Psyllid ID: psy11065
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| 340728851 | 738 | PREDICTED: far upstream element-binding | 0.666 | 0.124 | 0.572 | 1e-21 | |
| 350412234 | 736 | PREDICTED: far upstream element-binding | 0.666 | 0.125 | 0.572 | 1e-21 | |
| 328783034 | 735 | PREDICTED: far upstream element-binding | 0.753 | 0.141 | 0.539 | 1e-21 | |
| 307187117 | 690 | Far upstream element-binding protein 1 [ | 0.731 | 0.146 | 0.525 | 2e-21 | |
| 270010095 | 756 | hypothetical protein TcasGA2_TC009450 [T | 0.463 | 0.084 | 0.739 | 2e-21 | |
| 189238744 | 727 | PREDICTED: similar to P-element somatic | 0.463 | 0.088 | 0.739 | 2e-21 | |
| 383858339 | 736 | PREDICTED: far upstream element-binding | 0.666 | 0.125 | 0.572 | 2e-21 | |
| 307211366 | 751 | Far upstream element-binding protein 1 [ | 0.695 | 0.127 | 0.564 | 4e-21 | |
| 322790271 | 744 | hypothetical protein SINV_11556 [Solenop | 0.615 | 0.114 | 0.565 | 6e-21 | |
| 332023471 | 731 | Far upstream element-binding protein 1 [ | 0.739 | 0.139 | 0.508 | 7e-21 |
| >gi|340728851|ref|XP_003402727.1| PREDICTED: far upstream element-binding protein 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 107 bits (268), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 59/103 (57%), Positives = 72/103 (69%), Gaps = 11/103 (10%)
Query: 18 RNND---NFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNET 74
R ND N+ N FN +G G T + ++V VP+AAVGVVIGKGGDMIKK+Q ET
Sbjct: 280 RGNDRSGNYSNDSSFN-HGSG-------TTDGVEVLVPRAAVGVVIGKGGDMIKKIQAET 331
Query: 75 GARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVM 117
GARVQF Q RED P DR+C++SG V++ R RI+ELIDSVM
Sbjct: 332 GARVQFQQGREDGPGDRKCIVSGKHQAVEQVRQRIQELIDSVM 374
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350412234|ref|XP_003489579.1| PREDICTED: far upstream element-binding protein 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328783034|ref|XP_624673.3| PREDICTED: far upstream element-binding protein 1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307187117|gb|EFN72361.1| Far upstream element-binding protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|270010095|gb|EFA06543.1| hypothetical protein TcasGA2_TC009450 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189238744|ref|XP_972178.2| PREDICTED: similar to P-element somatic inhibitor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383858339|ref|XP_003704659.1| PREDICTED: far upstream element-binding protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307211366|gb|EFN87498.1| Far upstream element-binding protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322790271|gb|EFZ15270.1| hypothetical protein SINV_11556 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332023471|gb|EGI63714.1| Far upstream element-binding protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| FB|FBgn0014870 | 806 | Psi "P-element somatic inhibit | 0.739 | 0.126 | 0.333 | 2.8e-09 | |
| UNIPROTKB|Q7JPS0 | 796 | Psi "PSI" [Drosophila sp. (tax | 0.760 | 0.131 | 0.336 | 4.5e-09 | |
| WB|WBGene00007534 | 611 | C12D8.1 [Caenorhabditis elegan | 0.427 | 0.096 | 0.412 | 7.4e-07 | |
| UNIPROTKB|Q17936 | 611 | C12D8.1 "Protein C12D8.1, isof | 0.427 | 0.096 | 0.412 | 7.4e-07 | |
| ZFIN|ZDB-GENE-030131-4357 | 666 | khsrp "KH-type splicing regula | 0.826 | 0.171 | 0.317 | 5.7e-06 | |
| UNIPROTKB|C9JSZ1 | 232 | FUBP1 "Far upstream element-bi | 0.355 | 0.211 | 0.3 | 0.00011 | |
| UNIPROTKB|F1MX51 | 602 | FUBP1 "Uncharacterized protein | 0.724 | 0.166 | 0.321 | 0.00012 | |
| RGD|1591892 | 639 | Fubp1 "far upstream element (F | 0.724 | 0.156 | 0.321 | 0.00013 | |
| UNIPROTKB|Q32PX7 | 639 | Fubp1 "Far upstream element-bi | 0.724 | 0.156 | 0.321 | 0.00013 | |
| UNIPROTKB|J9P014 | 644 | FUBP1 "Uncharacterized protein | 0.724 | 0.155 | 0.321 | 0.00014 |
| FB|FBgn0014870 Psi "P-element somatic inhibitor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 148 (57.2 bits), Expect = 2.8e-09, P = 2.8e-09
Identities = 36/108 (33%), Positives = 54/108 (50%)
Query: 13 QQGIGRNNDNFGNMREFNENGDGRGGMWEVTWEVIQVCXXXXXXXXXXXXXXDMIKKLQN 72
Q G G G FN +G GG E +V DMI+K+Q
Sbjct: 303 QGGRGGGGGGGGPGMGFNNFNNGNGG------ESTEVFVPKIAVGVVIGKGGDMIRKIQT 356
Query: 73 ETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQ 120
E G ++QF+Q + D+ DRRC++ G+ QV +A+ I+ LI++VMV +
Sbjct: 357 ECGCKLQFIQGKNDEMGDRRCVIQGTRQQVDDAKRTIDGLIENVMVSR 404
|
|
| UNIPROTKB|Q7JPS0 Psi "PSI" [Drosophila sp. (taxid:7242)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007534 C12D8.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17936 C12D8.1 "Protein C12D8.1, isoform b" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-4357 khsrp "KH-type splicing regulatory protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JSZ1 FUBP1 "Far upstream element-binding protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MX51 FUBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1591892 Fubp1 "far upstream element (FUSE) binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32PX7 Fubp1 "Far upstream element-binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P014 FUBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-16 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 8e-16 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 4e-15 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 9e-15 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 5e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-07 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 6e-06 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 1e-05 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 3e-05 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 2e-04 | |
| cd02409 | 68 | cd02409, KH-II, KH-II (K homology RNA-binding doma | 0.001 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
Score = 68.7 bits (169), Expect = 1e-16
Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
Query: 46 VIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEA 105
+V VP + VG +IGKGG IK+++ ETGA+++ +R ++G+P+ V++A
Sbjct: 1 TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPD-SGSGSEERIVTITGTPEAVEKA 59
Query: 106 RARIE 110
+ I
Sbjct: 60 KELIL 64
|
KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64 |
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| KOG1676|consensus | 600 | 99.77 | ||
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.64 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.58 | |
| KOG1676|consensus | 600 | 99.55 | ||
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.53 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.51 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.48 | |
| KOG2192|consensus | 390 | 99.35 | ||
| KOG2191|consensus | 402 | 99.35 | ||
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.31 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 99.3 | |
| KOG2190|consensus | 485 | 99.27 | ||
| PF13014 | 43 | KH_3: KH domain | 99.22 | |
| KOG2191|consensus | 402 | 99.15 | ||
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.1 | |
| KOG0119|consensus | 554 | 99.09 | ||
| KOG2193|consensus | 584 | 99.07 | ||
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.04 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.04 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.03 | |
| KOG2193|consensus | 584 | 99.0 | ||
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.94 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.88 | |
| KOG2192|consensus | 390 | 98.8 | ||
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.64 | |
| KOG1588|consensus | 259 | 98.63 | ||
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.62 | |
| KOG2190|consensus | 485 | 98.54 | ||
| KOG0336|consensus | 629 | 98.32 | ||
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.32 | |
| KOG1067|consensus | 760 | 98.28 | ||
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 97.96 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 97.94 | |
| KOG2814|consensus | 345 | 97.89 | ||
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 97.79 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 97.61 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 97.61 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 97.58 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.54 | |
| KOG2113|consensus | 394 | 97.44 | ||
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 97.24 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.89 | |
| KOG2113|consensus | 394 | 96.68 | ||
| KOG2279|consensus | 608 | 96.67 | ||
| PRK12705 | 508 | hypothetical protein; Provisional | 96.65 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.6 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.57 | |
| KOG2279|consensus | 608 | 96.49 | ||
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 96.29 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 95.99 | |
| KOG4369|consensus | 2131 | 95.81 | ||
| KOG2208|consensus | 753 | 95.78 | ||
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 95.7 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 95.51 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 95.38 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 95.07 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.37 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 94.37 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 94.3 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 94.17 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 94.08 | |
| KOG2208|consensus | 753 | 93.98 | ||
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 93.83 | |
| KOG3273|consensus | 252 | 93.82 | ||
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 93.79 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 93.66 | |
| PRK13764 | 602 | ATPase; Provisional | 93.39 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 93.35 | |
| KOG2874|consensus | 356 | 92.7 | ||
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 92.11 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 91.57 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 91.13 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 90.97 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 89.93 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 89.52 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 89.05 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 88.64 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 88.52 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 88.1 | |
| TIGR03675 | 630 | arCOG00543 arCOG00543 universal archaeal KH-domain | 87.72 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 86.97 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 86.32 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 80.3 |
| >KOG1676|consensus | Back alignment and domain information |
|---|
Probab=99.77 E-value=4.2e-18 Score=144.46 Aligned_cols=111 Identities=34% Similarity=0.515 Sum_probs=90.0
Q ss_pred hHHHHHHHHHHHhhcC--CCCCCCcCCCCCCCCCCCCCCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEec
Q psy11065 5 EFQQSRRWQQGIGRNN--DNFGNMREFNENGDGRGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQ 82 (138)
Q Consensus 5 ~~~~ak~~v~~i~~~~--~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~ 82 (138)
+||+||.||.+|++.- ..++ +.++.+++.+ ...+.++.||..+||.||||+|++||+|+.+||+||+|.+
T Consensus 196 ~ve~a~~lV~dil~e~~~~~~g---~~~~~g~~~g-----~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkp 267 (600)
T KOG1676|consen 196 KVEQAKQLVADILREEDDEVPG---SGGHAGVRGG-----GSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKP 267 (600)
T ss_pred HHHHHHHHHHHHHHhcccCCCc---cccccCcCcc-----ccceeEEeccccceeeEEecCchHHHHHhhccCceeEeec
Confidence 6899999999999952 2221 1122222211 1238999999999999999999999999999999999999
Q ss_pred CCCCCCCCcEEEEecCHHHHHHHHHHHHHHHHhhhhccCCC
Q psy11065 83 MREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVEQFSG 123 (138)
Q Consensus 83 ~~~~~~~~r~i~i~G~~e~i~~A~~~I~~ii~~~~~~~~g~ 123 (138)
++++.+-+|.+.|.|++++|.+|.++|.+||++......++
T Consensus 268 Dd~p~speR~~~IiG~~d~ie~Aa~lI~eii~~~~~~~~~~ 308 (600)
T KOG1676|consen 268 DDDPSSPERPAQIIGTVDQIEHAAELINEIIAEAEAGAGGG 308 (600)
T ss_pred CCCCCCccceeeeecCHHHHHHHHHHHHHHHHHHhccCCCC
Confidence 88754449999999999999999999999999998885443
|
|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG0119|consensus | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1588|consensus | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG1067|consensus | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG2814|consensus | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG3273|consensus | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >KOG2874|consensus | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 138 | ||||
| 1j4w_A | 174 | Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si | 2e-04 |
| >pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-24 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-20 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 8e-18 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 4e-20 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-15 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 7e-20 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 8e-20 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 8e-20 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 8e-17 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 8e-20 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 2e-19 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 5e-19 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 5e-19 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 7e-19 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 7e-17 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 8e-19 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 8e-19 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-18 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-16 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 5e-18 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 6e-18 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-16 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-16 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-16 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 6e-16 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 1e-15 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-14 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 6e-14 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 6e-14 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 7e-12 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 4e-09 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 1e-08 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 3e-05 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 2e-08 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 3e-08 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-08 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 2e-07 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 8e-07 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 7e-06 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 2e-06 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-06 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 7e-06 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 8e-06 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 1e-05 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 6e-04 |
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
Score = 88.7 bits (220), Expect = 4e-24
Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
Query: 47 IQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEAR 106
I V VP+ +VGVVIG+ G+MIKK+QN+ G R+QF Q P ++ + G PD+ + A
Sbjct: 13 IDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGP-EKIAHIMGPPDRCEHAA 71
Query: 107 ARIEELIDSVM 117
I +L+ S+
Sbjct: 72 RIINDLLQSLR 82
|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.79 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.76 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.75 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.74 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.74 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.74 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.73 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.73 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.72 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.72 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.72 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.72 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.7 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.69 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.68 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.68 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.67 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.67 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.66 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.66 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.65 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.65 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.65 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.63 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.56 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.53 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.53 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.51 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 99.51 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.5 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.5 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 99.41 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.38 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.32 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 99.3 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 99.16 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.1 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.07 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 99.06 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.05 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.9 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 98.84 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.76 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.74 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.56 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.45 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 98.14 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 97.87 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 94.66 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 93.1 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 92.18 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 90.89 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 90.56 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 89.12 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 88.97 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 87.33 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 87.3 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 80.98 |
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
Probab=99.79 E-value=5.9e-19 Score=118.11 Aligned_cols=81 Identities=27% Similarity=0.545 Sum_probs=71.1
Q ss_pred CCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEecCCCCCCCCcEEEEecCHHHHHHHHHHHHHHHHhhhhc
Q psy11065 40 WEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQEARARIEELIDSVMVE 119 (138)
Q Consensus 40 ~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~~~~~~~~~r~i~i~G~~e~i~~A~~~I~~ii~~~~~~ 119 (138)
.+....+.+|.||.+++|.|||++|++|++|+++|||+|+|+++.+. ..++.|+|.|+++++++|+.+|++++.+.+..
T Consensus 10 ~~~~~~~~~i~Ip~~~vG~IIGkgG~~Ik~I~~~tga~I~I~~~~~g-~~~r~v~I~G~~e~v~~A~~~I~~~i~~~~~~ 88 (92)
T 1x4n_A 10 QQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGG-LPERSCMLTGTPESVQSAKRLLDQIVEKGRSG 88 (92)
T ss_dssp CCCCCEEEEEEEEHHHHHHHHCSSSHHHHHHHHHSCCEEEECSCCTT-CSEEEEEEEECHHHHHHHHHHHHHHHHHTTCC
T ss_pred CCCCCEEEEEEEChHHcceeECCCchHHHHHHHHhCCEEEEcCCCCC-CCccEEEEEeCHHHHHHHHHHHHHHHHhcccC
Confidence 34566899999999999999999999999999999999999886432 23799999999999999999999999987764
Q ss_pred cC
Q psy11065 120 QF 121 (138)
Q Consensus 120 ~~ 121 (138)
..
T Consensus 89 p~ 90 (92)
T 1x4n_A 89 PS 90 (92)
T ss_dssp SS
T ss_pred CC
Confidence 44
|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 138 | ||||
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-18 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 3e-17 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 6e-17 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 5e-16 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 6e-16 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 1e-15 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-15 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 3e-15 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 8e-15 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-14 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-14 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-14 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 4e-14 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 5e-14 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 1e-11 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 4e-11 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 1e-10 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-09 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 8e-09 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 8e-09 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 4e-08 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 4e-07 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 9e-07 |
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.8 bits (176), Expect = 2e-18
Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 1/72 (1%)
Query: 45 EVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDDPSDRRCMLSGSPDQVQE 104
+I V +P+ AVG+VIG+ G+MIKK+QN+ G R+QF P +R ++G PD+ Q
Sbjct: 3 HMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTP-ERIAQITGPPDRAQH 61
Query: 105 ARARIEELIDSV 116
A I +L+ SV
Sbjct: 62 AAEIITDLLRSV 73
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.76 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.76 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.74 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.74 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.74 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.72 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.72 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.71 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.59 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.53 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 99.4 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.38 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.37 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 99.27 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.19 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.06 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.82 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 96.84 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 96.73 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.55 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 93.42 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 87.76 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 87.1 | |
| d1wf3a2 | 118 | GTPase Era C-terminal domain {Thermus thermophilus | 84.27 |
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Tudor and KH domain containing protein, Tdrkh species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76 E-value=1.5e-18 Score=116.86 Aligned_cols=83 Identities=28% Similarity=0.374 Sum_probs=71.8
Q ss_pred CCCCCCccceEEEEEecCCccceeeccCcHHHHHHHHHhCCeEEEecCCCCC-CCCcEEEEecCHHHHHHHHHHHHHHHH
Q psy11065 36 RGGMWEVTWEVIQVCVPKAAVGVVIGKGGDMIKKLQNETGARVQFVQMREDD-PSDRRCMLSGSPDQVQEARARIEELID 114 (138)
Q Consensus 36 ~~~~~~~~~~~~~i~IP~~~vg~IIGk~G~~Ik~I~~~Tga~I~I~~~~~~~-~~~r~i~i~G~~e~i~~A~~~I~~ii~ 114 (138)
.+.....++.+.+|.||..++|+|||++|.+|++|+++|||+|.|++..... +.+|+++|+|++++|.+|+.+|.+++.
T Consensus 6 ~~~~~~~~~v~~~i~IP~~~vg~vIGk~G~~Ik~I~~~tga~I~i~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i~ 85 (104)
T d1we8a_ 6 SGILTENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVS 85 (104)
T ss_dssp CCCCSSSCEEEEEEEEETTTHHHHHTTTSHHHHHHHHHHCCEEEECCSSCCSSSSEEEEEEEEEHHHHHHHHHHHHHHHH
T ss_pred CCccCCCCCEEEEEEECHHHhcceECCCCcchHHHHHHcCCEEEECCCCCCCCCCccEEEEEeCHHHHHHHHHHHHHHHh
Confidence 3345677889999999999999999999999999999999999997754322 237899999999999999999999998
Q ss_pred hhhh
Q psy11065 115 SVMV 118 (138)
Q Consensus 115 ~~~~ 118 (138)
+...
T Consensus 86 e~~~ 89 (104)
T d1we8a_ 86 EDEE 89 (104)
T ss_dssp HHHH
T ss_pred CcHH
Confidence 7553
|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|