Psyllid ID: psy11115
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| 328711508 | 721 | PREDICTED: peroxisomal multifunctional e | 0.660 | 0.185 | 0.555 | 3e-36 | |
| 322799331 | 721 | hypothetical protein SINV_11572 [Solenop | 0.640 | 0.180 | 0.528 | 6e-33 | |
| 383861721 | 727 | PREDICTED: peroxisomal multifunctional e | 0.650 | 0.181 | 0.524 | 2e-32 | |
| 328792111 | 727 | PREDICTED: peroxisomal multifunctional e | 0.660 | 0.184 | 0.5 | 5e-32 | |
| 91085817 | 715 | PREDICTED: similar to estradiol 17 beta- | 0.645 | 0.183 | 0.486 | 6e-32 | |
| 380017015 | 727 | PREDICTED: peroxisomal multifunctional e | 0.660 | 0.184 | 0.5 | 2e-31 | |
| 340718384 | 724 | PREDICTED: LOW QUALITY PROTEIN: peroxiso | 0.640 | 0.179 | 0.492 | 2e-31 | |
| 307197943 | 720 | Peroxisomal multifunctional enzyme type | 0.635 | 0.179 | 0.514 | 8e-31 | |
| 307186267 | 722 | Peroxisomal multifunctional enzyme type | 0.640 | 0.180 | 0.492 | 1e-30 | |
| 156554853 | 722 | PREDICTED: peroxisomal multifunctional e | 0.640 | 0.180 | 0.492 | 2e-30 |
| >gi|328711508|ref|XP_003244558.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 2 [Acyrthosiphon pisum] gi|328711510|ref|XP_003244559.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 157 bits (396), Expect = 3e-36, Method: Compositional matrix adjust.
Identities = 80/144 (55%), Positives = 104/144 (72%), Gaps = 10/144 (6%)
Query: 58 AILGFSVRHVLRQYAGNDPALFKSLKVRFAKPVLPGQTLRTDMWQESNRIHFQTSVAETN 117
A LG SVRH+L+Q+A ND LFKSLKVRF+KPV+PGQTL T MW+E NRIHF+TSV+ETN
Sbjct: 518 ATLGMSVRHILKQFADNDSKLFKSLKVRFSKPVVPGQTLCTSMWREGNRIHFKTSVSETN 577
Query: 118 QVVISGAYVDLKSSVQMRKTGATSRPPGATLHTHRVNAADDLISQAVFDGMLERVQADPS 177
V+SGAY++L ++R S P L + +V ++L S AVF GM ER++++PS
Sbjct: 578 DTVLSGAYMELH---EVR----LSAKPHVVLCSGKV---EELPSDAVFHGMKERIESNPS 627
Query: 178 LTKKVNGVFVYVILKNGKKADTWS 201
L K +NGVFVY I K+GK TW+
Sbjct: 628 LLKSINGVFVYHITKSGKVTSTWT 651
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322799331|gb|EFZ20719.1| hypothetical protein SINV_11572 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383861721|ref|XP_003706333.1| PREDICTED: peroxisomal multifunctional enzyme type 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328792111|ref|XP_393475.3| PREDICTED: peroxisomal multifunctional enzyme type 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|91085817|ref|XP_974784.1| PREDICTED: similar to estradiol 17 beta-dehydrogenase [Tribolium castaneum] gi|270011047|gb|EFA07495.1| hydroxysteroid (17-beta) dehydrogenase 4 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380017015|ref|XP_003692462.1| PREDICTED: peroxisomal multifunctional enzyme type 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340718384|ref|XP_003397648.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal multifunctional enzyme type 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307197943|gb|EFN79028.1| Peroxisomal multifunctional enzyme type 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307186267|gb|EFN71930.1| Peroxisomal multifunctional enzyme type 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156554853|ref|XP_001606624.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 203 | ||||||
| UNIPROTKB|Q6IN39 | 751 | Hsd17b4 "Hsd17b4 protein" [Rat | 0.635 | 0.171 | 0.472 | 7e-25 | |
| RGD|621806 | 735 | Hsd17b4 "hydroxysteroid (17-be | 0.625 | 0.172 | 0.471 | 1.4e-24 | |
| UNIPROTKB|E7EPL9 | 474 | HSD17B4 "(3R)-hydroxyacyl-CoA | 0.625 | 0.267 | 0.450 | 4.4e-24 | |
| UNIPROTKB|E2R4T5 | 754 | HSD17B4 "Uncharacterized prote | 0.699 | 0.188 | 0.433 | 5.1e-24 | |
| MGI|MGI:105089 | 735 | Hsd17b4 "hydroxysteroid (17-be | 0.625 | 0.172 | 0.464 | 6.2e-24 | |
| UNIPROTKB|G5E9S2 | 596 | HSD17B4 "Hydroxysteroid (17-be | 0.625 | 0.213 | 0.450 | 1e-23 | |
| UNIPROTKB|E2R4T7 | 737 | HSD17B4 "Uncharacterized prote | 0.699 | 0.192 | 0.427 | 1e-23 | |
| UNIPROTKB|E7ET17 | 599 | HSD17B4 "(3R)-hydroxyacyl-CoA | 0.625 | 0.212 | 0.450 | 1e-23 | |
| UNIPROTKB|F1NKH9 | 678 | HSD17B4 "Uncharacterized prote | 0.615 | 0.184 | 0.468 | 1.1e-23 | |
| UNIPROTKB|E7EWE5 | 712 | HSD17B4 "(3R)-hydroxyacyl-CoA | 0.625 | 0.178 | 0.450 | 1.6e-23 |
| UNIPROTKB|Q6IN39 Hsd17b4 "Hsd17b4 protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 293 (108.2 bits), Expect = 7.0e-25, P = 7.0e-25
Identities = 68/144 (47%), Positives = 89/144 (61%)
Query: 61 GFSVRHVLRQYAGNDPALFKSLKVRFAKPVLPGQTLRTDMWQESNRIHFQTSVAETNQVV 120
GFS RHVL+Q+A ND + FK++KVRFAKPV PGQTL+T+MW+E NRIHFQT V ET +V
Sbjct: 537 GFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIV 596
Query: 121 ISGAYVDLKSSVQMRKTGATSRPPGATLHTHRVNAADDLISQAVFDGMLERVQ-ADPSLT 179
IS AYVDL + +G +++ P + L S VF + R++ +
Sbjct: 597 ISNAYVDLVPT-----SGVSAQTP---------SEGGALQSALVFGEIGRRLKDVGREVV 642
Query: 180 KKVNGVFVYVILKNGKKADTWSKL 203
KKVN VF + I KNG A W +L
Sbjct: 643 KKVNAVFEWHITKNGNVAAKWMEL 666
|
|
| RGD|621806 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EPL9 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4T5 HSD17B4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105089 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E9S2 HSD17B4 "Hydroxysteroid (17-beta) dehydrogenase 4, isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4T7 HSD17B4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ET17 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NKH9 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EWE5 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| cd03448 | 122 | cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot | 7e-32 | |
| PLN02864 | 310 | PLN02864, PLN02864, enoyl-CoA hydratase | 2e-17 | |
| pfam01575 | 123 | pfam01575, MaoC_dehydratas, MaoC like domain | 3e-12 | |
| cd03441 | 127 | cd03441, R_hydratase_like, (R)-hydratase [(R)-spec | 2e-07 | |
| cd03447 | 126 | cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog | 6e-04 |
| >gnl|CDD|239532 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins | Back alignment and domain information |
|---|
Score = 111 bits (280), Expect = 7e-32
Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 8/90 (8%)
Query: 48 DPALFKS-GYPA-IL------GFSVRHVLRQYAGNDPALFKSLKVRFAKPVLPGQTLRTD 99
DPA K+ G+P IL GF+ R VL +A DPA FK++KVRF+ PV PG+TLRT+
Sbjct: 33 DPAFAKAAGFPRPILHGLCTYGFAARAVLEAFADGDPARFKAIKVRFSSPVFPGETLRTE 92
Query: 100 MWQESNRIHFQTSVAETNQVVISGAYVDLK 129
MW+E NR+ FQT V E + VV+S L
Sbjct: 93 MWKEGNRVIFQTKVVERDVVVLSNGAALLA 122
|
Other enzymes with this fold include MaoC dehydratase, and the fatty acid synthase beta subunit. Length = 122 |
| >gnl|CDD|178455 PLN02864, PLN02864, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|216580 pfam01575, MaoC_dehydratas, MaoC like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239525 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >gnl|CDD|239531 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| PLN02864 | 310 | enoyl-CoA hydratase | 99.94 | |
| cd03448 | 122 | HDE_HSD HDE_HSD The R-hydratase-like hot dog fold | 99.93 | |
| KOG1206|consensus | 272 | 99.92 | ||
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 99.9 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 99.83 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 99.82 | |
| PF01575 | 122 | MaoC_dehydratas: MaoC like domain; InterPro: IPR00 | 99.81 | |
| PRK13693 | 142 | (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro | 99.8 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 99.77 | |
| COG2030 | 159 | MaoC Acyl dehydratase [Lipid metabolism] | 99.77 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 99.76 | |
| cd03452 | 142 | MaoC_C MaoC_C The C-terminal hot dog fold of the M | 99.74 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 99.73 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 99.72 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 99.69 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 99.66 | |
| cd03450 | 149 | NodN NodN (nodulation factor N) contains a single | 99.66 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 99.57 | |
| TIGR02278 | 663 | PaaN-DH phenylacetic acid degradation protein paaN | 99.5 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 99.49 | |
| PRK11563 | 675 | bifunctional aldehyde dehydrogenase/enoyl-CoA hydr | 99.46 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 98.65 | |
| KOG4170|consensus | 113 | 98.51 | ||
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 98.4 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 98.31 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 98.19 | |
| PF13452 | 132 | MaoC_dehydrat_N: N-terminal half of MaoC dehydrata | 98.08 | |
| PRK13188 | 464 | bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl | 97.92 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 97.91 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 97.76 | |
| COG3777 | 273 | Uncharacterized conserved protein [Function unknow | 97.66 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 97.55 | |
| PF07977 | 138 | FabA: FabA-like domain; InterPro: IPR013114 Fatty | 97.43 | |
| COG0764 | 147 | FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca | 97.23 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 97.02 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 96.96 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 96.85 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 96.64 | |
| cd01287 | 150 | FabA FabA, beta-hydroxydecanoyl-acyl carrier prote | 96.63 | |
| TIGR01749 | 169 | fabA beta-hydroxyacyl-[acyl carrier protein] dehyd | 96.44 | |
| PRK05174 | 172 | 3-hydroxydecanoyl-(acyl carrier protein) dehydrata | 96.36 | |
| cd03445 | 94 | Thioesterase_II_repeat2 Thioesterase II (TEII) is | 96.29 | |
| cd01289 | 138 | FabA_like Domain of unknown function, appears to b | 96.17 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 95.99 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 95.96 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 95.78 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 95.17 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 94.98 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 94.84 | |
| COG5496 | 130 | Predicted thioesterase [General function predictio | 94.75 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 94.56 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 94.39 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 93.34 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 93.19 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 93.07 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 93.03 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 92.62 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 92.6 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 92.42 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 91.41 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 91.02 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 88.94 | |
| PRK10254 | 137 | thioesterase; Provisional | 88.63 | |
| PF12119 | 218 | DUF3581: Protein of unknown function (DUF3581); In | 87.39 | |
| KOG3328|consensus | 148 | 82.09 | ||
| PF10989 | 146 | DUF2808: Protein of unknown function (DUF2808); In | 80.26 |
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
Probab=99.94 E-value=4.4e-26 Score=203.24 Aligned_cols=115 Identities=34% Similarity=0.504 Sum_probs=104.5
Q ss_pred eEEeeccchhhHhhhhccCCCCCCChh--hhhhhhhhhhhcCCCCeeeehHHHHHHHHHHHHHHHHcCCCCceEEEEEEE
Q psy11115 8 YQVDLTRGNDQVYLSGLDHHQIGIHLG--FSVRHVLRQYAGNDPALFKSGYPAILGFSVRHVLRQYAGNDPALFKSLKVR 85 (203)
Q Consensus 8 ~~~~~~~~~~~~~~a~ldgD~npih~~--~a~~~~fa~~ag~~p~~IaHG~m~T~G~~ar~v~~~~~~gd~~~l~s~~vR 85 (203)
.+++..++++|++||++|||+||||.| ||+.. +|+++|+|| |||+|++.++++++++++++++++++++|
T Consensus 190 ~~~~~~t~~~~~~~a~lSGD~NPiH~d~~~A~~~-------gf~~~IaHG-m~t~g~~~~~~~~~~~~~~~~~~~~~~~r 261 (310)
T PLN02864 190 AVFEDQTQPSQALLYRLSGDYNPLHSDPMFAKVA-------GFTRPILHG-LCTLGFAVRAVIKCFCNGDPTAVKTISGR 261 (310)
T ss_pred eEEeeccChhHHHHHHhhCCCCcccCCHHHHhhC-------CCCCceecc-HHHHHHHHHHHHhhhcCCCCceEEEEEEE
Confidence 567789999999999999999999965 55444 469999999 99999999999999999999999999999
Q ss_pred eccccCCCCeEEEEEEEeCCEEEEEEEEeeCCcEEEeceEEEEeeC
Q psy11115 86 FAKPVLPGQTLRTDMWQESNRIHFQTSVAETNQVVISGAYVDLKSS 131 (203)
Q Consensus 86 F~~PV~PGDtL~v~~w~~g~~v~f~~~v~~~G~~VLsgg~a~l~~~ 131 (203)
|.+||+|||||++++|++++++.|++.++++|++||+| .++|++.
T Consensus 262 F~~PV~pGdtl~~~~~~~~~~v~~~~~~~~~g~~vl~G-~a~~~~~ 306 (310)
T PLN02864 262 FLLHVYPGETLVTEMWLEGLRVIYQTKVKERNKAVLSG-YVDLRHL 306 (310)
T ss_pred EcCCccCCCEEEEEEEeCCCEEEEEEEEecCCeEEEEE-EEEEecc
Confidence 99999999999999999999999999998899999987 8999855
|
|
| >cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins | Back alignment and domain information |
|---|
| >KOG1206|consensus | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes | Back alignment and domain information |
|---|
| >PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >COG2030 MaoC Acyl dehydratase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4170|consensus | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A | Back alignment and domain information |
|---|
| >PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >COG3777 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] | Back alignment and domain information |
|---|
| >COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site | Back alignment and domain information |
|---|
| >TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA | Back alignment and domain information |
|---|
| >PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated | Back alignment and domain information |
|---|
| >cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5496 Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >PF12119 DUF3581: Protein of unknown function (DUF3581); InterPro: IPR021974 This family consists of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG3328|consensus | Back alignment and domain information |
|---|
| >PF10989 DUF2808: Protein of unknown function (DUF2808); InterPro: IPR021256 This family of proteins with unknown function appears to be restricted to Cyanobacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 203 | ||||
| 3oml_A | 613 | Structure Of Full-Length Peroxisomal Multifunctiona | 2e-24 | ||
| 1s9c_A | 298 | Crystal Structure Analysis Of The 2-Enoyl-Coa Hydra | 1e-22 | ||
| 2cdh_S | 248 | Architecture Of The Thermomyces Lanuginosus Fungal | 2e-22 | ||
| 3kh8_A | 332 | Crystal Structure Of Maoc-Like Dehydratase From Phy | 7e-12 | ||
| 3khp_A | 311 | Crystal Structure Of A Possible Dehydrogenase From | 6e-05 | ||
| 1pn4_A | 280 | Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain | 1e-04 | ||
| 1pn2_A | 280 | Crystal Structure Analysis Of The Selenomethionine | 2e-04 |
| >pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 | Back alignment and structure |
|
| >pdb|1S9C|A Chain A, Crystal Structure Analysis Of The 2-Enoyl-Coa Hydratase 2 Domain Of Human Peroxisomal Multifunctional Enzyme Type 2 Length = 298 | Back alignment and structure |
| >pdb|2CDH|S Chain S, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 248 | Back alignment and structure |
| >pdb|3KH8|A Chain A, Crystal Structure Of Maoc-Like Dehydratase From Phytophthora Capsici Length = 332 | Back alignment and structure |
| >pdb|3KHP|A Chain A, Crystal Structure Of A Possible Dehydrogenase From Mycobacterium Tuberculosis At 2.3a Resolution Length = 311 | Back alignment and structure |
| >pdb|1PN4|A Chain A, Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Complexed With (3r)-Hydroxydecanoyl-Coa. Length = 280 | Back alignment and structure |
| >pdb|1PN2|A Chain A, Crystal Structure Analysis Of The Selenomethionine Labelled 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Length = 280 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 203 | |||
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 7e-33 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 1e-22 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 5e-21 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 5e-18 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 3e-16 | |
| 3bkr_A | 126 | Sterol carrier protein-2 like-3; mosquito, fatty a | 3e-07 | |
| 1pz4_A | 116 | Sterol carrier protein 2; alpha and beta, lipid bi | 2e-06 | |
| 1ikt_A | 120 | Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, | 8e-06 | |
| 1c44_A | 123 | Protein (sterol carrier protein 2); non specific l | 1e-04 |
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 | Back alignment and structure |
|---|
Score = 122 bits (309), Expect = 7e-33
Identities = 49/72 (68%), Positives = 61/72 (84%)
Query: 60 LGFSVRHVLRQYAGNDPALFKSLKVRFAKPVLPGQTLRTDMWQESNRIHFQTSVAETNQV 119
LGFSVR VL Q+A N+PALFK++KVRF+ PV+PGQTLR D+W++ RI+F+T V ET +
Sbjct: 530 LGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKE 589
Query: 120 VISGAYVDLKSS 131
VISGAYVDLKSS
Sbjct: 590 VISGAYVDLKSS 601
|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298 | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332 | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311 | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280 | Back alignment and structure |
|---|
| >3bkr_A Sterol carrier protein-2 like-3; mosquito, fatty acid, palmitic acid, cholesterol, lipid binding protein; HET: PLM; 1.40A {Aedes aegypti} PDB: 3bks_A* Length = 126 | Back alignment and structure |
|---|
| >1pz4_A Sterol carrier protein 2; alpha and beta, lipid binding protein; HET: PLM; 1.35A {Aedes aegypti} SCOP: d.106.1.1 PDB: 2ksh_A 2ksi_A* Length = 116 | Back alignment and structure |
|---|
| >1ikt_A Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, protein-triton X-100 complex, hydrophobic tunnel; HET: OXN; 1.75A {Homo sapiens} SCOP: d.106.1.1 Length = 120 | Back alignment and structure |
|---|
| >1c44_A Protein (sterol carrier protein 2); non specific lipid transfer protein, fatty acid binding, fatty acyl COA binding, lipid binding protein; 1.80A {Oryctolagus cuniculus} SCOP: d.106.1.1 PDB: 1qnd_A 2c0l_B Length = 123 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 99.91 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 99.9 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 99.89 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 99.88 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 99.88 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 99.85 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 99.83 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 99.83 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 99.8 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 99.79 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 99.77 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 99.76 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 99.73 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 99.7 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 99.65 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 99.64 | |
| 4e3e_A | 352 | MAOC domain protein dehydratase; structural genomi | 99.62 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 99.61 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 99.57 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 99.17 | |
| 1z6b_A | 154 | Pffabz, fatty acid synthesis protein; malaria, bet | 98.92 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 98.9 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 98.87 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 98.8 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 98.72 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 98.56 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 98.55 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 98.52 | |
| 3esi_A | 129 | Uncharacterized protein; protein from erwinia caro | 98.36 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 98.26 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 98.18 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 98.14 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 98.08 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 97.93 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 97.93 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 97.92 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 97.87 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 97.83 | |
| 1pz4_A | 116 | Sterol carrier protein 2; alpha and beta, lipid bi | 97.77 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 97.77 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 97.75 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 97.73 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 97.71 | |
| 3bkr_A | 126 | Sterol carrier protein-2 like-3; mosquito, fatty a | 97.69 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 97.6 | |
| 1ikt_A | 120 | Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, | 97.57 | |
| 3q62_A | 175 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 97.55 | |
| 4b0b_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 97.52 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 97.49 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 97.46 | |
| 1c44_A | 123 | Protein (sterol carrier protein 2); non specific l | 97.41 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 97.28 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 97.27 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 97.26 | |
| 4b8u_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 97.24 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 97.23 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 97.2 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 97.2 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 97.12 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 97.05 | |
| 2qzt_A | 111 | Sterol carrier protein 2-like 2; mosquito, fatty a | 97.0 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 96.96 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 96.93 | |
| 2cf2_C | 342 | Fatty acid synthase, DH domain; transferase, fatty | 96.84 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 96.81 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 96.8 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 96.78 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 96.77 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 96.76 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 96.69 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 96.69 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 96.68 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 96.63 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 96.6 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 96.57 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 96.34 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 96.32 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 96.32 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 96.28 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 96.25 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 96.2 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 96.08 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 96.07 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 95.96 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 95.9 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 95.76 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 95.69 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 95.67 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 95.67 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 95.66 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 95.6 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 95.48 | |
| 2cx7_A | 130 | Sterol carrier protein 2; sterol transfer, SCP-2, | 95.46 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 95.38 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 95.37 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 95.35 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 95.33 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 95.21 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 95.18 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 95.09 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 94.84 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 94.81 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 94.78 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 94.75 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 94.68 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 94.55 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 94.43 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 94.33 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 94.06 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 93.91 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 93.77 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 93.68 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 93.47 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 93.13 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 92.72 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 92.64 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 92.55 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 92.3 | |
| 1tbu_A | 118 | Peroxisomal acyl-coenzyme A thioester hydrolase 1; | 92.0 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 91.45 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 91.27 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 90.76 | |
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 90.62 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 88.85 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 88.64 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 88.52 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 88.43 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 87.49 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 87.29 | |
| 3lmb_A | 165 | Uncharacterized protein; protein OLEI01261, unknow | 86.37 |
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
Probab=99.91 E-value=2.2e-24 Score=192.54 Aligned_cols=117 Identities=26% Similarity=0.503 Sum_probs=105.5
Q ss_pred eEEeeccchhhHhhhhccCCCCCCChh--hhhhhhhhhhhcCCCCeeeehHHHHHHHHHHHHHHHHcCCCCceEEEEEEE
Q psy11115 8 YQVDLTRGNDQVYLSGLDHHQIGIHLG--FSVRHVLRQYAGNDPALFKSGYPAILGFSVRHVLRQYAGNDPALFKSLKVR 85 (203)
Q Consensus 8 ~~~~~~~~~~~~~~a~ldgD~npih~~--~a~~~~fa~~ag~~p~~IaHG~m~T~G~~ar~v~~~~~~gd~~~l~s~~vR 85 (203)
.+++..+.+++++||+++||+||||.| ||+.. +|+++|+|| |||++++.+++.++++++++.++.++++|
T Consensus 209 ~~~~~~t~~d~~~fa~lsGD~nPiH~D~~~A~~~-------gf~~~IaHG-~~t~al~~~~~~~~~~~~~~~~~~~~~~r 280 (332)
T 3kh8_A 209 FNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSV-------GFKQPILHG-LCSMGVASRALFKQFCGGDVARFKSIRVR 280 (332)
T ss_dssp EEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHHT-------TCSSCCCCH-HHHHHHHHHHHHHHHSTTCGGGEEEEEEE
T ss_pred eEEecCcHHHHHHHHHHhCCCCCCccCHHHHHhc-------CCCCceECH-HHHHHHHHHHHHHhhcCCCcceEEEEEEE
Confidence 467788999999999999999999965 44443 469999999 99999999999999989999999999999
Q ss_pred eccccCCCCeEEEEEEEeC-CEEEEEEEEeeCCcEEEeceEEEEeeCc
Q psy11115 86 FAKPVLPGQTLRTDMWQES-NRIHFQTSVAETNQVVISGAYVDLKSSV 132 (203)
Q Consensus 86 F~~PV~PGDtL~v~~w~~g-~~v~f~~~v~~~G~~VLsgg~a~l~~~~ 132 (203)
|.+||+|||||++++|+++ ++|.|+++++++|++||++|.+++.+..
T Consensus 281 F~~PV~~Gdtl~~~~~~~~~g~v~~~~~~~q~g~~Vl~~g~a~~~~p~ 328 (332)
T 3kh8_A 281 FSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDA 328 (332)
T ss_dssp ECSCCCTTCEEEEEEEECSTTEEEEEEEETTTTEEEEEEEEEEECCGG
T ss_pred EecccCCCCEEEEEEEEECCCEEEEEEEEccCCcEEEeCeEEEEecCC
Confidence 9999999999999999988 4799999998999999999999998654
|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >1pz4_A Sterol carrier protein 2; alpha and beta, lipid binding protein; HET: PLM; 1.35A {Aedes aegypti} SCOP: d.106.1.1 PDB: 2ksh_A 2ksi_A* | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >3bkr_A Sterol carrier protein-2 like-3; mosquito, fatty acid, palmitic acid, cholesterol, lipid binding protein; HET: PLM; 1.40A {Aedes aegypti} PDB: 3bks_A* | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >1ikt_A Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, protein-triton X-100 complex, hydrophobic tunnel; HET: OXN; 1.75A {Homo sapiens} SCOP: d.106.1.1 | Back alignment and structure |
|---|
| >3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A | Back alignment and structure |
|---|
| >4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1c44_A Protein (sterol carrier protein 2); non specific lipid transfer protein, fatty acid binding, fatty acyl COA binding, lipid binding protein; 1.80A {Oryctolagus cuniculus} SCOP: d.106.1.1 PDB: 1qnd_A 2c0l_B | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >2qzt_A Sterol carrier protein 2-like 2; mosquito, fatty acid, palmitic acid, cholesterol, lipid transport; HET: PLM; 1.70A {Aedes aegypti} PDB: 3bdq_A* | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2cx7_A Sterol carrier protein 2; sterol transfer, SCP-2, RSGI, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} PDB: 1wfr_A | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 203 | ||||
| d1s9ca1 | 126 | d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain | 2e-14 | |
| d1pn2a2 | 124 | d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain | 6e-10 | |
| d1ikta_ | 115 | d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (H | 1e-05 | |
| d1c44a_ | 123 | d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Ra | 1e-04 | |
| d1pz4a_ | 113 | d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Ye | 1e-04 |
| >d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: MaoC-like domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.8 bits (157), Expect = 2e-14
Identities = 46/70 (65%), Positives = 55/70 (78%)
Query: 59 ILGFSVRHVLRQYAGNDPALFKSLKVRFAKPVLPGQTLRTDMWQESNRIHFQTSVAETNQ 118
GFS R VL+Q+A ND + FK++K RFAKPV PGQTL+T+MW+E NRIHFQT V ET
Sbjct: 56 TFGFSARRVLQQFADNDVSRFKAVKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGD 115
Query: 119 VVISGAYVDL 128
+VIS AYVDL
Sbjct: 116 IVISNAYVDL 125
|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 124 | Back information, alignment and structure |
|---|
| >d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 123 | Back information, alignment and structure |
|---|
| >d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 113 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 203 | |||
| d1s9ca1 | 126 | 2-enoyl-coa hydratase domain of multifunctional pe | 99.96 | |
| d1pn2a2 | 124 | 2-enoyl-coa hydratase domain of multifunctional pe | 99.94 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 99.84 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 99.81 | |
| d2c2ia1 | 149 | Hypothetical protein Rv0130 {Mycobacterium tubercu | 99.67 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 99.66 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 99.65 | |
| d2bi0a2 | 152 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 99.53 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 98.79 | |
| d1ikta_ | 115 | SCP2-like domain of MFE-2 {Human (Homo sapiens) [T | 98.72 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 98.43 | |
| d1c44a_ | 123 | Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolag | 98.36 | |
| d1pz4a_ | 113 | Sterol carrier protein 2 (SCP2) {Yellow fever mosq | 98.22 | |
| d1z6ba1 | 146 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria | 97.92 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 97.81 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 97.71 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 97.63 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 97.5 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 97.4 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 97.24 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 97.19 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 97.03 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 96.93 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 96.61 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 96.43 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 96.25 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 96.24 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 96.12 | |
| d1mkaa_ | 171 | beta-Hydroxydecanol thiol ester dehydrase {Escheri | 96.05 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 96.04 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 96.03 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 95.84 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 95.78 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 95.66 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 95.63 | |
| d2q78a1 | 130 | Uncharacterized protein TM0581 {Thermotoga maritim | 95.45 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 95.35 | |
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 95.31 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 94.83 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 94.83 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 94.68 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 94.68 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 94.27 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 94.24 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 94.2 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 94.14 | |
| d1tbua1 | 104 | Peroxisomal long-chain acyl-CoA thioesterase 1, TE | 93.59 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 93.35 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 93.34 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 93.0 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 92.47 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 90.98 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 90.5 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 88.39 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 86.88 | |
| d2cfua1 | 126 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 82.38 |
| >d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: MaoC-like domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=3.6e-29 Score=191.64 Aligned_cols=114 Identities=46% Similarity=0.668 Sum_probs=105.1
Q ss_pred eEEeeccchhhHhhhhccCCCCCCChh--hhhhhhhhhhhcCCCCeeeehHHHHHHHHHHHHHHHHcCCCCceEEEEEEE
Q psy11115 8 YQVDLTRGNDQVYLSGLDHHQIGIHLG--FSVRHVLRQYAGNDPALFKSGYPAILGFSVRHVLRQYAGNDPALFKSLKVR 85 (203)
Q Consensus 8 ~~~~~~~~~~~~~~a~ldgD~npih~~--~a~~~~fa~~ag~~p~~IaHG~m~T~G~~ar~v~~~~~~gd~~~l~s~~vR 85 (203)
.++...+.+|+.+||++|||+||||.| ||+.. +|+++|+|| ||+++++.+.+.+++.++++.++.++++|
T Consensus 11 ~~~~~~~~~~~~~~~~lSGD~NPIH~D~~~Ak~~-------g~~~~IahG-~l~~a~~~~~~~~~~~~~~~~~~~~~~~r 82 (126)
T d1s9ca1 11 AVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLA-------GFDKPILHG-LCTFGFSARRVLQQFADNDVSRFKAVKAR 82 (126)
T ss_dssp EEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHTT-------TCSSCCCCH-HHHHHHHHHHHHHHHSTTCGGGEEEEEEE
T ss_pred eEEeeecChhHHHHHHHHCCCceeEeCHHHHhhc-------CCCCccchH-HHHHHHHHHHHHHHhcccCceeEEEEEeE
Confidence 678888999999999999999999964 55554 359999999 99999999999999988899999999999
Q ss_pred eccccCCCCeEEEEEEEeCCEEEEEEEEeeCCcEEEeceEEEEe
Q psy11115 86 FAKPVLPGQTLRTDMWQESNRIHFQTSVAETNQVVISGAYVDLK 129 (203)
Q Consensus 86 F~~PV~PGDtL~v~~w~~g~~v~f~~~v~~~G~~VLsgg~a~l~ 129 (203)
|.+||+|||+|+++.|++++++.|+++++++|++||+|+.++|.
T Consensus 83 F~~Pv~~gdtl~v~~~~~~~~v~~~~~~~~~g~~Vl~ga~~~la 126 (126)
T d1s9ca1 83 FAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLA 126 (126)
T ss_dssp ECSCCCTTCEEEEEEEEETTEEEEEEEETTTTEEEEEEEEEEEC
T ss_pred ECCCCCCCCEEEEEEEEcCCEEEEEEEEecCCeEEEeCeEEEeC
Confidence 99999999999999999999999999999999999999999873
|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} | Back information, alignment and structure |
|---|
| >d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|