Psyllid ID: psy1127
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| 328696664 | 307 | PREDICTED: elongation of very long chain | 0.8 | 0.169 | 0.788 | 1e-17 | |
| 328696668 | 308 | PREDICTED: elongation of very long chain | 0.8 | 0.168 | 0.788 | 1e-17 | |
| 91090562 | 325 | PREDICTED: similar to CG31522 CG31522-PB | 0.723 | 0.144 | 0.851 | 3e-16 | |
| 307188868 | 297 | Elongation of very long chain fatty acid | 0.753 | 0.164 | 0.775 | 5e-16 | |
| 307192488 | 344 | Elongation of very long chain fatty acid | 0.830 | 0.156 | 0.740 | 5e-16 | |
| 357614994 | 337 | hypothetical protein KGM_16370 [Danaus p | 0.846 | 0.163 | 0.709 | 7e-16 | |
| 156553618 | 335 | PREDICTED: elongation of very long chain | 0.8 | 0.155 | 0.711 | 8e-16 | |
| 390179110 | 340 | GA16297, isoform B [Drosophila pseudoobs | 0.723 | 0.138 | 0.829 | 8e-16 | |
| 195497090 | 364 | GE25348 [Drosophila yakuba] gi|194182055 | 0.723 | 0.129 | 0.829 | 9e-16 | |
| 194744853 | 395 | GF18506 [Drosophila ananassae] gi|190627 | 0.723 | 0.118 | 0.829 | 9e-16 |
| >gi|328696664|ref|XP_001943200.2| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform 1 [Acyrthosiphon pisum] gi|328696666|ref|XP_003240093.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 94.0 bits (232), Expect = 1e-17, Method: Compositional matrix adjust.
Identities = 41/52 (78%), Positives = 47/52 (90%)
Query: 8 IQFVLIMVHAFQLLFIDCNFPKAFVWWIGSHAVMFFFLFRNFYKEQYVKPVK 59
+QF+ IM+HAFQLLFIDCN+PKAFVWWIG HAVMFFFLF+ FYK+QY KP K
Sbjct: 208 LQFLAIMLHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFKEFYKQQYTKPAK 259
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328696668|ref|XP_003240094.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91090562|ref|XP_971599.1| PREDICTED: similar to CG31522 CG31522-PB [Tribolium castaneum] gi|270013347|gb|EFA09795.1| hypothetical protein TcasGA2_TC011937 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307188868|gb|EFN73421.1| Elongation of very long chain fatty acids protein AAEL008004 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307192488|gb|EFN75681.1| Elongation of very long chain fatty acids protein AAEL008004 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|357614994|gb|EHJ69416.1| hypothetical protein KGM_16370 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|156553618|ref|XP_001600048.1| PREDICTED: elongation of very long chain fatty acids protein AAEL008004-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|390179110|ref|XP_003736807.1| GA16297, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859717|gb|EIM52880.1| GA16297, isoform B [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195497090|ref|XP_002095954.1| GE25348 [Drosophila yakuba] gi|194182055|gb|EDW95666.1| GE25348 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194744853|ref|XP_001954907.1| GF18506 [Drosophila ananassae] gi|190627944|gb|EDV43468.1| GF18506 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| FB|FBgn0051522 | 365 | CG31522 [Drosophila melanogast | 0.723 | 0.128 | 0.829 | 8.4e-19 | |
| UNIPROTKB|Q1HRV8 | 358 | AAEL008004 "Elongation of very | 0.723 | 0.131 | 0.787 | 2.4e-17 | |
| FB|FBgn0037534 | 329 | CG2781 [Drosophila melanogaste | 0.753 | 0.148 | 0.68 | 4.3e-14 | |
| FB|FBgn0051523 | 354 | CG31523 [Drosophila melanogast | 0.8 | 0.146 | 0.538 | 7.3e-12 | |
| FB|FBgn0038986 | 295 | CG5278 [Drosophila melanogaste | 0.846 | 0.186 | 0.418 | 7.2e-07 | |
| UNIPROTKB|J9PBB9 | 314 | ELOVL4 "Uncharacterized protei | 0.830 | 0.171 | 0.418 | 8e-06 | |
| RGD|1305630 | 314 | Elovl4 "ELOVL fatty acid elong | 0.815 | 0.168 | 0.396 | 8e-06 | |
| UNIPROTKB|F1NXS3 | 280 | ELOVL4 "Uncharacterized protei | 0.846 | 0.196 | 0.396 | 8.2e-06 | |
| UNIPROTKB|I3LVJ0 | 304 | LOC100623120 "Uncharacterized | 0.830 | 0.177 | 0.418 | 9.7e-06 | |
| UNIPROTKB|Q9GZR5 | 314 | ELOVL4 "Elongation of very lon | 0.8 | 0.165 | 0.423 | 1e-05 |
| FB|FBgn0051522 CG31522 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 228 (85.3 bits), Expect = 8.4e-19, P = 8.4e-19
Identities = 39/47 (82%), Positives = 42/47 (89%)
Query: 8 IQFVLIMVHAFQLLFIDCNFPKAFVWWIGSHAVMFFFLFRNFYKEQY 54
+QF+LIMVHAFQLLFIDCN+PKAFVWWIG HAVMFFFLF FYK Y
Sbjct: 212 VQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAY 258
|
|
| UNIPROTKB|Q1HRV8 AAEL008004 "Elongation of very long chain fatty acids protein AAEL008004" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037534 CG2781 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051523 CG31523 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038986 CG5278 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PBB9 ELOVL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1305630 Elovl4 "ELOVL fatty acid elongase 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXS3 ELOVL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVJ0 LOC100623120 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GZR5 ELOVL4 "Elongation of very long chain fatty acids protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| pfam01151 | 244 | pfam01151, ELO, GNS1/SUR4 family | 0.001 |
| >gnl|CDD|216332 pfam01151, ELO, GNS1/SUR4 family | Back alignment and domain information |
|---|
Score = 34.5 bits (80), Expect = 0.001
Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
Query: 8 IQFVLIMVHAFQLLFI----DCNFPKAFVWWIG-SHAVMFFFLFRNFYKEQYVKPVKTAK 62
IQFVL + H L+ C P +G + V + FLF NFY + Y KP K K
Sbjct: 185 IQFVLGLAHVGYALYNYTKGGCGGPFPKAVRLGLVYYVSYLFLFLNFYIKSYKKPKKKKK 244
|
Members of this family are involved in long chain fatty acid elongation systems that produce the 26-carbon precursors for ceramide and sphingolipid synthesis. Predicted to be integral membrane proteins, in eukaryotes they are probably located on the endoplasmic reticulum. Yeast ELO3 affects plasma membrane H+-ATPase activity, and may act on a glucose-signaling pathway that controls the expression of several genes that are transcriptionally regulated by glucose such as PMA1. Length = 244 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| PF01151 | 250 | ELO: GNS1/SUR4 family; InterPro: IPR002076 This gr | 99.74 | |
| PTZ00251 | 272 | fatty acid elongase; Provisional | 99.69 | |
| KOG3071|consensus | 274 | 99.63 | ||
| KOG3072|consensus | 282 | 99.09 |
| >PF01151 ELO: GNS1/SUR4 family; InterPro: IPR002076 This group of eukaryotic integral membrane proteins are evolutionary related, but exact function has not yet clearly been established | Back alignment and domain information |
|---|
Probab=99.74 E-value=6.3e-18 Score=110.95 Aligned_cols=61 Identities=33% Similarity=0.520 Sum_probs=56.1
Q ss_pred hHHHHHHHHHHHHHHHHHHHhh------cC---CCcHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCC
Q psy1127 2 RAVYISIQFVLIMVHAFQLLFI------DC---NFPKAFVWWIGSHAVMFFFLFRNFYKEQYVKPVKTAK 62 (65)
Q Consensus 2 iT~~QiiQF~~~~~~~~~~~~~------~C---~~p~~~~~~~~~~~~s~l~LF~~FY~~sY~~~~~~~~ 62 (65)
||.+||+||++++++..+.... || ++|+....++.++++++++||.|||+|+|.+|+++||
T Consensus 181 IT~~Qi~QF~~~~~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~s~l~LF~~Fy~~~Y~~~~~~k~ 250 (250)
T PF01151_consen 181 ITSLQIVQFVIGIVHTVYALYYYFFPGGDCDTSGYPKFNAILGLVYYVSYLYLFINFYIKSYIKKKKKKK 250 (250)
T ss_pred HhHHhhhhhHHHHHHHHHHhheeccCCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHhCcCCCCCC
Confidence 8999999999999998887754 89 7789999999999999999999999999999888775
|
The proteins have from 290 to 435 amino acid residues. Structurally, they seem to be formed of three sections: a N-terminal region with two transmembrane domains, a central hydrophilic loop and a C-terminal region that contains from one to three transmembrane domains. Members of this family are involved in long chain fatty acid elongation systems that produce the 26-carbon precursors for ceramide and sphingolipid synthesis []. Predicted to be integral membrane proteins, in eukaryotes they are probably located on the endoplasmic reticulum. Yeast ELO3 (P40319 from SWISSPROT) affects plasma membrane H+-ATPase activity, and may act on a glucose-signalling pathway that controls the expression of several genes that are transcriptionally regulated by glucose such as PMA1 []. ; GO: 0016021 integral to membrane |
| >PTZ00251 fatty acid elongase; Provisional | Back alignment and domain information |
|---|
| >KOG3071|consensus | Back alignment and domain information |
|---|
| >KOG3072|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00