 0.114 0.565 6e-21
332023471 731 Far upstream element-binding protein 1 [ 0.739 0.139 0.508 7e-21
>gi|340728851|ref|XP_003402727.1| PREDICTED: far upstream element-binding protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (69%), Gaps = 11/103 (10%)

Query: 18  RNND---NFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNET 74
           R ND   N+ N   FN +G G       T + ++V VP+AAVGVVIGKGGDMIKK+Q ET
Sbjct: 280 RGNDRSGNYSNDSSFN-HGSG-------TTDGVEVLVPRAAVGVVIGKGGDMIKKIQAET 331

Query: 75  GARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVM 117
           GARVQF Q RED P DR+C++SG    V++ R RI+ELIDSVM
Sbjct: 332 GARVQFQQGREDGPGDRKCIVSGKHQAVEQVRQRIQELIDSVM 374




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350412234|ref|XP_003489579.1| PREDICTED: far upstream element-binding protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783034|ref|XP_624673.3| PREDICTED: far upstream element-binding protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307187117|gb|EFN72361.1| Far upstream element-binding protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270010095|gb|EFA06543.1| hypothetical protein TcasGA2_TC009450 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189238744|ref|XP_972178.2| PREDICTED: similar to P-element somatic inhibitor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383858339|ref|XP_003704659.1| PREDICTED: far upstream element-binding protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307211366|gb|EFN87498.1| Far upstream element-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322790271|gb|EFZ15270.1| hypothetical protein SINV_11556 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023471|gb|EGI63714.1| Far upstream element-binding protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0014870 806 Psi "P-element somatic inhibit 0.739 0.126 0.333 2.8e-09
UNIPROTKB|Q7JPS0 796 Psi "PSI" [Drosophila sp. (tax 0.760 0.131 0.336 4.5e-09
WB|WBGene00007534 611 C12D8.1 [Caenorhabditis elegan 0.427 0.096 0.412 7.4e-07
UNIPROTKB|Q17936 611 C12D8.1 "Protein C12D8.1, isof 0.427 0.096 0.412 7.4e-07
ZFIN|ZDB-GENE-030131-4357 666 khsrp "KH-type splicing regula 0.826 0.171 0.317 5.7e-06
UNIPROTKB|C9JSZ1232 FUBP1 "Far upstream element-bi 0.355 0.211 0.3 0.00011
UNIPROTKB|F1MX51 602 FUBP1 "Uncharacterized protein 0.724 0.166 0.321 0.00012
RGD|1591892 639 Fubp1 "far upstream element (F 0.724 0.156 0.321 0.00013
UNIPROTKB|Q32PX7 639 Fubp1 "Far upstream element-bi 0.724 0.156 0.321 0.00013
UNIPROTKB|J9P014 644 FUBP1 "Uncharacterized protein 0.724 0.155 0.321 0.00014
FB|FBgn0014870 Psi "P-element somatic inhibitor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 148 (57.2 bits), Expect = 2.8e-09, P = 2.8e-09
 Identities = 36/108 (33%), Positives = 54/108 (50%)

Query:    13 QQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCXXXXXXXXXXXXXXDMIKKLQN 72
             Q G G      G    FN   +G GG      E  +V               DMI+K+Q 
Sbjct:   303 QGGRGGGGGGGGPGMGFNNFNNGNGG------ESTEVFVPKIAVGVVIGKGGDMIRKIQT 356

Query:    73 ETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQ 120
             E G ++QF+Q + D+  DRRC++ G+  QV +A+  I+ LI++VMV +
Sbjct:   357 ECGCKLQFIQGKNDEMGDRRCVIQGTRQQVDDAKRTIDGLIENVMVSR 404




GO:0003729 "mRNA binding" evidence=IDA
GO:0048025 "negative regulation of mRNA splicing, via spliceosome" evidence=IMP;IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005685 "U1 snRNP" evidence=IPI
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0007283 "spermatogenesis" evidence=IMP
GO:0006397 "mRNA processing" evidence=IDA
GO:0048024 "regulation of mRNA splicing, via spliceosome" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|Q7JPS0 Psi "PSI" [Drosophila sp. (taxid:7242)] Back     alignment and assigned GO terms
WB|WBGene00007534 C12D8.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q17936 C12D8.1 "Protein C12D8.1, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4357 khsrp "KH-type splicing regulatory protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9JSZ1 FUBP1 "Far upstream element-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX51 FUBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1591892 Fubp1 "far upstream element (FUSE) binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PX7 Fubp1 "Far upstream element-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P014 FUBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-16
smart0032268 smart00322, KH, K homology RNA-binding domain 8e-16
pfam0001359 pfam00013, KH_1, KH domain 4e-15
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 9e-15
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-08
pfam1301442 pfam13014, KH_3, KH domain 1e-07
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 6e-06
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 1e-05
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 3e-05
COG1185692 COG1185, Pnp, Polyribonucleotide nucleotidyltransf 2e-04
cd0240968 cd02409, KH-II, KH-II (K homology RNA-binding doma 0.001
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
 Score = 68.7 bits (169), Expect = 1e-16
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 46  VIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEA 105
             +V VP + VG +IGKGG  IK+++ ETGA+++          +R   ++G+P+ V++A
Sbjct: 1   TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPD-SGSGSEERIVTITGTPEAVEKA 59

Query: 106 RARIE 110
           +  I 
Sbjct: 60  KELIL 64


KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64

>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG1676|consensus 600 99.77
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.64
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.58
KOG1676|consensus 600 99.55
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.53
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.51
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.48
KOG2192|consensus390 99.35
KOG2191|consensus 402 99.35
smart0032269 KH K homology RNA-binding domain. 99.31
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 99.3
KOG2190|consensus 485 99.27
PF1301443 KH_3: KH domain 99.22
KOG2191|consensus 402 99.15
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.1
KOG0119|consensus 554 99.09
KOG2193|consensus584 99.07
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.04
PRK13763180 putative RNA-processing protein; Provisional 99.04
PRK13763180 putative RNA-processing protein; Provisional 99.03
KOG2193|consensus 584 99.0
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.94
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 98.88
KOG2192|consensus 390 98.8
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 98.64
KOG1588|consensus259 98.63
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 98.62
KOG2190|consensus 485 98.54
KOG0336|consensus 629 98.32
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 98.32
KOG1067|consensus760 98.28
COG1094194 Predicted RNA-binding protein (contains KH domains 97.96
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 97.94
KOG2814|consensus 345 97.89
COG5176269 MSL5 Splicing factor (branch point binding protein 97.79
PRK12704 520 phosphodiesterase; Provisional 97.61
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 97.61
PRK00106 535 hypothetical protein; Provisional 97.58
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 97.54
KOG2113|consensus 394 97.44
COG1094194 Predicted RNA-binding protein (contains KH domains 97.24
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 96.89
KOG2113|consensus 394 96.68
KOG2279|consensus 608 96.67
PRK12705 508 hypothetical protein; Provisional 96.65
PRK0046875 hypothetical protein; Provisional 96.6
PRK0282177 hypothetical protein; Provisional 96.57
KOG2279|consensus 608 96.49
COG183776 Predicted RNA-binding protein (contains KH domain) 96.29
PRK0106478 hypothetical protein; Provisional 95.99
KOG4369|consensus 2131 95.81
KOG2208|consensus 753 95.78
PRK08406140 transcription elongation factor NusA-like protein; 95.7
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 95.51
PRK08406140 transcription elongation factor NusA-like protein; 95.38
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 95.07
COG1855604 ATPase (PilT family) [General function prediction 94.37
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 94.37
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 94.3
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 94.17
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 94.08
KOG2208|consensus 753 93.98
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 93.83
KOG3273|consensus252 93.82
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 93.79
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 93.66
PRK13764602 ATPase; Provisional 93.39
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 93.35
KOG2874|consensus 356 92.7
COG0195190 NusA Transcription elongation factor [Transcriptio 92.11
TIGR01953341 NusA transcription termination factor NusA. This m 91.57
PRK12328374 nusA transcription elongation factor NusA; Provisi 91.13
PRK06418166 transcription elongation factor NusA-like protein; 90.97
cd02412109 30S_S3_KH K homology RNA-binding (KH) domain of th 89.93
PRK12327362 nusA transcription elongation factor NusA; Provisi 89.52
cd0241185 archeal_30S_S3_KH K homology RNA-binding domain (K 89.05
PRK09202470 nusA transcription elongation factor NusA; Validat 88.64
COG1782 637 Predicted metal-dependent RNase, consists of a met 88.52
COG0092233 RpsC Ribosomal protein S3 [Translation, ribosomal 88.1
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 87.72
PRK12329449 nusA transcription elongation factor NusA; Provisi 86.97
COG0195190 NusA Transcription elongation factor [Transcriptio 86.32
TIGR00436270 era GTP-binding protein Era. Era is an essential G 80.3
>KOG1676|consensus Back     alignment and domain information
Probab=99.77  E-value=4.2e-18  Score=144.46  Aligned_cols=111  Identities=34%  Similarity=0.515  Sum_probs=90.0

Q ss_pred             hHHHHHHHHHHHhhcC--CCCCCCcCCCCCCCCCCCCCCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEec
Q psy11065          5 EFQQSRRWQQGIGRNN--DNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQ   82 (138)
Q Consensus         5 ~~~~ak~~v~~i~~~~--~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~   82 (138)
                      +||+||.||.+|++.-  ..++   +.++.+++.+     ...+.++.||..+||.||||+|++||+|+.+||+||+|.+
T Consensus       196 ~ve~a~~lV~dil~e~~~~~~g---~~~~~g~~~g-----~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkp  267 (600)
T KOG1676|consen  196 KVEQAKQLVADILREEDDEVPG---SGGHAGVRGG-----GSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKP  267 (600)
T ss_pred             HHHHHHHHHHHHHHhcccCCCc---cccccCcCcc-----ccceeEEeccccceeeEEecCchHHHHHhhccCceeEeec
Confidence            6899999999999952  2221   1122222211     1238999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcEEEEecCHHHHHHHHHHHHHHHHhhhhccCCC
Q psy11065         83 MREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSG  123 (138)
Q Consensus        83 ~~~~~~~~r~i~i~G~~e~i~~A~~~I~~ii~~~~~~~~g~  123 (138)
                      ++++.+-+|.+.|.|++++|.+|.++|.+||++......++
T Consensus       268 Dd~p~speR~~~IiG~~d~ie~Aa~lI~eii~~~~~~~~~~  308 (600)
T KOG1676|consen  268 DDDPSSPERPAQIIGTVDQIEHAAELINEIIAEAEAGAGGG  308 (600)
T ss_pred             CCCCCCccceeeeecCHHHHHHHHHHHHHHHHHHhccCCCC
Confidence            88754449999999999999999999999999998885443



>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1j4w_A174 Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si 2e-04
>pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 Back     alignment and structure

Iteration: 1

Score = 41.2 bits (95), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 5/54 (9%) Query: 65 DMIKKLQNETGARVQFVQMREDD--PSDRRCMLSGSPDQVQEARARIEELIDSV 116 +MIKK+QN+ G R+QF + DD +R ++G PD+ Q A I +L+ SV Sbjct: 23 EMIKKIQNDAGVRIQF---KPDDGTTPERIAQITGPPDRAQHAAEIITDLLRSV 73

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-24
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-20
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 8e-18
1j4w_A174 FUSE binding protein; single-stranded DNA binding 4e-20
1j4w_A174 FUSE binding protein; single-stranded DNA binding 3e-15
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 7e-20
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 8e-20
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 8e-20
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 8e-17
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 8e-20
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-19
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 5e-19
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 5e-19
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 7e-19
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 7e-17
1x4n_A92 FAR upstream element binding protein 1; KH domain, 8e-19
1x4m_A94 FAR upstream element binding protein 1; KH domain, 8e-19
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-18
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-16
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-18
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 6e-18
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-16
1we8_A104 Tudor and KH domain containing protein; structural 3e-16
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-16
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 6e-16
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-15
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-14
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 6e-14
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 6e-14
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 7e-12
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-09
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 1e-08
3n89_A376 Defective in GERM LINE development protein 3, ISO; 3e-05
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 2e-08
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 3e-08
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 2e-07
1tua_A191 Hypothetical protein APE0754; structural genomics, 8e-07
1tua_A191 Hypothetical protein APE0754; structural genomics, 7e-06
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 2e-06
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 3e-06
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 7e-06
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 8e-06
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 1e-05
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 6e-04
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
 Score = 88.7 bits (220), Expect = 4e-24
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 47  IQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEAR 106
           I V VP+ +VGVVIG+ G+MIKK+QN+ G R+QF Q     P ++   + G PD+ + A 
Sbjct: 13  IDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGP-EKIAHIMGPPDRCEHAA 71

Query: 107 ARIEELIDSVM 117
             I +L+ S+ 
Sbjct: 72  RIINDLLQSLR 82


>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.79
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.76
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.75
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.74
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.74
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.74
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.73
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.73
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.72
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.72
1we8_A104 Tudor and KH domain containing protein; structural 99.72
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.72
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.7
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.69
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.68
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.68
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.67
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.67
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.66
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.66
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.65
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.65
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.65
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.63
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.56
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.53
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.53
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.51
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 99.51
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.5
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.5
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 99.41
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.38
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.32
2cpq_A91 FragIle X mental retardation syndrome related prot 99.3
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 99.16
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 99.1
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.07
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 99.06
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.05
3n89_A376 Defective in GERM LINE development protein 3, ISO; 98.9
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 98.84
1tua_A191 Hypothetical protein APE0754; structural genomics, 98.76
1tua_A191 Hypothetical protein APE0754; structural genomics, 98.74
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.56
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 98.45
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 98.14
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 97.87
2cxc_A144 NUSA; transcription termination, RNA binding prote 94.66
2ba0_A229 Archeal exosome RNA binding protein RRP4; RNAse PH 93.1
2cxc_A144 NUSA; transcription termination, RNA binding prote 92.18
2asb_A251 Transcription elongation protein NUSA; protein-RNA 90.89
2z0s_A235 Probable exosome complex RNA-binding protein 1; al 90.56
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 89.12
1hh2_P344 NUSA, N utilization substance protein A; transcrip 88.97
2pt7_G152 HP1451, hypothetical protein; ATPase, protein-prot 87.33
1wh9_A92 40S ribosomal protein S3; KH domain, structural ge 87.3
2ja9_A175 Exosome complex exonuclease RRP40; RNA-binding pro 80.98
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
Probab=99.79  E-value=5.9e-19  Score=118.11  Aligned_cols=81  Identities=27%  Similarity=0.545  Sum_probs=71.1

Q ss_pred             CCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEecCCCCCCCCcEEEEecCHHHHHHHHHHHHHHHHhhhhc
Q psy11065         40 WEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVE  119 (138)
Q Consensus        40 ~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~~~~~~~~~r~i~i~G~~e~i~~A~~~I~~ii~~~~~~  119 (138)
                      .+....+.+|.||.+++|.|||++|++|++|+++|||+|+|+++.+. ..++.|+|.|+++++++|+.+|++++.+.+..
T Consensus        10 ~~~~~~~~~i~Ip~~~vG~IIGkgG~~Ik~I~~~tga~I~I~~~~~g-~~~r~v~I~G~~e~v~~A~~~I~~~i~~~~~~   88 (92)
T 1x4n_A           10 QQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGG-LPERSCMLTGTPESVQSAKRLLDQIVEKGRSG   88 (92)
T ss_dssp             CCCCCEEEEEEEEHHHHHHHHCSSSHHHHHHHHHSCCEEEECSCCTT-CSEEEEEEEECHHHHHHHHHHHHHHHHHTTCC
T ss_pred             CCCCCEEEEEEEChHHcceeECCCchHHHHHHHHhCCEEEEcCCCCC-CCccEEEEEeCHHHHHHHHHHHHHHHHhcccC
Confidence            34566899999999999999999999999999999999999886432 23799999999999999999999999987764


Q ss_pred             cC
Q psy11065        120 QF  121 (138)
Q Consensus       120 ~~  121 (138)
                      ..
T Consensus        89 p~   90 (92)
T 1x4n_A           89 PS   90 (92)
T ss_dssp             SS
T ss_pred             CC
Confidence            44



>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} Back     alignment and structure
>1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 Back     alignment and structure
>2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-18
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 3e-17
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 6e-17
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 5e-16
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 6e-16
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 1e-15
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-15
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-15
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 8e-15
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-14
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 2e-14
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-14
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 4e-14
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 5e-14
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-11
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 4e-11
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 1e-10
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-09
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 8e-09
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 8e-09
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 4e-08
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 4e-07
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 9e-07
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.8 bits (176), Expect = 2e-18
 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 45  EVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQE 104
            +I V +P+ AVG+VIG+ G+MIKK+QN+ G R+QF       P +R   ++G PD+ Q 
Sbjct: 3   HMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTP-ERIAQITGPPDRAQH 61

Query: 105 ARARIEELIDSV 116
           A   I +L+ SV
Sbjct: 62  AAEIITDLLRSV 73


>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.76
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.76
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.74
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.74
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.74
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.72
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.72
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.71
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.59
d2cpqa178 Fragile X mental retardation syndrome related prot 99.53
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 99.4
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 99.38
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.37
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 99.27
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 99.19
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.06
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 98.82
d2asba367 Transcription factor NusA, C-terminal domains {Myc 96.84
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 96.73
d1hh2p368 Transcription factor NusA, C-terminal domains {The 96.55
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 93.42
d2uubc1105 Ribosomal protein S3 N-terminal domain {Thermus th 87.76
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 87.1
d1wf3a2118 GTPase Era C-terminal domain {Thermus thermophilus 84.27
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Tudor and KH domain containing protein, Tdrkh
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76  E-value=1.5e-18  Score=116.86  Aligned_cols=83  Identities=28%  Similarity=0.374  Sum_probs=71.8

Q ss_pred             CCCCCCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEecCCCCC-CCCcEEEEecCHHHHHHHHHHHHHHHH
Q psy11065         36 RGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDD-PSDRRCMLSGSPDQVQEARARIEELID  114 (138)
Q Consensus        36 ~~~~~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~~~~~~-~~~r~i~i~G~~e~i~~A~~~I~~ii~  114 (138)
                      .+.....++.+.+|.||..++|+|||++|.+|++|+++|||+|.|++..... +.+|+++|+|++++|.+|+.+|.+++.
T Consensus         6 ~~~~~~~~~v~~~i~IP~~~vg~vIGk~G~~Ik~I~~~tga~I~i~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i~   85 (104)
T d1we8a_           6 SGILTENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVS   85 (104)
T ss_dssp             CCCCSSSCEEEEEEEEETTTHHHHHTTTSHHHHHHHHHHCCEEEECCSSCCSSSSEEEEEEEEEHHHHHHHHHHHHHHHH
T ss_pred             CCccCCCCCEEEEEEECHHHhcceECCCCcchHHHHHHcCCEEEECCCCCCCCCCccEEEEEeCHHHHHHHHHHHHHHHh
Confidence            3345677889999999999999999999999999999999999997754322 237899999999999999999999998


Q ss_pred             hhhh
Q psy11065        115 SVMV  118 (138)
Q Consensus       115 ~~~~  118 (138)
                      +...
T Consensus        86 e~~~   89 (104)
T d1we8a_          86 EDEE   89 (104)
T ss_dssp             HHHH
T ss_pred             CcHH
Confidence            7553



>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure