Psyllid ID: psy11208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVNK
ccccccccccccccccccEEEcccccHHHHcccccccccccEEcEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHcccccEEccccccccccccccHHHHHHHHHHHcc
cccccccccccccccccccEEccccccHHHHHcccEEccccEEcEEEEEEccccEEEEEEEEcccEcccHHHHHHHHHHHHHcccccEEccccccccccEcccHHHHHHHHHHHcc
mclrslkkggliegTVTAKVLSsrnrrekedrigvliepagiplrglfiidpkgvlrqitvnvprtgktlFGYFTIRSVISsfglfsvcpanwkpdsptikpspaesKEYFNKVNK
mclrslkkggliegtvtakvlssrnrrekedrigvliepagiplrglFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANwkpdsptikpspaeskeyfnkvnk
MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVNK
*******************************RIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANW***********************
*CLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFN****
MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAE**********
*C********LIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q9Y7F0196 Peroxiredoxin TSA1 OS=Can N/A N/A 0.905 0.535 0.504 5e-20
P30048256 Thioredoxin-dependent per yes N/A 0.887 0.402 0.486 5e-20
Q5REY3256 Thioredoxin-dependent per yes N/A 0.887 0.402 0.478 1e-19
P20108257 Thioredoxin-dependent per yes N/A 0.896 0.404 0.473 6e-19
Q9Z0V6257 Thioredoxin-dependent per yes N/A 0.905 0.408 0.469 1e-18
P35705257 Thioredoxin-dependent per yes N/A 0.887 0.400 0.452 1e-17
Q21824226 Probable peroxiredoxin pr yes N/A 0.896 0.460 0.447 7e-16
Q90384200 Peroxiredoxin OS=Cynops p N/A N/A 0.913 0.53 0.445 2e-15
Q2PFZ3198 Peroxiredoxin-2 OS=Macaca N/A N/A 0.913 0.535 0.472 3e-15
P32119198 Peroxiredoxin-2 OS=Homo s no N/A 0.913 0.535 0.472 3e-15
>sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 66/113 (58%), Gaps = 8/113 (7%)

Query: 7   KKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVN---V 63
           K GG+  G V   VL+  N     D  GVLIE  G+ LRG+F+IDPKGVLRQIT+N   V
Sbjct: 89  KDGGI--GKVDFPVLADTNHSLSRD-YGVLIEEEGVALRGIFLIDPKGVLRQITINDLPV 145

Query: 64  PRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVNK 116
            R+ +              +G   VCPANW P   TIKPSP  SKEYFNKVNK
Sbjct: 146 GRSVEESLRLLEAFQFTEKYG--EVCPANWHPGDETIKPSPEASKEYFNKVNK 196
Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol.
Candida albicans (strain SC5314 / ATCC MYA-2876) (taxid: 237561)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 5
>sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens GN=PRDX3 PE=1 SV=3 Back     alignment and function description
>sp|Q5REY3|PRDX3_PONAB Thioredoxin-dependent peroxide reductase, mitochondrial OS=Pongo abelii GN=PRDX3 PE=2 SV=1 Back     alignment and function description
>sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus GN=Prdx3 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0V6|PRDX3_RAT Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus GN=Prdx3 PE=1 SV=2 Back     alignment and function description
>sp|P35705|PRDX3_BOVIN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Bos taurus GN=PRDX3 PE=1 SV=2 Back     alignment and function description
>sp|Q21824|TDX1_CAEEL Probable peroxiredoxin prdx-3 OS=Caenorhabditis elegans GN=prdx-3 PE=1 SV=1 Back     alignment and function description
>sp|Q90384|TDX_CYNPY Peroxiredoxin OS=Cynops pyrrhogaster PE=2 SV=1 Back     alignment and function description
>sp|Q2PFZ3|PRDX2_MACFA Peroxiredoxin-2 OS=Macaca fascicularis GN=PRDX2 PE=2 SV=3 Back     alignment and function description
>sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens GN=PRDX2 PE=1 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
193627312 239 PREDICTED: thioredoxin-dependent peroxid 0.896 0.435 0.508 1e-19
442749885 233 Putative alkyl hydroperoxide reductase t 0.887 0.442 0.513 1e-19
427787267 233 Putative alkyl hydroperoxide reductase t 0.887 0.442 0.522 2e-19
427787241 233 Putative alkyl hydroperoxide reductase t 0.887 0.442 0.522 2e-19
427787303 233 Putative alkyl hydroperoxide reductase t 0.887 0.442 0.522 2e-19
241785831 233 thioredoxin-dependent peroxide reductase 0.887 0.442 0.513 3e-19
67083703 233 mitochondrial truncated thioredoxin-depe 0.887 0.442 0.513 4e-19
62896877 256 peroxiredoxin 3 isoform a precursor vari 0.905 0.410 0.477 2e-18
391331172 225 PREDICTED: thioredoxin-dependent peroxid 0.887 0.457 0.504 2e-18
54696872 257 peroxiredoxin 3 [synthetic construct] gi 0.887 0.400 0.486 2e-18
>gi|193627312|ref|XP_001948034.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] gi|328698588|ref|XP_003240676.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 72/114 (63%), Gaps = 10/114 (8%)

Query: 7   KKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRT 66
           K GGL  G +   +LS  N+ E      VLIEP GIPLRGLFIIDPKG++RQIT+N    
Sbjct: 132 KHGGL--GGLCYPLLSDYNK-EIAKAYDVLIEPDGIPLRGLFIIDPKGIIRQITINDLPV 188

Query: 67  GKTLFGYFTIRSVISSFGLFS----VCPANWKPDSPTIKPSPAESKEYFNKVNK 116
           G+++     +  ++ +F        VCP NWKP+SPTIKP P  SKEYF KVNK
Sbjct: 189 GRSV---DEVLRLVQAFQFVDKHGEVCPMNWKPNSPTIKPDPNLSKEYFGKVNK 239

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|442749885|gb|JAA67102.1| Putative alkyl hydroperoxide reductase thiol specific antioxidant [Ixodes ricinus] Back     alignment and taxonomy information
>gi|427787267|gb|JAA59085.1| Putative alkyl hydroperoxide reductase thiol specific antioxidant [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427787241|gb|JAA59072.1| Putative alkyl hydroperoxide reductase thiol specific antioxidant [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427787303|gb|JAA59103.1| Putative alkyl hydroperoxide reductase thiol specific antioxidant [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|241785831|ref|XP_002400518.1| thioredoxin-dependent peroxide reductase [Ixodes scapularis] gi|215510786|gb|EEC20239.1| thioredoxin-dependent peroxide reductase [Ixodes scapularis] Back     alignment and taxonomy information
>gi|67083703|gb|AAY66786.1| mitochondrial truncated thioredoxin-dependent peroxide reductase precursor, partial [Ixodes scapularis] Back     alignment and taxonomy information
>gi|62896877|dbj|BAD96379.1| peroxiredoxin 3 isoform a precursor variant [Homo sapiens] Back     alignment and taxonomy information
>gi|391331172|ref|XP_003740024.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 1 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|54696872|gb|AAV38808.1| peroxiredoxin 3 [synthetic construct] gi|54696874|gb|AAV38809.1| peroxiredoxin 3 [synthetic construct] gi|61366442|gb|AAX42860.1| peroxiredoxin 3 [synthetic construct] gi|61366450|gb|AAX42861.1| peroxiredoxin 3 [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
CGD|CAL0005458196 TSA1 [Candida albicans (taxid: 0.922 0.545 0.495 1e-20
CGD|CAF0007120196 TSA1B [Candida albicans (taxid 0.922 0.545 0.495 1e-20
UNIPROTKB|Q9Y7F0196 TSA1 "Peroxiredoxin TSA1" [Can 0.922 0.545 0.495 1e-20
UNIPROTKB|E9PH29238 PRDX3 "Thioredoxin-dependent p 0.887 0.432 0.486 3.5e-20
UNIPROTKB|P30048256 PRDX3 "Thioredoxin-dependent p 0.887 0.402 0.486 3.5e-20
UNIPROTKB|E2RRD4257 PRDX3 "Uncharacterized protein 0.896 0.404 0.473 2.5e-19
MGI|MGI:88034257 Prdx3 "peroxiredoxin 3" [Mus m 0.896 0.404 0.473 2.5e-19
UNIPROTKB|E1BR10257 PRDX3 "Uncharacterized protein 0.879 0.396 0.473 3.1e-19
RGD|620040257 Prdx3 "peroxiredoxin 3" [Rattu 0.905 0.408 0.460 5.1e-19
UNIPROTKB|F1S418261 PRDX3 "Uncharacterized protein 0.896 0.398 0.456 6.5e-19
CGD|CAL0005458 TSA1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
 Score = 244 (91.0 bits), Expect = 1.0e-20, P = 1.0e-20
 Identities = 55/111 (49%), Positives = 66/111 (59%)

Query:     7 KKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRT 66
             K GG+  G V   VL+  N     D  GVLIE  G+ LRG+F+IDPKGVLRQIT+N    
Sbjct:    89 KDGGI--GKVDFPVLADTNHSLSRD-YGVLIEEEGVALRGIFLIDPKGVLRQITINDLPV 145

Query:    67 GKTLFGYFTIRSVISSFGLFS-VCPANWKPDSPTIKPSPAESKEYFNKVNK 116
             G+++     +         +  VCPANW P   TIKPSP  SKEYFNKVNK
Sbjct:   146 GRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK 196
GO:0030446 "hyphal cell wall" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0008379 "thioredoxin peroxidase activity" evidence=IGI;ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0031505 "fungal-type cell wall organization" evidence=IGI;IMP
GO:0042744 "hydrogen peroxide catabolic process" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0051701 "interaction with host" evidence=IPI
GO:0030985 "high molecular weight kininogen binding" evidence=IDA
GO:0009986 "cell surface" evidence=IDA
GO:0042542 "response to hydrogen peroxide" evidence=IMP
GO:0009277 "fungal-type cell wall" evidence=IDA
GO:0070301 "cellular response to hydrogen peroxide" evidence=IMP
GO:0030447 "filamentous growth" evidence=IMP
GO:0033554 "cellular response to stress" evidence=IGI
GO:0034599 "cellular response to oxidative stress" evidence=IEP;IGI;ISS
GO:0005829 "cytosol" evidence=IEA
GO:0005844 "polysome" evidence=IEA
GO:0043022 "ribosome binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0036170 "filamentous growth of a population of unicellular organisms in response to starvation" evidence=IGI;IMP
GO:0036171 "filamentous growth of a population of unicellular organisms in response to chemical stimulus" evidence=IGI;IMP
GO:0006457 "protein folding" evidence=IEA
GO:0010468 "regulation of gene expression" evidence=IEA
GO:0001302 "replicative cell aging" evidence=IEA
GO:0042262 "DNA protection" evidence=IEA
GO:0000077 "DNA damage checkpoint" evidence=IEA
GO:0033194 "response to hydroperoxide" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
CGD|CAF0007120 TSA1B [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y7F0 TSA1 "Peroxiredoxin TSA1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E9PH29 PRDX3 "Thioredoxin-dependent peroxide reductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30048 PRDX3 "Thioredoxin-dependent peroxide reductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRD4 PRDX3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:88034 Prdx3 "peroxiredoxin 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BR10 PRDX3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|620040 Prdx3 "peroxiredoxin 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S418 PRDX3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
PTZ00253199 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provi 2e-20
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational mo 6e-16
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, 5e-14
TIGR03137187 TIGR03137, AhpC, peroxiredoxin 6e-10
PRK13190202 PRK13190, PRK13190, putative peroxiredoxin; Provis 1e-05
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 3e-05
pfam1041740 pfam10417, 1-cysPrx_C, C-terminal domain of 1-Cys 1e-04
PRK15000200 PRK15000, PRK15000, peroxidase; Provisional 1e-04
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; c 2e-04
PRK10382187 PRK10382, PRK10382, alkyl hydroperoxide reductase 2e-04
>gnl|CDD|140280 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provisional Back     alignment and domain information 
 Score = 81.5 bits (201), Expect = 2e-20
 Identities = 50/116 (43%), Positives = 63/116 (54%), Gaps = 8/116 (6%)

Query: 3   LRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVN 62
           L+  KKGGL  GT+   +L+ + +       GVL E  G+  RGLFIIDPKG+LRQITVN
Sbjct: 89  LQERKKGGL--GTMAIPMLADKTKSIARS-YGVLEEEQGVAYRGLFIIDPKGMLRQITVN 145

Query: 63  ---VPRTGKTLFGYFTIRSVISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVN 115
              V R  + +         +   G   VCPANWK   PT+KP P +SKE F    
Sbjct: 146 DMPVGRNVEEVLRLLEAFQFVEKHG--EVCPANWKKGDPTMKPDPNKSKEGFFSKA 199

Length = 199
>gnl|CDD|223527 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239313 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>gnl|CDD|211789 TIGR03137, AhpC, peroxiredoxin Back     alignment and domain information
>gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|220741 pfam10417, 1-cysPrx_C, C-terminal domain of 1-Cys peroxiredoxin Back     alignment and domain information
>gnl|CDD|184962 PRK15000, PRK15000, peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|182423 PRK10382, PRK10382, alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG0852|consensus196 100.0
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.97
PRK15000200 peroxidase; Provisional 99.95
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.94
PTZ00253199 tryparedoxin peroxidase; Provisional 99.92
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.92
PRK13190202 putative peroxiredoxin; Provisional 99.92
PRK13191215 putative peroxiredoxin; Provisional 99.91
PRK13189222 peroxiredoxin; Provisional 99.91
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.88
PRK13599215 putative peroxiredoxin; Provisional 99.86
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.85
KOG0854|consensus224 99.75
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.73
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.56
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.1
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.0
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 98.91
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 98.87
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.77
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 98.67
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 98.66
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.65
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 98.63
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.53
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.5
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.4
KOG0855|consensus211 98.25
PF1041740 1-cysPrx_C: C-terminal domain of 1-Cys peroxiredox 98.22
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.17
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.11
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 98.05
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.99
PRK03147173 thiol-disulfide oxidoreductase; Provisional 97.95
PTZ00256183 glutathione peroxidase; Provisional 97.93
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 97.92
PLN02412167 probable glutathione peroxidase 97.87
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 97.65
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 97.65
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 97.65
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 97.6
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 97.55
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.46
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 97.29
cd02967114 mauD Methylamine utilization (mau) D family; mauD 97.02
PTZ00056199 glutathione peroxidase; Provisional 96.9
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 96.6
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 96.44
PRK13728181 conjugal transfer protein TrbB; Provisional 96.41
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 96.24
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.11
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 95.11
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 93.62
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 93.25
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 91.95
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 91.93
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 91.59
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 90.3
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 89.69
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 89.12
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 88.95
PF05176252 ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th 85.08
TIGR02740271 TraF-like TraF-like protein. This protein is relat 81.35
cd02958114 UAS UAS family; UAS is a domain of unknown functio 81.15
>KOG0852|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-33  Score=210.86  Aligned_cols=109  Identities=49%  Similarity=0.786  Sum_probs=106.6

Q ss_pred             CcccccccCCccccccceEEEEeCCChHHHHHhCCCccCCCCcceEEEEECCCCCEEEEEEccCCCCCCccHHHHHHHHH
Q psy11208          1 MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVI   80 (116)
Q Consensus         1 ~~~~~~~~~~~~~~~l~fpLLSD~~~~~vak~yGv~~~~~G~~~RatFIID~dG~I~~~~~~~~~~~r~~~e~~iL~~~l   80 (116)
                      |++++|+.||+  ..+++|||||.+.+ +++.|||+.++.|++.|++||||++|++|++.++..+++|.++|  +||. |
T Consensus        84 W~ntprk~gGl--g~~~iPllsD~~~~-IsrdyGvL~~~~G~~lRglfIId~~gi~R~it~NDlpvgRSVdE--~lRL-v  157 (196)
T KOG0852|consen   84 WINTPRKQGGL--GPLNIPLLSDLNHE-ISRDYGVLKEDEGIALRGLFIIDPDGILRQITINDLPVGRSVDE--TLRL-V  157 (196)
T ss_pred             HhcCchhhCCc--Cccccceeeccchh-hHHhcCceecCCCcceeeeEEEccccceEEeeecccCCCccHHH--HHHH-H
Confidence            99999999999  99999999999999 99999999999999999999999999999999999999999999  9999 9


Q ss_pred             hhhCcC----ccccCCCCCCCCCccCChhhHHHHhhhcc
Q psy11208         81 SSFGLF----SVCPANWKPDSPTIKPSPAESKEYFNKVN  115 (116)
Q Consensus        81 ~~l~~~----~~~p~~w~~g~~~~~~~~~~~~~~~~~~~  115 (116)
                      +++|..    ++|||||.||+++|+|+++.+|+||++++
T Consensus       158 qAfQ~td~~geVcPagW~pgs~tikp~~~~skeyf~k~~  196 (196)
T KOG0852|consen  158 QAFQFTDEHGEVCPAGWKPGSDTIKPDVKDSKEYFSKHN  196 (196)
T ss_pred             HHHhhhhccCccccCCCCCCCcccCCCcchhHHHHhhcC
Confidence            999998    99999999999999999999999999875

>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>KOG0854|consensus Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>KOG0855|consensus Back     alignment and domain information
>PF10417 1-cysPrx_C: C-terminal domain of 1-Cys peroxiredoxin; InterPro: IPR019479 This entry represents the C-terminal domain of 1-Cys peroxiredoxin, a member of the peroxiredoxin superfamily which protect cells against membrane oxidation through glutathione (GSH)-dependent reduction of phospholipid hydroperoxides to corresponding alcohols [] Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1zye_A220 Crystal Strucutre Analysis Of Bovine Mitochondrial 2e-17
1qmv_A197 Thioredoxin Peroxidase B From Red Blood Cells Lengt 2e-16
3sbc_A216 Crystal Structure Of Saccharomyces Cerevisiae Tsa1c 7e-16
1uul_A202 Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cr 6e-15
3tue_A219 The Structure Of Tryparedoxin Peroxidase I From Lei 8e-15
2z9s_A199 Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXI 9e-15
1qq2_A199 Crystal Structure Of A Mammalian 2-Cys Peroxiredoxi 9e-15
3tkp_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 1e-14
2pn8_A211 Crystal Structure Of Human Peroxiredoxin 4 (Thiored 1e-14
3tkr_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 1e-14
3tks_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 1e-14
3tjf_A254 Crystal Structure Of Human Peroxiredoxin Iv C51a Mu 2e-14
3tjb_A254 Crystal Structure Of Wild-Type Human Peroxiredoxin 2e-14
2rii_A199 Crystal Structure Of Human Peroxiredoxin I In Compl 9e-14
3qpm_A240 Crystal Structure Of Peroxiredoxin Prx4 From Pseudo 9e-14
3tjk_A254 Crystal Structure Of Human Peroxiredoxin Iv C245a M 2e-13
3tjj_A254 Crystal Structure Of Human Peroxiredoxin Iv C245a M 2e-13
3hy2_A206 Crystal Structure Of Sulfiredoxin In Complex With P 8e-13
3zvj_A219 Crystal Structure Of High Molecular Weight (Hmw) Fo 4e-09
3ztl_A222 Crystal Structure Of Decameric Form Of Peroxiredoxi 5e-09
3zvj_D219 Crystal Structure Of High Molecular Weight (Hmw) Fo 6e-09
2c0d_A221 Structure Of The Mitochondrial 2-Cys Peroxiredoxin 2e-08
1e2y_A188 Tryparedoxin Peroxidase From Crithidia Fasciculata 2e-07
1we0_A187 Crystal Structure Of Peroxiredoxin (Ahpc) From Amph 5e-06
2h66_A213 The Crystal Structure Of Plasmodium Vivax 2-Cys Per 1e-05
2h01_A192 Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I 2e-04
>pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii Length = 220 Back     alignment and structure 
Iteration: 1

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (60%), Gaps = 12/115 (10%)
Query: 7   KKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRT 66
           K GGL  G +   +LS   ++   D  GVL+E  G+ LRGLFIIDP GV++ ++VN    
Sbjct: 113 KNGGL--GHMNIALLSDLTKQISRDY-GVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPV 169
Query: 67  GKTLFGYFTIRSV-----ISSFGLFSVCPANWKPDSPTIKPSPAESKEYFNKVNK 116
           G+++    T+R V     + + G   V PANW P+SPTIKP P  S+EYF KVN+
Sbjct: 170 GRSVEE--TLRLVKAFQFVEAHG--EVSPANWTPESPTIKPHPTASREYFEKVNQ 220
>pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red Blood Cells Length = 197 Back     alignment and structure
>pdb|3SBC|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Tsa1c47s Mutant Protein Length = 216 Back     alignment and structure
>pdb|1UUL|A Chain A, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In The Reduced State Length = 202 Back     alignment and structure
>pdb|3TUE|A Chain A, The Structure Of Tryparedoxin Peroxidase I From Leishmania Major Length = 219 Back     alignment and structure
>pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant Length = 199 Back     alignment and structure
>pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. Length = 199 Back     alignment and structure
>pdb|3TKP|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In The Reduced Form Length = 246 Back     alignment and structure
>pdb|2PN8|A Chain A, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) Length = 211 Back     alignment and structure
>pdb|3TKR|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 With T118e Mutation Length = 246 Back     alignment and structure
>pdb|3TKS|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In Three Different Redox States Length = 246 Back     alignment and structure
>pdb|3TJF|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C51a Mutant In Reduced Form Length = 254 Back     alignment and structure
>pdb|3TJB|A Chain A, Crystal Structure Of Wild-Type Human Peroxiredoxin Iv Length = 254 Back     alignment and structure
>pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin Length = 199 Back     alignment and structure
>pdb|3QPM|A Chain A, Crystal Structure Of Peroxiredoxin Prx4 From Pseudosciaena Crocea Length = 240 Back     alignment and structure
>pdb|3TJK|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Reduced Form Length = 254 Back     alignment and structure
>pdb|3TJJ|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Sulfenylated Form Length = 254 Back     alignment and structure
>pdb|3HY2|A Chain A, Crystal Structure Of Sulfiredoxin In Complex With Peroxiredoxin I And Atp:mg2+ Length = 206 Back     alignment and structure
>pdb|3ZVJ|A Chain A, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 Back     alignment and structure
>pdb|3ZTL|A Chain A, Crystal Structure Of Decameric Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 222 Back     alignment and structure
>pdb|3ZVJ|D Chain D, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 Back     alignment and structure
>pdb|2C0D|A Chain A, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum Length = 221 Back     alignment and structure
>pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 Back     alignment and structure
>pdb|1WE0|A Chain A, Crystal Structure Of Peroxiredoxin (Ahpc) From Amphibacillus Xylanus Length = 187 Back     alignment and structure
>pdb|2H66|A Chain A, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin Length = 213 Back     alignment and structure
>pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I Length = 192 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 3e-28
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 1e-27
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 1e-27
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 1e-27
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 1e-27
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 4e-27
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 9e-27
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 7e-26
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 7e-25
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 1e-24
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 2e-24
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 1e-21
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin 6e-21
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 3e-20
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 3e-20
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 2e-19
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 2e-15
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 1e-14
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 3e-14
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 1e-13
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 2e-10
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Length = 220 Back     alignment and structure
 Score =  101 bits (253), Expect = 3e-28
 Identities = 44/91 (48%), Positives = 58/91 (63%), Gaps = 15/91 (16%)

Query: 34  GVLIEPAGIPLRGLFIIDPKGVLRQITVN---VPRTGKTLFGYFTIRSV-----ISSFGL 85
           GVL+E  G+ LRGLFIIDP GV++ ++VN   V R+ +      T+R V     + + G 
Sbjct: 137 GVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEE-----TLRLVKAFQFVEAHG- 190

Query: 86  FSVCPANWKPDSPTIKPSPAESKEYFNKVNK 116
             V PANW P+SPTIKP P  S+EYF KVN+
Sbjct: 191 -EVSPANWTPESPTIKPHPTASREYFEKVNQ 220
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 211 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Length = 202 Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Length = 197 Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Length = 216 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Length = 254 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Length = 240 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Length = 221 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Length = 192 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Length = 198 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Length = 213 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Length = 222 Back     alignment and structure
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Length = 186 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Length = 187 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Length = 233 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Length = 224 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Length = 249 Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Length = 220 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 100.0
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.97
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.91
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.9
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.87
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.87
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.87
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.86
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.86
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.84
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.84
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.83
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.83
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.83
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.83
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.79
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.75
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.72
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.69
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.65
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.48
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 99.48
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.45
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.34
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.24
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.19
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.12
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.11
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.04
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.01
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.99
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.99
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.98
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 98.98
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.97
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 98.96
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 98.93
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.93
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.92
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.92
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 98.89
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.89
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.88
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 98.84
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 98.81
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.78
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 98.62
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.57
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 98.41
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.34
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 98.34
4evm_A138 Thioredoxin family protein; structural genomics, n 98.3
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.28
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.24
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.2
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.19
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.19
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.14
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.14
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.12
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.1
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.07
2l5o_A153 Putative thioredoxin; structural genomics, unknown 98.05
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.04
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.0
2lrn_A152 Thiol:disulfide interchange protein; structural ge 97.99
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 97.99
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 97.96
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 97.96
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 97.89
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 97.86
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 97.83
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 97.82
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 97.81
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 97.79
2ls5_A159 Uncharacterized protein; structural genomics, unkn 96.99
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 97.77
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 97.77
3raz_A151 Thioredoxin-related protein; structural genomics, 97.75
2lrt_A152 Uncharacterized protein; structural genomics, thio 97.73
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 97.73
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 97.66
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 97.63
4h86_A199 Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch 97.62
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 97.51
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.3
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 97.26
3me7_A170 Putative uncharacterized protein; electron transfe 97.12
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 97.12
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.11
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 97.11
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 97.07
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 97.05
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 97.01
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.01
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 96.82
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 96.76
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 96.67
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 96.66
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 95.62
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 96.32
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 96.18
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 95.93
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 95.34
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 95.26
2l57_A126 Uncharacterized protein; structural genomics, unkn 95.2
2kuc_A130 Putative disulphide-isomerase; structural genomics 95.1
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 94.96
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 94.79
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 93.69
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 93.28
3f9u_A172 Putative exported cytochrome C biogenesis-related; 92.14
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 91.38
2l5l_A136 Thioredoxin; structural genomics, electron transpo 90.63
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 90.56
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 90.13
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 89.28
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 89.17
3ira_A173 Conserved protein; methanosarcina mazei,structural 88.35
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 88.25
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 87.55
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 87.37
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 87.12
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 86.72
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 86.26
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 86.19
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 86.12
2yzu_A109 Thioredoxin; redox protein, electron transport, st 85.79
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 85.52
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 85.49
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 85.45
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 85.08
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 85.0
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 84.49
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 84.44
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 84.41
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 83.64
4euy_A105 Uncharacterized protein; structural genomics, PSI- 83.64
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 83.24
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 82.09
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 82.03
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 81.74
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 81.66
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 81.3
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 81.11
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 80.8
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 80.26
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 80.02
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 80.56
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4.6e-34  Score=217.63  Aligned_cols=110  Identities=44%  Similarity=0.747  Sum_probs=105.6

Q ss_pred             CcccccccCCccccccceEEEEeCCChHHHHHhCCCccCCCCcceEEEEECCCCCEEEEEEccCCCCCCccHHHHHHHHH
Q psy11208          1 MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVI   80 (116)
Q Consensus         1 ~~~~~~~~~~~~~~~l~fpLLSD~~~~~vak~yGv~~~~~G~~~RatFIID~dG~I~~~~~~~~~~~r~~~e~~iL~~~l   80 (116)
                      |+++.+..+|+  .+++||||||++++ ++++||++.++.|++.|+|||||++|+|+++++++.+.+||++|  +||. |
T Consensus       103 w~~~~~~~~~~--~~l~fpllsD~~~~-vak~YGv~~~~~g~~~R~tFiID~~G~Ir~~~v~~~~~grn~dE--iLr~-l  176 (216)
T 3sbc_A          103 WTNIPRKEGGL--GPINIPLLADTNHS-LSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDE--ALRL-V  176 (216)
T ss_dssp             HHTSCGGGTCC--CSCSSCEEECTTSH-HHHHHTCEETTTTEECEEEEEECTTSBEEEEEEECTTBCCCHHH--HHHH-H
T ss_pred             HHHHHHHhCCc--cCcccceEeCCCCH-HHHHcCCeeccCCceeeEEEEECCCCeEEEEEEcCCCCCCCHHH--HHHH-H
Confidence            77888889999  89999999999999 99999999988899999999999999999999999999999999  9999 9


Q ss_pred             hhhCcC----ccccCCCCCCCCCccCChhhHHHHhhhccC
Q psy11208         81 SSFGLF----SVCPANWKPDSPTIKPSPAESKEYFNKVNK  116 (116)
Q Consensus        81 ~~l~~~----~~~p~~w~~g~~~~~~~~~~~~~~~~~~~~  116 (116)
                      ++||+.    ++|||||+||+++|+|+++.+++||++++|
T Consensus       177 ~AlQ~~~~~~~~~Pa~W~~G~~~i~p~~~~~~~~~~~~~~  216 (216)
T 3sbc_A          177 EAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK  216 (216)
T ss_dssp             HHHHHHHHHCCBBCTTCCTTSCCBCCSTTTHHHHHHHHCC
T ss_pred             HHhhhHhhcCCCcCCCCCCCCceecCCHHHHHHHHHHccC
Confidence            999966    899999999999999999999999999886
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d1qmva_197 c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredox 2e-20
d1uula_194 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 2e-19
d1xcca_219 c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoe 2e-09
d1n8ja_186 c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC 4e-09
d1prxa_220 c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sa 5e-09
d1e2ya_167 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 2e-06
d2zcta1237 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum perni 2e-06
d1zyea1158 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) 9e-06
d1we0a1166 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase 1e-05
d1xvwa1153 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c 2e-04
d2h01a1170 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thio 0.001
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Length = 197 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.8 bits (196), Expect = 2e-20
 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 34  GVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFT-IRSVISSFGLFSVCPAN 92
           GVL    GI  RGLFIID KGVLRQITVN    G+++      +++   +     VCPA 
Sbjct: 115 GVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAG 174

Query: 93  WKPDSPTIKPSPAESKEYFNKVN 115
           WKP S TIKP+  +SKEYF+K N
Sbjct: 175 WKPGSDTIKPNVDDSKEYFSKHN 197
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 219 Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Length = 186 Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Length = 167 Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Length = 237 Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Length = 166 Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 153 Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.97
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.97
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.95
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.94
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.94
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.91
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.86
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.75
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.75
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.7
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.63
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.61
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.36
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.24
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.07
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.03
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 98.97
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 98.95
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 98.93
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.88
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 98.86
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 98.85
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 98.77
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.61
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.58
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.5
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.34
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.25
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.18
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 97.99
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 97.96
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 97.96
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.21
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.54
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 95.88
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 94.33
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 94.16
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 90.25
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 89.38
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 87.95
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 87.19
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 85.47
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 81.78
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 81.07
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 80.4
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Tryparedoxin peroxidase (thioredoxin peroxidase homologue)
species: Trypanosoma cruzi [TaxId: 5693]

Probab=99.97  E-value=3.5e-32  Score=201.60  Aligned_cols=107  Identities=44%  Similarity=0.759  Sum_probs=101.1

Q ss_pred             CcccccccCCccccccceEEEEeCCChHHHHHhCCCccCCCCcceEEEEECCCCCEEEEEEccCCCCCCccHHHHHHHHH
Q psy11208          1 MCLRSLKKGGLIEGTVTAKVLSSRNRREKEDRIGVLIEPAGIPLRGLFIIDPKGVLRQITVNVPRTGKTLFGYFTIRSVI   80 (116)
Q Consensus         1 ~~~~~~~~~~~~~~~l~fpLLSD~~~~~vak~yGv~~~~~G~~~RatFIID~dG~I~~~~~~~~~~~r~~~e~~iL~~~l   80 (116)
                      |+...++.+++  .+++||+|||++++ ++++||++.+..|++.|+|||||++|+|+++++++...+||++|  +||. |
T Consensus        84 ~~~~~~~~~~~--~~l~fpllsD~~~~-v~~~ygv~~~~~~~~~R~tfvID~~G~I~~~~~~~~~~~r~~~E--~Lr~-l  157 (194)
T d1uula_          84 WTSIERKRGGL--GQMNIPILADKTKC-IMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDE--ALRL-V  157 (194)
T ss_dssp             HHHSCGGGTCC--CSCSSCEEECTTCH-HHHHHTCEETTTTEECEEEEEECTTSBEEEEEEECTTBCCCHHH--HHHH-H
T ss_pred             hhhhhhhhccc--cCCCcceeeCCcch-HHHHcCCeeccCCceEEEEEEECCCCeEEEEEEecCCCCcCHHH--HHHH-H
Confidence            56667788889  99999999999999 99999999988899999999999999999999999999999999  9999 9


Q ss_pred             hhhCcC----ccccCCCCCCCCCccCChhhHHHHhhh
Q psy11208         81 SSFGLF----SVCPANWKPDSPTIKPSPAESKEYFNK  113 (116)
Q Consensus        81 ~~l~~~----~~~p~~w~~g~~~~~~~~~~~~~~~~~  113 (116)
                      ++||+.    ++|||||+||+++|+|+|+.+++||++
T Consensus       158 ~alQ~~~~~~~~cp~~W~~g~~~~~p~~~~~~~~~~~  194 (194)
T d1uula_         158 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGA  194 (194)
T ss_dssp             HHHHHHHHHSCBBCTTCCTTSCCBCSSTGGGHHHHCC
T ss_pred             HHhhhHhhcCCCcCCCCCCCCccccCCHHHHHHHhcC
Confidence            999974    999999999999999999999999975
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure