Psyllid ID: psy11333

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MGLADRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNGAQ
ccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEccEEEEccHHHHHcccHHHHHHcccccccccccEEEEccccHHHHHHHHHcccccEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEcccccccccccccEEEEEccEEEEEccccccccccEEEEEEccccEEEcccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEEcccccccccEEEEEEEcccccc
cccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccEccHHHHHHHcccHHHHHHHcccHHHHcccEEEEccccHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEcccccEEEEEccccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccEEEEEEEcccccc
mgladrpaspaclthtsdkhprVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTShitveesnvqtlLPAACLLQLVEIQDICCEFLKrqldpsnclgirafadtHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDiissdelnvrSEEQVFNAIMSWLKYNVSERRQHLAQVLQHvrlpllspkflvgtvgsdllvrsDEACRDLVDEAKNylllpqerplmqgprtrprkpsrrgeVLFAVggwcsgdaissverydpqssdwkivapmskrrcgVGVAVLNDLLYavgghdgqsYLNSIerydpqtnqwscdvapttscrtsvgvAVLDGFLyavggqdgvqclnhverydpkenkwsrvapmttRRLGVAVAVLGGFLYaiggsdgqsplntverfdpklnrwtamapmstrrkhlgcavfvgdngaq
mgladrpaspaclthtsdkhprvVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAknylllpqerplmqgprtrprkpsrrGEVLFAvggwcsgdaissverydpqssdwKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHverydpkenkwsrvapmttRRLGVAVAVLGGFLYAIggsdgqsplnTVERFDPKLNRWtamapmstrrkhLGCAVFVGDNGAQ
MGLADRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNGAQ
**********************VVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLL*********************EVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDG***LNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFV******
******************KHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQE*P*****RTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNG**
*********PACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQ**********RRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNGAQ
************LTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGD****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLADRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNGAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query482 2.2.26 [Sep-21-2011]
B4GRJ2 628 Kelch-like protein diablo N/A N/A 0.975 0.748 0.904 0.0
Q16RL8 589 Kelch-like protein diablo N/A N/A 0.979 0.801 0.894 0.0
B3NDN0 623 Kelch-like protein diablo N/A N/A 0.975 0.754 0.904 0.0
B4PD06 623 Kelch-like protein diablo N/A N/A 0.975 0.754 0.904 0.0
B4HIK1 623 Kelch-like protein diablo N/A N/A 0.975 0.754 0.904 0.0
Q9VUU5 623 Kelch-like protein diablo yes N/A 0.975 0.754 0.904 0.0
Q2M0J9 628 Kelch-like protein diablo yes N/A 0.975 0.748 0.904 0.0
B0WWP2582 Kelch-like protein diablo N/A N/A 0.979 0.810 0.894 0.0
B3M9V8 633 Kelch-like protein diablo N/A N/A 0.975 0.742 0.902 0.0
B4QLQ2 623 Kelch-like protein diablo N/A N/A 0.975 0.754 0.902 0.0
>sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 Back     alignment and function desciption
 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/471 (90%), Positives = 454/471 (96%)

Query: 5   DRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFR 64
           DRP SPA L+HTS+KHP+V L+E++ LRRHRELCDVVLNVG RKIFAHRV+LSACS YF 
Sbjct: 41  DRPPSPARLSHTSEKHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFC 100

Query: 65  AMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQ 124
           AMFTGEL ESRQ EVTIRDID+ AM+ LI+FCYT+HI VEESNVQTLLPAACLLQLVEIQ
Sbjct: 101 AMFTGELEESRQTEVTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQ 160

Query: 125 DICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVAQL 184
           DICCEFLKRQLDP+NCLGIRAFADTHSCR+LLRIADKFTQHNFQEVMESEEFL+LPV QL
Sbjct: 161 DICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQL 220

Query: 185 VDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSD 244
           VDII SDELNVRSEEQVFNA+MSWLKYNV+ERRQHLAQVLQHVRLPLLSPKFLVGTVGSD
Sbjct: 221 VDIICSDELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSD 280

Query: 245 LLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISS 304
           LLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKP+RRGEVLFAVGGWCSGDAI+S
Sbjct: 281 LLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIAS 340

Query: 305 VERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSC 364
           VER+DPQ++DWK+VAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSC
Sbjct: 341 VERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSC 400

Query: 365 DVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLGVA 424
           DVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWS+VAPMTTRRLGVA
Sbjct: 401 DVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVA 460

Query: 425 VAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVF 475
           VAVLGGFLYAIGGSDGQ PLNTVER+DP+ N+W A++PMSTRRKHLGCAVF
Sbjct: 461 VAVLGGFLYAIGGSDGQCPLNTVERYDPRQNKWVAVSPMSTRRKHLGCAVF 511
Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. May have a role in synapse differentiation and growth.
Drosophila persimilis (taxid: 7234)
>sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 Back     alignment and function description
>sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
312376627 907 hypothetical protein AND_12475 [Anophele 0.979 0.520 0.892 0.0
195160717 628 GL25213 [Drosophila persimilis] gi|25480 0.975 0.748 0.904 0.0
442632585 620 diablo, isoform B [Drosophila melanogast 0.975 0.758 0.904 0.0
157127716 589 BACH1, putative [Aedes aegypti] gi|12210 0.979 0.801 0.894 0.0
194873084 623 GG15931 [Drosophila erecta] gi|254807996 0.975 0.754 0.904 0.0
170051549 590 ring canal kelch protein [Culex quinquef 0.979 0.8 0.894 0.0
24664829 623 diablo, isoform A [Drosophila melanogast 0.975 0.754 0.904 0.0
198464950 628 GA19454 [Drosophila pseudoobscura pseudo 0.975 0.748 0.904 0.0
254808001582 RecName: Full=Kelch-like protein diablo 0.979 0.810 0.894 0.0
7243777 623 Diablo [Drosophila melanogaster] 0.975 0.754 0.902 0.0
>gi|312376627|gb|EFR23654.1| hypothetical protein AND_12475 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/473 (89%), Positives = 455/473 (96%)

Query: 3   LADRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPY 62
           ++DRP SPA L+HTS+KHPRV L E++ LRRHRELCDVV+NV  RKIFAHRV+LSACSPY
Sbjct: 6   ISDRPPSPARLSHTSEKHPRVTLQELNVLRRHRELCDVVINVSGRKIFAHRVILSACSPY 65

Query: 63  FRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVE 122
           FRAMFTGEL ESRQ EVTIRDID+ AM+ LI+FCYTSHI VEESNVQTLLPAACLLQL E
Sbjct: 66  FRAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTSHIVVEESNVQTLLPAACLLQLAE 125

Query: 123 IQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVA 182
           IQDICCEFLKRQLDP+NCLGIRAFADTHSCR+LLRIADKFTQHNFQEVMESEEFL+LPV 
Sbjct: 126 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVG 185

Query: 183 QLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVG 242
           QLVDII SDELNVRSEEQVFNA+M+WLKYNV+ERRQHLAQVLQHVR+PLLSPKFLVGTVG
Sbjct: 186 QLVDIICSDELNVRSEEQVFNAVMAWLKYNVAERRQHLAQVLQHVRMPLLSPKFLVGTVG 245

Query: 243 SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAI 302
           SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKP+RRGEVLFAVGGWCSGDAI
Sbjct: 246 SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAI 305

Query: 303 SSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW 362
           +SVER+DP+++DWK+VAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW
Sbjct: 306 ASVERFDPETADWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW 365

Query: 363 SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLG 422
           SCDVAPTTSCRTSVGVAVL+GFLYAVGGQDGVQCLNHVERYDPKENKWS+VAPMTTRRLG
Sbjct: 366 SCDVAPTTSCRTSVGVAVLEGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLG 425

Query: 423 VAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVF 475
           VAVAVLGG+LYAIGGSDGQ PLNTVER+DP+ N+W A++PMSTRRKHLGCAVF
Sbjct: 426 VAVAVLGGYLYAIGGSDGQCPLNTVERYDPRQNKWCAVSPMSTRRKHLGCAVF 478

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195160717|ref|XP_002021221.1| GL25213 [Drosophila persimilis] gi|254807999|sp|B4GRJ2.1|KLHDB_DROPE RecName: Full=Kelch-like protein diablo gi|194118334|gb|EDW40377.1| GL25213 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|442632585|ref|NP_001261892.1| diablo, isoform B [Drosophila melanogaster] gi|440215838|gb|AGB94585.1| diablo, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|157127716|ref|XP_001661146.1| BACH1, putative [Aedes aegypti] gi|122105300|sp|Q16RL8.1|KLHDB_AEDAE RecName: Full=Kelch-like protein diablo gi|108872825|gb|EAT37050.1| AAEL010911-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194873084|ref|XP_001973137.1| GG15931 [Drosophila erecta] gi|254807996|sp|B3NDN0.1|KLHDB_DROER RecName: Full=Kelch-like protein diablo gi|190654920|gb|EDV52163.1| GG15931 [Drosophila erecta] Back     alignment and taxonomy information
>gi|170051549|ref|XP_001861814.1| ring canal kelch protein [Culex quinquefasciatus] gi|167872751|gb|EDS36134.1| ring canal kelch protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|24664829|ref|NP_524989.2| diablo, isoform A [Drosophila melanogaster] gi|195327879|ref|XP_002030645.1| GM25560 [Drosophila sechellia] gi|195495341|ref|XP_002095226.1| GE22281 [Drosophila yakuba] gi|74871079|sp|Q9VUU5.1|KLHDB_DROME RecName: Full=Kelch-like protein diablo gi|254807844|sp|B4HIK1.1|KLHDB_DROSE RecName: Full=Kelch-like protein diablo gi|254807848|sp|B4PD06.1|KLHDB_DROYA RecName: Full=Kelch-like protein diablo gi|7294226|gb|AAF49578.1| diablo, isoform A [Drosophila melanogaster] gi|33636585|gb|AAQ23590.1| RE13447p [Drosophila melanogaster] gi|40645038|dbj|BAD06413.1| kelch-like protein [Drosophila melanogaster] gi|194119588|gb|EDW41631.1| GM25560 [Drosophila sechellia] gi|194181327|gb|EDW94938.1| GE22281 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|198464950|ref|XP_001353424.2| GA19454 [Drosophila pseudoobscura pseudoobscura] gi|254808000|sp|Q2M0J9.2|KLHDB_DROPS RecName: Full=Kelch-like protein diablo gi|198149951|gb|EAL30933.2| GA19454 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|254808001|sp|B0WWP2.2|KLHDB_CULQU RecName: Full=Kelch-like protein diablo Back     alignment and taxonomy information
>gi|7243777|gb|AAF43447.1| Diablo [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
UNIPROTKB|B0WWP2582 dbo "Kelch-like protein diablo 0.981 0.812 0.894 2.3e-236
UNIPROTKB|Q16RL8 589 dbo "Kelch-like protein diablo 0.981 0.803 0.894 2.3e-236
UNIPROTKB|B4GRJ2 628 dbo "Kelch-like protein diablo 0.977 0.75 0.904 4.8e-236
UNIPROTKB|Q2M0J9 628 dbo "Kelch-like protein diablo 0.977 0.75 0.904 4.8e-236
FB|FBgn0040230 623 dbo "diablo" [Drosophila melan 0.977 0.756 0.904 6.2e-236
UNIPROTKB|B3NDN0 623 dbo "Kelch-like protein diablo 0.977 0.756 0.904 6.2e-236
UNIPROTKB|B4HIK1 623 dbo "Kelch-like protein diablo 0.977 0.756 0.904 6.2e-236
UNIPROTKB|B4PD06 623 dbo "Kelch-like protein diablo 0.977 0.756 0.904 6.2e-236
UNIPROTKB|B3M9V8 633 dbo "Kelch-like protein diablo 0.981 0.747 0.900 2.1e-235
UNIPROTKB|B4QLQ2 623 dbo "Kelch-like protein diablo 0.977 0.756 0.902 4.4e-235
UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 2279 (807.3 bits), Expect = 2.3e-236, P = 2.3e-236
 Identities = 423/473 (89%), Positives = 456/473 (96%)

Query:     3 LADRPASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPY 62
             ++DRP SPA L+HTS+KHPRV L+E++ LRRHRELCDVV+NV  RKIFAHRV+LSACSPY
Sbjct:     6 ISDRPPSPARLSHTSEKHPRVTLTELNVLRRHRELCDVVINVSGRKIFAHRVILSACSPY 65

Query:    63 FRAMFTGELAESRQAEVTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVE 122
             FRAMFTGEL ESRQ EVTIRDID+ AM+ LI+FCYTSHI VEESNVQTLLPAACLLQL E
Sbjct:    66 FRAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTSHIVVEESNVQTLLPAACLLQLAE 125

Query:   123 IQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLILPVA 182
             IQDICCEFLKRQLDP+NCLGIRAFADTHSCR+LLRIADKFTQHNFQEVMESEEFL+LPV 
Sbjct:   126 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVG 185

Query:   183 QLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVG 242
             QLVDII SDELNVRSEEQVFNA+M+WLKYNV+ERRQHLAQVLQHVR+PLLSPKFLVGTVG
Sbjct:   186 QLVDIICSDELNVRSEEQVFNAVMAWLKYNVAERRQHLAQVLQHVRMPLLSPKFLVGTVG 245

Query:   243 SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAI 302
             SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKP+RRGEVLFAVGGWCSGDAI
Sbjct:   246 SDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAI 305

Query:   303 SSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW 362
             +SVER+DP+++DWK+VAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW
Sbjct:   306 ASVERFDPETADWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQW 365

Query:   363 SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRRLG 422
             SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWS+VAPMTTRRLG
Sbjct:   366 SCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLG 425

Query:   423 VAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVF 475
             VAVAVLGG+LYAIGGSDGQ PLNTVER+DP+ N+W A++PMSTRRKHLGCAVF
Sbjct:   426 VAVAVLGGYLYAIGGSDGQCPLNTVERYDPRQNKWCAVSPMSTRRKHLGCAVF 478
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0016049 "cell growth" evidence=ISS
GO:0050807 "regulation of synapse organization" evidence=ISS
UNIPROTKB|Q16RL8 dbo "Kelch-like protein diablo" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B4GRJ2 dbo "Kelch-like protein diablo" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q2M0J9 dbo "Kelch-like protein diablo" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
FB|FBgn0040230 dbo "diablo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3NDN0 dbo "Kelch-like protein diablo" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4HIK1 dbo "Kelch-like protein diablo" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4PD06 dbo "Kelch-like protein diablo" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B3M9V8 dbo "Kelch-like protein diablo" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4QLQ2 dbo "Kelch-like protein diablo" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B4LIG6KLHDB_DROVINo assigned EC number0.90020.97510.7532N/AN/A
B3M9V8KLHDB_DROANNo assigned EC number0.90230.97510.7424N/AN/A
Q08DK3KLH20_BOVINNo assigned EC number0.82400.96470.7635yesN/A
Q16RL8KLHDB_AEDAENo assigned EC number0.89420.97920.8013N/AN/A
B4HIK1KLHDB_DROSENo assigned EC number0.90440.97510.7544N/AN/A
Q9VUU5KLHDB_DROMENo assigned EC number0.90440.97510.7544yesN/A
B4PD06KLHDB_DROYANo assigned EC number0.90440.97510.7544N/AN/A
Q6DFF6KLH20_XENLANo assigned EC number0.82180.96470.7698N/AN/A
Q5ZKD9KLH20_CHICKNo assigned EC number0.81580.96680.7639yesN/A
Q2M0J9KLHDB_DROPSNo assigned EC number0.90440.97510.7484yesN/A
B3NDN0KLHDB_DROERNo assigned EC number0.90440.97510.7544N/AN/A
B4QLQ2KLHDB_DROSINo assigned EC number0.90230.97510.7544N/AN/A
Q7QGL0KLHDB_ANOGANo assigned EC number0.88790.97920.8109yesN/A
B4L0G9KLHDB_DROMONo assigned EC number0.90020.97510.7617N/AN/A
D3Z8N4KLH20_RATNo assigned EC number0.82400.96470.7635yesN/A
Q5R7B8KLH20_PONABNo assigned EC number0.82400.96470.7635yesN/A
B4GRJ2KLHDB_DROPENo assigned EC number0.90440.97510.7484N/AN/A
B4MXW3KLHDB_DROWINo assigned EC number0.89800.97510.6921N/AN/A
Q8VCK5KLH20_MOUSENo assigned EC number0.82400.96470.7698yesN/A
Q9Y2M5KLH20_HUMANNo assigned EC number0.82400.96470.7635yesN/A
B0WWP2KLHDB_CULQUNo assigned EC number0.89420.97920.8109N/AN/A
B4J045KLHDB_DROGRNo assigned EC number0.89830.97710.7548N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-71
pfam07707101 pfam07707, BACK, BTB And C-terminal Kelch 2e-46
smart00875101 smart00875, BACK, BTB And C-terminal Kelch 3e-38
pfam00651101 pfam00651, BTB, BTB/POZ domain 9e-33
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-31
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 5e-29
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 1e-22
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 4e-16
smart0061247 smart00612, Kelch, Kelch domain 1e-15
pfam0134446 pfam01344, Kelch_1, Kelch motif 8e-15
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-14
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-14
smart0061247 smart00612, Kelch, Kelch domain 8e-14
smart0061247 smart00612, Kelch, Kelch domain 2e-13
smart0061247 smart00612, Kelch, Kelch domain 1e-12
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-08
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-08
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-08
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-07
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 4e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-06
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 8e-06
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 9e-06
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 2e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-05
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 4e-05
PLN02153 341 PLN02153, PLN02153, epithiospecifier protein 7e-05
pfam0764648 pfam07646, Kelch_2, Kelch motif 9e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-04
TIGR03547 346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 5e-04
TIGR03547 346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 8e-04
COG3055 381 COG3055, COG3055, Uncharacterized protein conserve 0.001
PLN02193 470 PLN02193, PLN02193, nitrile-specifier protein 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score =  236 bits (603), Expect = 1e-71
 Identities = 108/474 (22%), Positives = 209/474 (44%), Gaps = 51/474 (10%)

Query: 35  RELCD--VVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDDVAMDNL 92
           ++ CD  +++  G   I  H+++LS+ S YF+ MF     E+   E+ + +ID  + + +
Sbjct: 7   QKFCDESIIIVNGGGIIKVHKIILSSSSEYFKKMFKNNFKEN---EINL-NIDYDSFNEV 62

Query: 93  IEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSC 152
           I++ YT  I +  +NV+ +L  A  L +  + ++C  ++ + +D +NC+ I  F+  + C
Sbjct: 63  IKYIYTGKINITSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGC 122

Query: 153 RDLLRIADKFTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYN 212
           + L   A  + ++N + +    +F+ L   +L+ I+S D+LNV SE+ V   I+ WL   
Sbjct: 123 KKLYSAAYNYIRNNIELIYNDPDFIYLSKNELIKILSDDKLNVSSEDVVLEIIIKWLTSK 182

Query: 213 VSERRQHLAQVLQHVRLPLLSP-------KFLVGTVGSDLLVRSDEACR----------D 255
            + + + +  +L+ +R+  LS        ++ +      ++                   
Sbjct: 183 KNNKYKDICLILKVLRITFLSEEGIKKLKRWKLRIKKKKIVFNKRCIKIIYSKKYNLNKI 242

Query: 256 LVDEAK----NYLLLPQERPLMQGPRTRPRKPSR-----------------RGEVLFAVG 294
           L   +      Y+ +           T     S                     V++ +G
Sbjct: 243 LPRSSTFGSIIYIHITMSIFTYN-YITNYSPLSEINTIIDIHYVYCFGSVVLNNVIYFIG 301

Query: 295 GWC-SGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIE 353
           G   +  +++SV  YD ++  W  V  +   R   GV V N+ +Y +GG      LN++E
Sbjct: 302 GMNKNNLSVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSISLNTVE 361

Query: 354 RYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGG-QDGVQCLNHVERYDPKENKWSR 412
            + P  ++W  +  P    R +  V  ++  +Y +GG     + L  VE +    NKWS+
Sbjct: 362 SWKPGESKWR-EEPPLIFPRYNPCVVNVNNLIYVIGGISKNDELLKTVECFSLNTNKWSK 420

Query: 413 VAPMTTRRLGVAVAVLGGFLYAIGG---SDGQSPLNTVERFDPKLNRWTAMAPM 463
            +P+     G       G +Y IGG    D     N VE ++P  N+WT ++ +
Sbjct: 421 GSPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIVESYNPVTNKWTELSSL 474

Length = 534
>gnl|CDD|149006 pfam07707, BACK, BTB And C-terminal Kelch Back     alignment and domain information
>gnl|CDD|197943 smart00875, BACK, BTB And C-terminal Kelch Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 482
KOG4441|consensus571 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4441|consensus571 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG4350|consensus 620 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.96
KOG4693|consensus392 99.96
KOG4693|consensus 392 99.95
KOG0379|consensus 482 99.94
KOG0379|consensus 482 99.92
KOG1230|consensus 521 99.91
KOG2075|consensus521 99.9
KOG1230|consensus 521 99.86
KOG4682|consensus488 99.81
KOG4152|consensus 830 99.8
KOG4152|consensus 830 99.77
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.76
KOG4591|consensus280 99.75
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.55
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.52
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 99.52
KOG0783|consensus 1267 99.38
PF1396450 Kelch_6: Kelch motif 99.37
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 99.37
PF1396450 Kelch_6: Kelch motif 99.36
KOG2437|consensus 723 99.24
KOG2437|consensus 723 99.14
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.13
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.12
PF1341549 Kelch_3: Galactose oxidase, central domain 99.09
smart0061247 Kelch Kelch domain. 99.01
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.98
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.98
smart0061247 Kelch Kelch domain. 98.93
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.89
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.82
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.63
PLN02772 398 guanylate kinase 98.63
PLN02772 398 guanylate kinase 98.5
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.48
PF1385442 Kelch_5: Kelch motif 98.46
PF1385442 Kelch_5: Kelch motif 98.46
KOG0783|consensus 1267 98.45
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.23
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.19
KOG0511|consensus516 98.13
KOG2838|consensus401 97.82
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.79
KOG2716|consensus230 97.66
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 97.51
KOG2838|consensus401 97.46
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.25
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.05
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 96.99
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 96.99
PF12768281 Rax2: Cortical protein marker for cell polarity 96.86
KOG3473|consensus112 96.66
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.55
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.46
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 96.42
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.29
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.23
KOG1987|consensus297 96.1
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.01
PF03089 337 RAG2: Recombination activating protein 2; InterPro 96.0
smart00284255 OLF Olfactomedin-like domains. 95.83
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 95.77
KOG1665|consensus302 95.73
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.71
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.62
KOG4350|consensus620 95.4
KOG2715|consensus210 95.37
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.36
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.34
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.29
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 95.24
KOG1724|consensus162 95.18
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.07
PRK00178430 tolB translocation protein TolB; Provisional 95.02
PRK04792448 tolB translocation protein TolB; Provisional 94.83
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.61
KOG2714|consensus465 94.37
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.28
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.9
PRK04922433 tolB translocation protein TolB; Provisional 93.89
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.83
PTZ00421 493 coronin; Provisional 93.8
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.72
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.59
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.22
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.02
KOG2055|consensus 514 92.83
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.67
PRK05137435 tolB translocation protein TolB; Provisional 92.52
KOG0310|consensus 487 92.28
KOG0310|consensus 487 92.03
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.65
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 91.08
smart00284255 OLF Olfactomedin-like domains. 91.03
PRK04043419 tolB translocation protein TolB; Provisional 90.67
KOG2055|consensus514 90.62
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.5
PRK03629429 tolB translocation protein TolB; Provisional 90.25
PRK11028 330 6-phosphogluconolactonase; Provisional 89.59
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.46
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 89.31
PRK00178430 tolB translocation protein TolB; Provisional 88.55
KOG0289|consensus506 88.12
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 88.07
PRK04792448 tolB translocation protein TolB; Provisional 87.68
KOG2321|consensus 703 87.53
PTZ00420 568 coronin; Provisional 86.96
KOG0511|consensus516 86.69
KOG0316|consensus 307 86.63
COG1520 370 FOG: WD40-like repeat [Function unknown] 86.61
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 86.53
PRK05137435 tolB translocation protein TolB; Provisional 86.3
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 85.94
KOG0649|consensus325 85.91
KOG1332|consensus299 85.77
KOG1036|consensus 323 85.68
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 85.12
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 84.58
PRK13684334 Ycf48-like protein; Provisional 84.4
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 84.31
PLN00181793 protein SPA1-RELATED; Provisional 84.23
PRK02889427 tolB translocation protein TolB; Provisional 83.14
KOG1036|consensus323 83.02
PLN00181 793 protein SPA1-RELATED; Provisional 82.29
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 80.59
KOG3840|consensus438 80.41
>KOG4441|consensus Back     alignment and domain information 
Probab=100.00  E-value=4e-82  Score=627.27  Aligned_cols=472  Identities=54%  Similarity=0.921  Sum_probs=451.2

Q ss_pred             CCCCCceeeecCCcHHHHHHHHHHHHhcCCceeEEEEeCCeEEeceeEEeeccCHHHHHHhcCCCCcCccceEEEccCCH
Q psy11333          7 PASPACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIRDIDD   86 (482)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~i~~~~~~~~~hk~iL~~~S~~F~~~~~~~~~e~~~~~i~l~~~~~   86 (482)
                      .....+..|....|...+++.|+.|++.+.+|||++.+++++|+|||.||++.|+||++||+++++|+.+++|.+.++++
T Consensus         6 ~~~~~~~~~~~~~h~~~~l~~l~~lr~~~~lcDv~L~v~~~~~~aHR~VLAa~S~YFraMFt~~l~e~~~~~i~l~~v~~   85 (571)
T KOG4441|consen    6 EIFNSTSEFTDPSHSKFLLQGLNELREEGLLCDVTLLVGDREFPAHRVVLAACSPYFRAMFTSGLKESKQKEINLEGVDP   85 (571)
T ss_pred             cccccccccccHHHHHHHHHHHHHHHHhCCCceEEEEECCeeechHHHHHHhccHHHHHHhcCCcccccceEEEEecCCH
Confidence            34446678999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcCeeeeccccHhhHHHHhcccChhhHHHHHHHHHhccCCCCCHHHHHHHHhhCCCHHHHHHHHHHHHHh
Q psy11333         87 VAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHN  166 (482)
Q Consensus        87 ~~~~~~l~~~y~~~~~~~~~~~~~ll~~a~~~~~~~L~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~~i~~~  166 (482)
                      ..++.+++|+|++.+.++.+|+.+++.+|++||++++.+.|.+|+..+++++||+.+..+|+.++|.+|.+.+..|+..|
T Consensus        86 ~~l~~ll~y~Yt~~i~i~~~nVq~ll~aA~~lQi~~v~~~C~~fL~~~l~~~Nclgi~~~a~~~~~~~L~~~a~~~i~~~  165 (571)
T KOG4441|consen   86 ETLELLLDYAYTGKLEISEDNVQELLEAASLLQIPEVVDACCEFLESQLDPSNCLGIRRFAELHSCTELLEVADEYILQH  165 (571)
T ss_pred             HHHHHHHHHhhcceEEechHhHHHHHHHHHHhhhHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcccccccCCHHHHhHhhcCCCcccCChHHHHHHHHHHHhcChhHHHHHHHHhhccccCCCCChhhHhhcccCccc
Q psy11333        167 FQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLL  246 (482)
Q Consensus       167 ~~~l~~~~~f~~l~~~~l~~il~~~~l~~~~e~~v~~~~~~wi~~~~~~~~~~~~~l~~~~r~~~~~~~~l~~~~~~~~~  246 (482)
                      |.++.++++|..|+.+.|.++++++.+++.+|..+|++++.|++++...|..+++.+++++|++.+++.+|.+.+...++
T Consensus       166 F~~v~~~eefl~L~~~~l~~ll~~d~l~v~~E~~vf~a~~~Wv~~d~~~R~~~~~~ll~~vr~~ll~~~~l~~~v~~~~~  245 (571)
T KOG4441|consen  166 FAEVSKTEEFLLLSLEELIGLLSSDDLNVDSEEEVFEAAMRWVKHDFEEREEHLPALLEAVRLPLLPPQFLVEIVESEPL  245 (571)
T ss_pred             HHHHhccHHhhCCCHHHHHhhccccCCCcCCHHHHHHHHHHHHhcCHhhHHHHHHHHHHhcCccCCCHHHHHHHHhhhhh
Confidence            99999999999999999999999999999999999999999999999888899999999999999999999999888888


Q ss_pred             ccCChhhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCcEEEEeccccC-CCCCceeEEEeCCCCCeeeccCCCCCC
Q psy11333        247 VRSDEACRDLVDEAKNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCS-GDAISSVERYDPQSSDWKIVAPMSKRR  325 (482)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~GG~~~-~~~~~~~~~~d~~~~~W~~~~~~~~~~  325 (482)
                      +.....|.+++.++.+|+.++..++..+.+|..++.  ...+.||++||... ....+.++.|||.+++|..+++||.+|
T Consensus       246 ~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~--~~~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~~r  323 (571)
T KOG4441|consen  246 IKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRR--SVSGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPSPR  323 (571)
T ss_pred             hccCHHHHHHHHHHHHHhhCcccCccccCCCcccCc--CCCCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCccc
Confidence            888899999999999999999876667778877775  34689999999985 678899999999999999999999999


Q ss_pred             CceeEEEECCEEEEEecCC-CCCCCCeEEEEeCCCCceeecCCCCCCcccceeEEEECCEEEEEeccCCCcccCeEEEEe
Q psy11333        326 CGVGVAVLNDLLYAVGGHD-GQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYD  404 (482)
Q Consensus       326 ~~~~~~~~~~~iyv~GG~~-~~~~~~~~~~yd~~~~~W~~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~yd  404 (482)
                      ..+++++++|+||++||.+ +....+++++|||.+++|+.+ ++|+.+|..+++++++|.||++||.++....+++++||
T Consensus       324 ~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~-a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l~svE~YD  402 (571)
T KOG4441|consen  324 CRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPV-APMNTKRSDFGVAVLDGKLYAVGGFDGEKSLNSVECYD  402 (571)
T ss_pred             ccccEEEECCEEEEEccccCCCcccceEEEecCCCCceecc-CCccCccccceeEEECCEEEEEeccccccccccEEEec
Confidence            9999999999999999999 677889999999999999999 99999999999999999999999999888899999999


Q ss_pred             CCCCceeecCCCCCCccceEEEEECCEEEEEcCCCCCC-CCCeEEEEeCCCCceeecCCCCcCCCceeEEEEcCCCCC
Q psy11333        405 PKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQS-PLNTVERFDPKLNRWTAMAPMSTRRKHLGCAVFVGDNGA  481 (482)
Q Consensus       405 ~~~~~W~~~~~~~~~r~~~~~~~~~~~i~v~GG~~~~~-~~~~~~~y~~~~~~W~~~~~~~~~r~~~~~~~~~~~~~~  481 (482)
                      |.+++|+.+++|+.+|+++++++++|+||++||.++.. .++++++|||.+++|+.+++|+.+|.++++++++++|++
T Consensus       403 p~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R~~~g~a~~~~~iYv  480 (571)
T KOG4441|consen  403 PVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRRSGFGVAVLNGKIYV  480 (571)
T ss_pred             CCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCcccccccceEEEECCEEEE
Confidence            99999999999999999999999999999999998877 899999999999999999999999999999999999875

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 3e-40
1x2j_A 316 Structural Basis For The Defects Of Human Lung Canc 2e-10
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 3e-40
2dyh_A 318 Crystal Structure Of The Keap1 Protein In Complexed 2e-10
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 9e-40
3vng_A 309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-11
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-39
1u6d_X 308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-11
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 3e-37
1zgk_A 308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-10
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-37
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-34
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-36
4ap2_A297 Crystal Structure Of The Human Klhl11-cul3 Complex 1e-32
3i3n_A279 Crystal Structure Of The Btb-Back Domains Of Human 2e-31
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-21
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-14
3hve_A256 Structures Of Spop-Substrate Complexes: Insights In 2e-20
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 4e-17
2nn2_A133 Crystal Structure Of The Btb Domain From The LrfZBT 8e-15
2if5_A120 Structure Of The Poz Domain Of Human Lrf, A Master 9e-13
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 4e-11
2ihc_A124 Crystal Structure Of The Bric-A-Brac (Btb) Domain O 2e-10
1r28_A127 Crystal Structure Of The B-Cell Lymphoma 6 (Bcl6) B 2e-10
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 3e-10
3hve_B256 Structures Of Spop-Substrate Complexes: Insights In 2e-09
2z8h_A138 Structure Of Mouse Bach1 Btb Domain Length = 138 2e-09
3e4u_A130 Crystal Structure Of The Wild-Type Human Bcl6 BtbPO 2e-09
3m52_A117 Crystal Structure Of The Btb Domain From The Miz-1Z 3e-09
2q81_A119 Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length 4e-09
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 5e-09
3ohu_A125 Crystal Structure Of The Human Bach2 Poz Domain, Fo 3e-08
3ga1_A129 Crystal Structure Of The Human Nac1 Poz Domain Leng 2e-06
2yy9_A135 Crystal Structure Of Btb Domain From Mouse Hkr3 Len 4e-06
3b84_A119 Crystal Structure Of The Human Btb Domain Of The Kr 4e-06
3htm_A172 Structures Of Spop-Substrate Complexes: Insights In 5e-06
2ppi_A144 Structure Of The Btb (Tramtrack And Bric A Brac) Do 2e-05
2vkp_A109 Crystal Structure Of Btb Domain From Btbd6 Length = 4e-05
1buo_A121 Btb Domain From Plzf Length = 121 5e-05
1cs3_A116 Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN 7e-05
2eqx_A105 Solution Structure Of The Back Domain Of Kelch Repe 2e-04
2vpk_A116 Crystal Structure Of The Btb Domain Of Human Myoneu 2e-04
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 117/195 (60%), Gaps = 5/195 (2%)
Query: 287 GEVLFAVGGWCS---GDAISS-VERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAVGG 342
           G +L+AVGG  +   G+  SS ++ Y+P ++ W   A MS  R  +GV V++  +YAVGG
Sbjct: 63  GGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGG 122
Query: 343 HDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVER 402
             G  + +S+ERY+P+ ++W   VAP  + R  VGVAVL+  LYAVGG DG   LN  E 
Sbjct: 123 SHGCIHHSSVERYEPERDEWHL-VAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAEC 181
Query: 403 YDPKENKWSRVAPMTTRRLGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAP 462
           Y P+ N+W  + PM T R G  V VL   +YA GG DGQ  LN+VER+D +   WT +AP
Sbjct: 182 YYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAP 241
Query: 463 MSTRRKHLGCAVFVG 477
           M   R  LG  V  G
Sbjct: 242 MRHHRSALGITVHQG 256
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|4AP2|A Chain A, Crystal Structure Of The Human Klhl11-cul3 Complex At 2.8a Resolution Length = 297 Back     alignment and structure
>pdb|3I3N|A Chain A, Crystal Structure Of The Btb-Back Domains Of Human Klhl11 Length = 279 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|3HVE|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 Back     alignment and structure
>pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|2IHC|A Chain A, Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1 Length = 124 Back     alignment and structure
>pdb|1R28|A Chain A, Crystal Structure Of The B-Cell Lymphoma 6 (Bcl6) Btb Domain To 2.2 Angstrom Length = 127 Back     alignment and structure
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|3HVE|B Chain B, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 Back     alignment and structure
>pdb|2Z8H|A Chain A, Structure Of Mouse Bach1 Btb Domain Length = 138 Back     alignment and structure
>pdb|3E4U|A Chain A, Crystal Structure Of The Wild-Type Human Bcl6 BtbPOZ DOMAIN Length = 130 Back     alignment and structure
>pdb|3M52|A Chain A, Crystal Structure Of The Btb Domain From The Miz-1ZBTB17 Transcription Regulator Length = 117 Back     alignment and structure
>pdb|2Q81|A Chain A, Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length = 119 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|3OHU|A Chain A, Crystal Structure Of The Human Bach2 Poz Domain, Form I Length = 125 Back     alignment and structure
>pdb|3GA1|A Chain A, Crystal Structure Of The Human Nac1 Poz Domain Length = 129 Back     alignment and structure
>pdb|2YY9|A Chain A, Crystal Structure Of Btb Domain From Mouse Hkr3 Length = 135 Back     alignment and structure
>pdb|3B84|A Chain A, Crystal Structure Of The Human Btb Domain Of The Krueppel Related Zinc Finger Protein 3 (Hkr3) Length = 119 Back     alignment and structure
>pdb|3HTM|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Spopbtb3-Box Length = 172 Back     alignment and structure
>pdb|2PPI|A Chain A, Structure Of The Btb (Tramtrack And Bric A Brac) Domain Of Human Gigaxonin Length = 144 Back     alignment and structure
>pdb|2VKP|A Chain A, Crystal Structure Of Btb Domain From Btbd6 Length = 109 Back     alignment and structure
>pdb|1BUO|A Chain A, Btb Domain From Plzf Length = 121 Back     alignment and structure
>pdb|1CS3|A Chain A, Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN FROM PROMELOCYTIC Leukemia Zinc Finger Oncoprotein Length = 116 Back     alignment and structure
>pdb|2EQX|A Chain A, Solution Structure Of The Back Domain Of Kelch Repeat And Btb Domain-Containing Protein 4 Length = 105 Back     alignment and structure
>pdb|2VPK|A Chain A, Crystal Structure Of The Btb Domain Of Human Myoneurin Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 1e-134
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-129
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-98
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-88
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 1e-64
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-36
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-97
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-91
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-62
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-35
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-13
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-94
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-90
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-89
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-34
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-88
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-87
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-86
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-34
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-34
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-86
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-84
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-83
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-60
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-55
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-84
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-83
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 9e-78
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 9e-64
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-54
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-36
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 7e-66
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 7e-62
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 4e-59
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 6e-59
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 1e-57
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 6e-56
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-55
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 2e-54
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 1e-53
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 3e-53
2vpk_A116 Myoneurin; transcription regulation, transcription 5e-50
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 9e-50
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 1e-49
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 5e-49
3b84_A119 Zinc finger and BTB domain-containing protein 48; 1e-48
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 2e-46
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 3e-45
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 8e-45
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-40
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-35
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-34
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-11
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 1e-43
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 1e-41
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 4e-24
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-19
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-17
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
 Score =  388 bits (999), Expect = e-134
 Identities = 82/279 (29%), Positives = 134/279 (48%), Gaps = 12/279 (4%)

Query: 9   SPACLTHTSDKHPRVVLSEVSALRRHRELCDVVL---NVGARKIFAHRVVLSACSPYFRA 65
           S          H   +    +  RR    CD+ L     G R+  AHR VL+A + YF  
Sbjct: 4   SMEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTP 63

Query: 66  MFTGELAESRQAEVTIRDIDDV------AMDNLIEFCYTSHITVEESNVQTLLPAACLLQ 119
           + +G+ +ESR   V +R            ++ +IE+ YT  I V   +V  +L  A    
Sbjct: 64  LLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFL 123

Query: 120 LVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADKFTQHNFQEVMESEEFLIL 179
           L+ +++ C EFLK++L  SNC+ I + A  ++   L   A    + NF +V++ EEF  L
Sbjct: 124 LIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTL 183

Query: 180 PVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVG 239
           P   + D +S  E+ V SEE +F  ++ W++ N  ER ++  ++ + +RL  + P +L  
Sbjct: 184 PFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPTYLTR 243

Query: 240 TVGSDLLVRSDEACRDLVDEAKNYLLLPQERPLMQGPRT 278
            V  + LV ++E C  LV +A     L  E   +Q   T
Sbjct: 244 HVKPERLVANNEVCVKLVADAVERHALRAEN--IQ-SGT 279
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 100.0
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.98
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.95
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.95
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.93
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.91
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.91
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.91
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.9
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.9
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.89
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.89
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.89
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.89
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.89
2vpk_A116 Myoneurin; transcription regulation, transcription 99.88
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.88
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.88
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.86
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.86
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.84
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.81
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 99.54
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.32
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.1
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.92
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.78
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.35
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.31
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.08
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.06
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.84
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.84
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.66
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.64
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 97.64
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.42
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.41
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 97.37
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.36
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.24
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 96.97
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.96
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.9
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.87
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.83
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.74
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.97
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.92
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.82
3jrp_A 379 Fusion protein of protein transport protein SEC13 95.75
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.61
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.34
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.31
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.26
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.15
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.13
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 95.13
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.11
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.08
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.07
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.94
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.86
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 94.82
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.82
2pm7_B297 Protein transport protein SEC13, protein transport 94.67
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.67
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.61
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 94.6
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.57
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.54
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.53
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 94.5
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.48
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.45
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 94.3
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.27
3jrp_A 379 Fusion protein of protein transport protein SEC13 94.27
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.25
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.2
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.18
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 94.15
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 94.15
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.14
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.12
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.08
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.03
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.97
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.96
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.94
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.83
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.83
3kvt_A115 Potassium channel protein SHAW; tetramerization do 93.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.75
3ott_A 758 Two-component system sensor histidine kinase; beta 93.74
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.68
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.64
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.6
3jro_A 753 Fusion protein of protein transport protein SEC13 93.6
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.58
1itv_A195 MMP9; adaptive molecular recognition, beta propell 93.55
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 93.52
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.43
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 93.41
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.37
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.3
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.29
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 93.25
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.15
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.1
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.08
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.04
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.03
4a2l_A 795 BT_4663, two-component system sensor histidine kin 92.93
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.87
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.78
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.77
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.77
3v9f_A 781 Two-component system sensor histidine kinase/RESP 92.72
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.6
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.5
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 92.44
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.4
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 92.37
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 92.33
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.29
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 92.18
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.12
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 92.08
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.07
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.01
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 91.95
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.88
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 91.86
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.84
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 91.8
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.77
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.61
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 91.57
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 91.56
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.54
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 91.53
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.46
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 91.45
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.38
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 91.35
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.34
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.22
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.06
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 90.87
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 90.85
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 90.85
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 90.72
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 90.66
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.61
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 90.58
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.58
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 90.53
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.41
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 90.4
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 90.38
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 90.37
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 90.37
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 90.36
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.32
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.29
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 90.23
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.23
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 90.19
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 90.16
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 90.15
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 90.11
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 90.09
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.07
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 90.0
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 89.94
3jro_A 753 Fusion protein of protein transport protein SEC13 89.9
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 89.86
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 89.69
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 89.52
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.48
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 89.45
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 89.37
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.31
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 89.25
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 89.24
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 89.22
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 89.13
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.08
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.04
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 88.76
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 88.66
2pm7_B 297 Protein transport protein SEC13, protein transport 88.47
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 88.09
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 87.91
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 87.82
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 87.67
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 87.66
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 87.51
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 87.5
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 87.46
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.33
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.31
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 87.29
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 87.19
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 87.1
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.1
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 86.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 86.9
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 86.61
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 86.52
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 86.47
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.42
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 86.22
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 86.19
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 86.01
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 85.96
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 85.7
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 85.7
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 85.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 85.49
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 85.43
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 85.4
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 85.06
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 84.82
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 84.52
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 84.47
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 84.35
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 84.33
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 84.26
2p4o_A 306 Hypothetical protein; putative lactonase, structur 84.16
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 84.02
3ott_A 758 Two-component system sensor histidine kinase; beta 83.85
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 83.61
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 83.2
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 82.69
2xyi_A430 Probable histone-binding protein CAF1; transcripti 82.44
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 82.43
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 82.24
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 82.05
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 81.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 81.7
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 81.56
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 81.31
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 81.21
1itv_A195 MMP9; adaptive molecular recognition, beta propell 81.01
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 80.53
2xyi_A430 Probable histone-binding protein CAF1; transcripti 80.4
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 80.34
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 80.21
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
Probab=100.00  E-value=1.7e-41  Score=312.58  Aligned_cols=258  Identities=30%  Similarity=0.541  Sum_probs=240.1

Q ss_pred             CceeeecCCcHHHHHHHHHHHHhcCCceeEEEEeC---CeEEeceeEEeeccCHHHHHHhcCCCCcCccceEEEc-----
Q psy11333         11 ACLTHTSDKHPRVVLSEVSALRRHRELCDVVLNVG---ARKIFAHRVVLSACSPYFRAMFTGELAESRQAEVTIR-----   82 (482)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~i~~~---~~~~~~hk~iL~~~S~~F~~~~~~~~~e~~~~~i~l~-----   82 (482)
                      +...|....|++.+++.+++++.++.+|||+|+++   |++|+|||.||+++|+||++||++++.|+.++.|.++     
T Consensus         6 ~~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~f~~Hr~vLaa~S~yF~~mf~~~~~e~~~~~i~l~~~~~~   85 (279)
T 3i3n_A            6 EAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSE   85 (279)
T ss_dssp             CEEEEECTTHHHHHHHHHHHHHHHTTTCCEEEECC----CEEEECHHHHHHHCTTSGGGCCC--------EEECCCCSST
T ss_pred             cccCcCCHhHHHHHHHHHHHHHhcCCCCCeEEEEcCCCCeEEehHHHHHHHcCHHHHHHhcCCCccccCCeEEecccccc
Confidence            34678999999999999999999999999999998   9999999999999999999999999999999999998     


Q ss_pred             -cCCHHHHHHHHHHhhcCeeeeccccHhhHHHHhcccChhhHHHHHHHHHhccCCCCCHHHHHHHHhhCCCHHHHHHHHH
Q psy11333         83 -DIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRIADK  161 (482)
Q Consensus        83 -~~~~~~~~~~l~~~y~~~~~~~~~~~~~ll~~a~~~~~~~L~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~  161 (482)
                       ++++.+|..+++|+|+|.+.++.+++.+++.+|++|+++.|++.|.+++.++++.+||+.++.+|..+++..|.+.|.+
T Consensus        86 ~~v~~~~f~~ll~~~Ytg~~~i~~~~v~~ll~~A~~l~i~~L~~~c~~~L~~~l~~~n~~~i~~~A~~~~~~~L~~~~~~  165 (279)
T 3i3n_A           86 PGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAAD  165 (279)
T ss_dssp             TCSCHHHHHHHHHHHHHSEEEEETTTHHHHHHHHHHTTCHHHHHHHHHHHHHHCCTTTHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHhhCcCCcccCHHHHHHHHHHHHHHCcHHHHHHHHHHHHHcCCcchHHHHHHHHHHcCcHHHHHHHHH
Confidence             8999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhHHHHhcccccccCCHHHHhHhhcCCCcccCChHHHHHHHHHHHhcChhHHHHHHHHhhccccCCCCChhhHhhcc
Q psy11333        162 FTQHNFQEVMESEEFLILPVAQLVDIISSDELNVRSEEQVFNAIMSWLKYNVSERRQHLAQVLQHVRLPLLSPKFLVGTV  241 (482)
Q Consensus       162 ~i~~~~~~l~~~~~f~~l~~~~l~~il~~~~l~~~~e~~v~~~~~~wi~~~~~~~~~~~~~l~~~~r~~~~~~~~l~~~~  241 (482)
                      |+..||.++..+++|..|+.+.+.++++++.|++.+|..+|+++++|++++++.|.+++..+++++||+.|++..|...+
T Consensus       166 ~i~~~f~~v~~~~~f~~L~~~~l~~lL~~d~L~v~sE~~vf~av~~W~~~~~~~r~~~~~~ll~~VRf~l~~~~~L~~~v  245 (279)
T 3i3n_A          166 MIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPTYLTRHV  245 (279)
T ss_dssp             HHHHTHHHHTTSSGGGGSCHHHHHHHHTCSSCCCSCHHHHHHHHHHHHHTTHHHHTTTHHHHHTTSCGGGSCHHHHHHTT
T ss_pred             HHHHHHHHHhcCcChhcCCHHHHHHHhcCcCCCCCCHHHHHHHHHHHHHcCHHHHHHHHHHHHHhcCCCCCCHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999998888899999999999999999999988


Q ss_pred             cCcccccCChhhHHHHHHHHHHhcCCC
Q psy11333        242 GSDLLVRSDEACRDLVDEAKNYLLLPQ  268 (482)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  268 (482)
                      ...+++...+.|.+++.++.+++.++.
T Consensus       246 ~~~~l~~~~~~c~~~l~ea~~~~~~~~  272 (279)
T 3i3n_A          246 KPERLVANNEVCVKLVADAVERHALRA  272 (279)
T ss_dssp             TTSHHHHTCHHHHHHHHHHHHHHHHTT
T ss_pred             hccchhcCCHHHHHHHHHHHHhccCch
Confidence            888888888999999999999988775
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 482
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 7e-28
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-26
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-26
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-19
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-19
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-20
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-18
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-17
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-14
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-13
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-13
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  105 bits (263), Expect = 7e-28
 Identities = 36/114 (31%), Positives = 60/114 (52%)

Query: 19  KHPRVVLSEVSALRRHRELCDVVLNVGARKIFAHRVVLSACSPYFRAMFTGELAESRQAE 78
           +H   VL  ++ LR    L DVV+ V   +  AH+ VL ACS  F ++FT +L  +    
Sbjct: 7   RHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVI 66

Query: 79  VTIRDIDDVAMDNLIEFCYTSHITVEESNVQTLLPAACLLQLVEIQDICCEFLK 132
               +I+    + L++F YTS + + E N+  ++  A  LQ+  + D C +F+K
Sbjct: 67  NLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIK 120
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.92
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.9
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.9
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.8
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.33
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.14
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.07
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 95.96
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 95.81
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.78
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.77
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.34
d1t1da_100 Shaker potassium channel {California sea hare (Apl 95.32
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.29
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.15
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.15
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.12
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.5
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.03
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 92.97
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 92.81
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 92.78
d1tbga_340 beta1-subunit of the signal-transducing G protein 92.39
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.23
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 92.19
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 91.91
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.88
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 91.28
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 91.1
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 90.13
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.08
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.02
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.77
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.6
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 89.56
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.54
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.21
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.2
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.11
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 88.84
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.99
d1tbga_340 beta1-subunit of the signal-transducing G protein 87.92
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 87.82
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.78
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.6
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 86.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 86.32
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 86.0
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 85.52
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 85.47
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 85.22
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 85.12
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 84.96
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 84.89
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 84.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 84.46
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 82.84
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 82.55
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 81.75
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 81.51
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=3e-30  Score=237.81  Aligned_cols=208  Identities=43%  Similarity=0.739  Sum_probs=189.4

Q ss_pred             HHHhcCCCCCCCCCCCCCCCCCCCCCCcEEEEeccccCCCCCceeEEEeCCCCCeeeccCCCCCCCceeEEEECCEEEEE
Q psy11333        261 KNYLLLPQERPLMQGPRTRPRKPSRRGEVLFAVGGWCSGDAISSVERYDPQSSDWKIVAPMSKRRCGVGVAVLNDLLYAV  340 (482)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~GG~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~iyv~  340 (482)
                      ..|..++    .+|.+|..+.+ +..++++|++||.......+.++.||+.++.|...+.++.+|.+|++++.++.+|++
T Consensus        80 ~~w~~~~----~~p~~r~~~~~-~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~  154 (288)
T d1zgka1          80 NQWSPCA----PMSVPRNRIGV-GVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAV  154 (288)
T ss_dssp             TEEEECC----CCSSCCBTCEE-EEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEE
T ss_pred             ccccccc----cccceecceec-cccceeeEEecceecccccceeeeeccccCccccccccccccccceeeeeeecceEe
Confidence            4566555    36667776654 446899999999987788889999999999999999999999999999999999999


Q ss_pred             ecCCCCCCCCeEEEEeCCCCceeecCCCCCCcccceeEEEECCEEEEEeccCCCcccCeEEEEeCCCCceeecCCCCCCc
Q psy11333        341 GGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSRVAPMTTRR  420 (482)
Q Consensus       341 GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~r  420 (482)
                      ||.+......++++||+.+++|... +.++.++..+++++.++++|++||.......+..+.||+.+++|..++++|.+|
T Consensus       155 GG~~~~~~~~~~~~~d~~~~~~~~~-~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r  233 (288)
T d1zgka1         155 GGFDGTNRLNSAECYYPERNEWRMI-TAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRR  233 (288)
T ss_dssp             CCBCSSCBCCCEEEEETTTTEEEEC-CCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSCC
T ss_pred             cCcccccccceEEEeeccccccccc-cccccccccccccceeeeEEEecCccccccccceeeeeecceeeecccCccCcc
Confidence            9998777778899999999999999 888899999999999999999999887777889999999999999999999999


Q ss_pred             cceEEEEECCEEEEEcCCCCCCCCCeEEEEeCCCCceeecCCCCcCCCceeEEE
Q psy11333        421 LGVAVAVLGGFLYAIGGSDGQSPLNTVERFDPKLNRWTAMAPMSTRRKHLGCAV  474 (482)
Q Consensus       421 ~~~~~~~~~~~i~v~GG~~~~~~~~~~~~y~~~~~~W~~~~~~~~~r~~~~~~~  474 (482)
                      ..++++.++|+|||+||.++....+++++||+++++|+.+++||.+|.+|++||
T Consensus       234 ~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         234 SALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             BSCEEEEETTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             cceEEEEECCEEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCcEeEEEEE
Confidence            999999999999999999888888999999999999999999999999999887
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure