Psyllid ID: psy11351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
ccccccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEcccccccEEEEEEcccEEEEEEccccccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEccccccccEEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccEEEEEcccEEEEEEc
ccccccHHEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEccccEEEEEEEcccccccEEEcccccEEEEEEccccccEEEEEcccccEEEEEccccccEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccEcEEEEEEEEEEcccccEEEEEcccccEEEEEcccccEEEcccEEEEEccccEEEEccc
MASGDPIKVLRVignddhvishdmasgdpidfylherpvyglsvdpsqdAIFASACDDGRVLLFDTRSREEATElavnsgpfhavmfnPVEARLVATAnskdgialydtrkpkevlmqygscescmSIRFNKAGtqllglrrrlppvlyntrssspvaqfdhegyynsctmksccfagtqdeyvvsgsddFVLYMwrvprddiyvssdiyvcrhgslevsilpa
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEAtelavnsgpfhAVMFNPVEARLVATAnskdgialydtrkpkEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQllglrrrlPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
******IKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVS****
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
**SGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSIL*A
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVCRHGSLEVSILPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
Q96JK2 942 DDB1- and CUL4-associated yes N/A 0.839 0.199 0.595 6e-64
Q80T85 946 DDB1- and CUL4-associated yes N/A 0.839 0.198 0.590 2e-63
Q5U2M6 591 DDB1- and CUL4-associated no N/A 0.718 0.272 0.274 2e-07
Q5R448 597 DDB1- and CUL4-associated no N/A 0.718 0.269 0.263 2e-07
Q5TAQ9 597 DDB1- and CUL4-associated no N/A 0.718 0.269 0.274 2e-07
Q8N7N5 591 DDB1- and CUL4-associated no N/A 0.718 0.272 0.274 2e-07
O22468415 WD-40 repeat-containing p yes N/A 0.683 0.368 0.232 6e-07
P0C7V8 602 DDB1- and CUL4-associated no N/A 0.718 0.267 0.263 4e-06
Q6NRH1 601 DDB1- and CUL4-associated N/A N/A 0.718 0.267 0.258 4e-06
Q5U4F6535 WD repeat-containing prot no N/A 0.495 0.207 0.290 8e-06
>sp|Q96JK2|DCAF5_HUMAN DDB1- and CUL4-associated factor 5 OS=Homo sapiens GN=DCAF5 PE=1 SV=2 Back     alignment and function desciption
 Score =  243 bits (621), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 115/193 (59%), Positives = 144/193 (74%), Gaps = 5/193 (2%)

Query: 14  GNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEAT 73
           GND+ VI HD+ S + +D + HE  VYGLSV P  D IFAS+ DDGRVL++D R      
Sbjct: 120 GNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGE 179

Query: 74  ELAVNSGP--FHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYG---SCESCMSI 128
              + + P  FH+VMFNPVE RL+ATANSK+G+ L+D RKP+  L++YG   S +S MS+
Sbjct: 180 PFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQSSLLRYGGNLSLQSAMSV 239

Query: 129 RFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGS 188
           RFN  GTQLL LRRRLPPVLY+  S  PV QFD++GY+NSCTMKSCCFAG +D+Y++SGS
Sbjct: 240 RFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGS 299

Query: 189 DDFVLYMWRVPRD 201
           DDF LYMWR+P D
Sbjct: 300 DDFNLYMWRIPAD 312




May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Homo sapiens (taxid: 9606)
>sp|Q80T85|DCAF5_MOUSE DDB1- and CUL4-associated factor 5 OS=Mus musculus GN=Dcaf5 PE=1 SV=2 Back     alignment and function description
>sp|Q5U2M6|DCAF8_RAT DDB1- and CUL4-associated factor 8 OS=Rattus norvegicus GN=Dcaf8 PE=2 SV=1 Back     alignment and function description
>sp|Q5R448|DCAF8_PONAB DDB1- and CUL4-associated factor 8 OS=Pongo abelii GN=DCAF8 PE=2 SV=1 Back     alignment and function description
>sp|Q5TAQ9|DCAF8_HUMAN DDB1- and CUL4-associated factor 8 OS=Homo sapiens GN=DCAF8 PE=1 SV=1 Back     alignment and function description
>sp|Q8N7N5|DCAF8_MOUSE DDB1- and CUL4-associated factor 8 OS=Mus musculus GN=Dcaf8 PE=1 SV=1 Back     alignment and function description
>sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 Back     alignment and function description
>sp|P0C7V8|DC8L2_HUMAN DDB1- and CUL4-associated factor 8-like protein 2 OS=Homo sapiens GN=DCAF8L2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NRH1|DCAF8_XENLA DDB1- and CUL4-associated factor 8 OS=Xenopus laevis GN=dcaf8 PE=2 SV=1 Back     alignment and function description
>sp|Q5U4F6|WDR34_MOUSE WD repeat-containing protein 34 OS=Mus musculus GN=Wdr34 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
345487538 886 PREDICTED: hypothetical protein LOC10011 0.843 0.213 0.571 3e-66
432107116 927 Alpha-actinin-1 [Myotis davidii] 0.839 0.202 0.595 5e-63
383847829 765 PREDICTED: DDB1- and CUL4-associated fac 0.892 0.261 0.601 7e-63
327280348 893 PREDICTED: DDB1- and CUL4-associated fac 0.839 0.210 0.590 9e-63
197100342 860 DDB1- and CUL4-associated factor 5 [Pong 0.839 0.218 0.595 3e-62
355778691 879 hypothetical protein EGM_16752, partial 0.839 0.213 0.595 3e-62
148234935 936 DDB1 and CUL4 associated factor 5 [Xenop 0.839 0.200 0.585 3e-62
403264510 942 PREDICTED: DDB1- and CUL4-associated fac 0.839 0.199 0.595 3e-62
119601385 860 WD repeat domain 22, isoform CRA_a [Homo 0.839 0.218 0.595 3e-62
344273521 880 PREDICTED: DDB1- and CUL4-associated fac 0.839 0.213 0.595 3e-62
>gi|345487538|ref|XP_001601625.2| PREDICTED: hypothetical protein LOC100117364 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 152/196 (77%), Gaps = 7/196 (3%)

Query: 14  GNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEAT 73
           GNDD VI HD+ + D ++F+ HE+PVYGLSV P  D +F+SACDDGRVL++D R    + 
Sbjct: 168 GNDDQVIVHDLKTTDVLNFFRHEKPVYGLSVHPHNDNVFSSACDDGRVLIYDIRGSANSP 227

Query: 74  E----LAVNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGS---CESCM 126
           E    LA +  PFH+VMFNP+   ++ATAN+K+G++++D RKP + +++YGS    +SCM
Sbjct: 228 ESFFCLAQHKNPFHSVMFNPINPVMLATANAKEGVSMWDVRKPLKPVLRYGSEGPAQSCM 287

Query: 127 SIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVS 186
           ++RFN+AGT LL +R+RLPPVLY   S++ + QFDH GYYNSCTMKSCCFAG+ DEY++S
Sbjct: 288 NVRFNEAGTTLLAIRKRLPPVLYAVNSATHLCQFDHPGYYNSCTMKSCCFAGSNDEYILS 347

Query: 187 GSDDFVLYMWRVPRDD 202
           GSDDF LYMW++P DD
Sbjct: 348 GSDDFNLYMWKIPDDD 363




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|432107116|gb|ELK32539.1| Alpha-actinin-1 [Myotis davidii] Back     alignment and taxonomy information
>gi|383847829|ref|XP_003699555.1| PREDICTED: DDB1- and CUL4-associated factor 5-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|327280348|ref|XP_003224914.1| PREDICTED: DDB1- and CUL4-associated factor 5-like, partial [Anolis carolinensis] Back     alignment and taxonomy information
>gi|197100342|ref|NP_001125052.1| DDB1- and CUL4-associated factor 5 [Pongo abelii] gi|55726813|emb|CAH90166.1| hypothetical protein [Pongo abelii] Back     alignment and taxonomy information
>gi|355778691|gb|EHH63727.1| hypothetical protein EGM_16752, partial [Macaca fascicularis] Back     alignment and taxonomy information
>gi|148234935|ref|NP_001090592.1| DDB1 and CUL4 associated factor 5 [Xenopus laevis] gi|120537380|gb|AAI29051.1| LOC100036835 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|403264510|ref|XP_003924521.1| PREDICTED: DDB1- and CUL4-associated factor 5 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|119601385|gb|EAW80979.1| WD repeat domain 22, isoform CRA_a [Homo sapiens] Back     alignment and taxonomy information
>gi|344273521|ref|XP_003408570.1| PREDICTED: DDB1- and CUL4-associated factor 5 [Loxodonta africana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
ZFIN|ZDB-GENE-060929-808 789 dcaf5 "ddb1 and cul4 associate 0.839 0.238 0.549 1.8e-55
UNIPROTKB|F1N0J7 876 DCAF5 "Uncharacterized protein 0.839 0.214 0.559 3.2e-55
UNIPROTKB|Q96JK2 942 DCAF5 "DDB1- and CUL4-associat 0.839 0.199 0.559 5.4e-55
UNIPROTKB|E2QXZ3 947 DCAF5 "Uncharacterized protein 0.839 0.198 0.559 5.6e-55
UNIPROTKB|G3V6K4 946 Dcaf5 "Protein Dcaf5" [Rattus 0.839 0.198 0.559 9.2e-55
MGI|MGI:2444785 946 Dcaf5 "DDB1 and CUL4 associate 0.839 0.198 0.554 1.2e-54
UNIPROTKB|F1NXD8 871 DCAF5 "Uncharacterized protein 0.839 0.215 0.564 4e-54
DICTYBASE|DDB_G0269686 895 DDB_G0269686 "WD40 repeat-cont 0.303 0.075 0.333 1.3e-06
TAIR|locus:2059856415 MSI2 "AT2G16780" [Arabidopsis 0.343 0.185 0.324 2.5e-05
ASPGD|ASPL0000009210447 AN4226 [Emericella nidulans (t 0.705 0.353 0.234 3.7e-05
ZFIN|ZDB-GENE-060929-808 dcaf5 "ddb1 and cul4 associated factor 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 572 (206.4 bits), Expect = 1.8e-55, P = 1.8e-55
 Identities = 106/193 (54%), Positives = 137/193 (70%)

Query:    14 GNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEAT 73
             GND+ VI HD+  G+ ++ +LH+  VYGLSV P  D +FAS+ DDGRVL++DTR      
Sbjct:   118 GNDEQVILHDVERGETLNVFLHDDAVYGLSVSPVNDNVFASSSDDGRVLIWDTREPPHGE 177

Query:    74 ELAVNSGP--FHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYG---SCESCMSI 128
                + + P  FH+VMFNPVE RL+ATANSK+G+ L+D RKP+  L++YG   S +S MS+
Sbjct:   178 PFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPRSSLLRYGGSLSLQSAMSV 237

Query:   129 RFNKAGTQXXXXXXXXPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGS 188
             RFN  GTQ        PPVLY   S  P  QFD++GY+NSCTMKSCCFAG +D+Y++SGS
Sbjct:   238 RFNSTGTQLLALRRRLPPVLYELHSRLPSFQFDNQGYFNSCTMKSCCFAGDRDQYILSGS 297

Query:   189 DDFVLYMWRVPRD 201
             DDF LYMWR+P D
Sbjct:   298 DDFNLYMWRIPTD 310




GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|F1N0J7 DCAF5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96JK2 DCAF5 "DDB1- and CUL4-associated factor 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXZ3 DCAF5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6K4 Dcaf5 "Protein Dcaf5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2444785 Dcaf5 "DDB1 and CUL4 associated factor 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXD8 DCAF5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269686 DDB_G0269686 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2059856 MSI2 "AT2G16780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009210 AN4226 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80T85DCAF5_MOUSENo assigned EC number0.59060.83920.1987yesN/A
Q96JK2DCAF5_HUMANNo assigned EC number0.59580.83920.1995yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 55.0 bits (133), Expect = 4e-09
 Identities = 33/168 (19%), Positives = 62/168 (36%), Gaps = 9/168 (5%)

Query: 32  FYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAVMFNPVE 91
              H   V  ++  P    + A+   DG + ++D  + E    L  ++GP   V  +   
Sbjct: 5   LKGHTGGVTCVAFSPDGK-LLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADG 63

Query: 92  ARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNT 151
             L + ++ K  I L+D    + V    G      S+ F+  G  L    R     +++ 
Sbjct: 64  TYLASGSSDKT-IRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDV 122

Query: 152 RSSSPVAQF-DHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRV 198
            +   +     H  + N     S  F+     +V S S D  + +W +
Sbjct: 123 ETGKCLTTLRGHTDWVN-----SVAFSPDGT-FVASSSQDGTIKLWDL 164


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0263|consensus707 100.0
KOG0271|consensus480 100.0
KOG0279|consensus315 100.0
KOG0279|consensus315 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0286|consensus343 100.0
KOG0315|consensus311 100.0
KOG0285|consensus460 100.0
KOG0266|consensus456 100.0
KOG0273|consensus524 100.0
KOG0271|consensus480 100.0
KOG0266|consensus456 100.0
KOG0284|consensus 464 100.0
KOG0316|consensus307 100.0
KOG0295|consensus406 100.0
KOG0277|consensus311 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0284|consensus 464 100.0
KOG0295|consensus406 100.0
KOG0319|consensus 775 100.0
KOG0273|consensus524 100.0
KOG0276|consensus 794 100.0
KOG0285|consensus460 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0315|consensus311 100.0
KOG0291|consensus 893 100.0
KOG0265|consensus338 100.0
KOG0282|consensus503 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0291|consensus 893 100.0
KOG0645|consensus312 100.0
KOG0275|consensus508 100.0
KOG0281|consensus499 100.0
KOG0319|consensus 775 100.0
KOG0281|consensus499 100.0
KOG0265|consensus338 100.0
KOG0310|consensus 487 99.98
KOG0282|consensus503 99.98
KOG0277|consensus311 99.98
KOG0264|consensus422 99.98
PTZ00421 493 coronin; Provisional 99.97
KOG1407|consensus313 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0640|consensus430 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0269|consensus 839 99.97
KOG0283|consensus 712 99.97
KOG0292|consensus 1202 99.97
KOG0274|consensus537 99.97
KOG0645|consensus312 99.97
KOG0288|consensus459 99.97
KOG0276|consensus 794 99.97
KOG0293|consensus519 99.97
KOG1446|consensus311 99.97
KOG0313|consensus423 99.96
KOG0274|consensus 537 99.96
KOG0313|consensus423 99.96
KOG0283|consensus 712 99.96
KOG0264|consensus422 99.96
KOG0643|consensus327 99.96
KOG0316|consensus 307 99.96
KOG0292|consensus 1202 99.96
KOG0294|consensus362 99.96
KOG0296|consensus 399 99.96
KOG0643|consensus327 99.96
KOG0275|consensus 508 99.96
KOG0289|consensus506 99.96
KOG0278|consensus334 99.96
KOG0310|consensus 487 99.96
KOG0306|consensus 888 99.96
KOG0267|consensus 825 99.96
KOG0318|consensus 603 99.96
KOG0270|consensus463 99.95
KOG0772|consensus 641 99.95
KOG0299|consensus479 99.95
KOG0318|consensus 603 99.95
KOG0300|consensus481 99.95
KOG0308|consensus 735 99.95
KOG0646|consensus 476 99.95
KOG0308|consensus 735 99.95
KOG1332|consensus299 99.95
KOG0289|consensus506 99.95
KOG0268|consensus433 99.95
KOG0302|consensus440 99.95
KOG0270|consensus463 99.95
KOG0647|consensus347 99.95
KOG1407|consensus313 99.95
KOG0772|consensus 641 99.95
KOG0305|consensus484 99.95
KOG0973|consensus 942 99.95
KOG0305|consensus484 99.95
KOG1273|consensus405 99.94
KOG0293|consensus519 99.94
KOG1036|consensus323 99.94
KOG0296|consensus 399 99.94
KOG0299|consensus479 99.94
KOG0278|consensus334 99.94
KOG0269|consensus 839 99.94
KOG0306|consensus 888 99.94
KOG0640|consensus430 99.93
KOG0641|consensus350 99.93
KOG0973|consensus 942 99.93
KOG4283|consensus397 99.93
KOG1274|consensus 933 99.93
KOG0647|consensus 347 99.93
KOG0288|consensus459 99.93
KOG0300|consensus481 99.93
KOG0301|consensus 745 99.92
KOG0267|consensus 825 99.92
KOG0321|consensus 720 99.92
KOG0639|consensus705 99.92
KOG0302|consensus440 99.92
KOG0301|consensus 745 99.92
KOG4328|consensus498 99.92
KOG1408|consensus 1080 99.92
KOG4378|consensus 673 99.92
KOG0641|consensus350 99.92
KOG0639|consensus705 99.91
KOG1332|consensus299 99.91
KOG0303|consensus 472 99.91
KOG0307|consensus 1049 99.91
KOG1539|consensus 910 99.91
KOG1446|consensus311 99.91
KOG1034|consensus385 99.9
KOG0294|consensus362 99.9
KOG4283|consensus397 99.9
KOG1408|consensus 1080 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG2919|consensus406 99.9
KOG0303|consensus 472 99.9
KOG2048|consensus 691 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG0321|consensus 720 99.89
KOG2096|consensus420 99.89
KOG2445|consensus361 99.89
KOG1036|consensus 323 99.89
KOG0646|consensus 476 99.88
KOG2055|consensus514 99.88
KOG0307|consensus 1049 99.88
KOG1274|consensus 933 99.88
KOG2096|consensus420 99.87
KOG1188|consensus 376 99.87
KOG0290|consensus364 99.87
KOG0642|consensus577 99.86
KOG2055|consensus514 99.86
KOG0771|consensus398 99.86
KOG2048|consensus 691 99.86
KOG2110|consensus 391 99.86
KOG1539|consensus 910 99.85
KOG1273|consensus 405 99.85
KOG0649|consensus325 99.85
KOG1445|consensus 1012 99.85
KOG1009|consensus 434 99.84
KOG1445|consensus 1012 99.84
KOG1034|consensus385 99.84
KOG0650|consensus733 99.84
KOG1007|consensus370 99.84
KOG2106|consensus626 99.84
KOG2106|consensus 626 99.84
KOG4378|consensus 673 99.83
KOG1063|consensus764 99.83
KOG0290|consensus364 99.83
KOG1188|consensus376 99.83
KOG0268|consensus433 99.82
KOG1063|consensus764 99.81
KOG3881|consensus412 99.81
KOG4328|consensus 498 99.81
KOG1272|consensus 545 99.8
KOG2110|consensus391 99.8
KOG2445|consensus 361 99.8
KOG1009|consensus 434 99.8
KOG1007|consensus370 99.79
COG2319 466 FOG: WD40 repeat [General function prediction only 99.79
KOG2394|consensus 636 99.79
KOG0644|consensus 1113 99.79
KOG1524|consensus 737 99.78
KOG2919|consensus406 99.77
KOG0649|consensus325 99.77
KOG1310|consensus 758 99.77
KOG4227|consensus 609 99.77
KOG1310|consensus 758 99.76
KOG0322|consensus323 99.76
KOG1523|consensus361 99.75
KOG0322|consensus323 99.75
COG2319 466 FOG: WD40 repeat [General function prediction only 99.74
KOG2111|consensus346 99.74
KOG0650|consensus733 99.73
KOG1587|consensus555 99.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.73
KOG1517|consensus1387 99.73
KOG4227|consensus 609 99.73
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG1272|consensus 545 99.73
KOG1523|consensus 361 99.72
PRK01742429 tolB translocation protein TolB; Provisional 99.72
KOG0771|consensus398 99.71
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.71
KOG1517|consensus1387 99.71
KOG1240|consensus 1431 99.71
KOG1334|consensus 559 99.7
PRK11028330 6-phosphogluconolactonase; Provisional 99.7
PRK01742429 tolB translocation protein TolB; Provisional 99.69
KOG1587|consensus555 99.69
KOG3881|consensus412 99.69
KOG0642|consensus577 99.68
KOG2139|consensus 445 99.68
KOG1538|consensus 1081 99.67
KOG2321|consensus 703 99.67
KOG1963|consensus 792 99.66
PRK04922433 tolB translocation protein TolB; Provisional 99.66
PRK05137435 tolB translocation protein TolB; Provisional 99.66
KOG1538|consensus 1081 99.65
KOG0974|consensus 967 99.65
KOG4547|consensus 541 99.65
PRK03629429 tolB translocation protein TolB; Provisional 99.65
KOG2321|consensus 703 99.64
KOG2394|consensus 636 99.63
PRK04922433 tolB translocation protein TolB; Provisional 99.63
PRK05137435 tolB translocation protein TolB; Provisional 99.63
PRK03629429 tolB translocation protein TolB; Provisional 99.62
KOG0644|consensus 1113 99.62
PRK02889427 tolB translocation protein TolB; Provisional 99.61
PRK02889427 tolB translocation protein TolB; Provisional 99.6
KOG2111|consensus346 99.59
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.59
KOG1524|consensus 737 99.59
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.59
KOG0280|consensus339 99.58
KOG1963|consensus 792 99.57
KOG1064|consensus2439 99.56
KOG0280|consensus339 99.55
KOG4497|consensus 447 99.53
KOG1354|consensus433 99.53
KOG1240|consensus 1431 99.52
KOG0974|consensus 967 99.52
KOG4497|consensus 447 99.49
PRK00178430 tolB translocation protein TolB; Provisional 99.49
KOG2139|consensus445 99.49
PRK00178430 tolB translocation protein TolB; Provisional 99.48
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.46
PRK04792448 tolB translocation protein TolB; Provisional 99.45
KOG4547|consensus 541 99.45
PRK04792448 tolB translocation protein TolB; Provisional 99.45
PRK01029428 tolB translocation protein TolB; Provisional 99.44
KOG3914|consensus 390 99.43
KOG2695|consensus425 99.38
KOG3914|consensus390 99.38
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.35
KOG1409|consensus 404 99.35
KOG2695|consensus425 99.35
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.34
KOG4714|consensus319 99.34
KOG1334|consensus 559 99.34
KOG4190|consensus1034 99.32
KOG1354|consensus 433 99.3
KOG4532|consensus344 99.29
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.24
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.24
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.23
COG4946668 Uncharacterized protein related to the periplasmic 99.22
KOG2315|consensus 566 99.22
KOG1409|consensus404 99.21
KOG4532|consensus344 99.2
PRK01029428 tolB translocation protein TolB; Provisional 99.2
KOG4190|consensus 1034 99.19
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.18
KOG2066|consensus 846 99.17
COG4946 668 Uncharacterized protein related to the periplasmic 99.17
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.16
KOG1064|consensus2439 99.15
PRK04043419 tolB translocation protein TolB; Provisional 99.14
KOG0309|consensus 1081 99.13
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.12
KOG2315|consensus 566 99.12
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.1
KOG0309|consensus 1081 99.08
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.08
KOG4714|consensus319 99.06
KOG1275|consensus 1118 99.05
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.05
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.05
KOG0882|consensus 558 99.05
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.04
KOG1645|consensus463 99.04
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.04
PRK04043419 tolB translocation protein TolB; Provisional 99.04
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.01
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.0
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.97
KOG1275|consensus 1118 98.97
KOG2041|consensus 1189 98.95
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.94
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.9
KOG1832|consensus 1516 98.88
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.87
KOG1912|consensus 1062 98.87
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.86
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.86
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.85
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.83
KOG2066|consensus 846 98.81
KOG0882|consensus 558 98.81
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.79
KOG2041|consensus 1189 98.78
KOG1008|consensus 783 98.78
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.77
KOG1912|consensus 1062 98.74
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.73
KOG2114|consensus 933 98.7
KOG4649|consensus 354 98.7
KOG3621|consensus 726 98.67
KOG2314|consensus 698 98.65
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.63
KOG1832|consensus 1516 98.62
KOG1920|consensus 1265 98.59
KOG2314|consensus 698 98.57
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.57
KOG1645|consensus463 98.54
KOG3621|consensus 726 98.47
PRK02888 635 nitrous-oxide reductase; Validated 98.45
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.43
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.43
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.41
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.41
COG3391381 Uncharacterized conserved protein [Function unknow 98.37
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.35
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.34
KOG4640|consensus 665 98.33
KOG3617|consensus 1416 98.3
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.29
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.28
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.28
KOG4649|consensus 354 98.28
KOG1008|consensus 783 98.24
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.19
KOG2114|consensus 933 98.19
KOG4640|consensus 665 98.15
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.1
KOG3617|consensus 1416 98.06
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.04
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.04
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.03
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.03
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.98
KOG2079|consensus 1206 97.98
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.95
PHA02713557 hypothetical protein; Provisional 97.94
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.93
KOG2395|consensus644 97.93
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.9
COG3391 381 Uncharacterized conserved protein [Function unknow 97.89
KOG1920|consensus 1265 97.87
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.86
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.85
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.82
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.81
PRK02888 635 nitrous-oxide reductase; Validated 97.8
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.8
KOG4441|consensus571 97.79
KOG4441|consensus571 97.78
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.71
KOG2079|consensus 1206 97.69
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.62
PHA03098534 kelch-like protein; Provisional 97.62
KOG2444|consensus238 97.58
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.57
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.55
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 97.53
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.53
KOG2444|consensus238 97.5
PRK13616591 lipoprotein LpqB; Provisional 97.43
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.42
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.42
PRK13616591 lipoprotein LpqB; Provisional 97.34
PHA02790480 Kelch-like protein; Provisional 97.3
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.28
KOG3630|consensus 1405 97.28
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.28
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.19
KOG2395|consensus 644 97.11
PHA02713557 hypothetical protein; Provisional 97.08
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.97
KOG1897|consensus 1096 96.95
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.93
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.84
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.82
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.81
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.8
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 96.79
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.79
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.72
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.63
KOG4499|consensus310 96.58
PHA03098534 kelch-like protein; Provisional 96.49
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.39
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.38
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.35
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.25
KOG2247|consensus 615 96.23
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.18
KOG3630|consensus 1405 96.04
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.04
COG5167776 VID27 Protein involved in vacuole import and degra 95.94
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.85
PF14727 418 PHTB1_N: PTHB1 N-terminus 95.81
KOG4460|consensus 741 95.73
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.72
KOG2377|consensus 657 95.71
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.7
PHA02790480 Kelch-like protein; Provisional 95.64
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.6
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.59
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.57
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.54
COG5167 776 VID27 Protein involved in vacuole import and degra 95.53
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.51
KOG1900|consensus 1311 95.44
KOG4499|consensus310 95.43
KOG1897|consensus 1096 95.42
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.34
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.3
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.18
PF12768281 Rax2: Cortical protein marker for cell polarity 95.17
KOG1916|consensus 1283 95.0
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.93
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.9
PF12768281 Rax2: Cortical protein marker for cell polarity 94.89
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.82
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 94.78
KOG2247|consensus 615 94.74
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.67
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.65
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.15
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 94.06
PLN02153341 epithiospecifier protein 94.06
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 94.04
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 93.9
KOG2377|consensus 657 93.84
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.73
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 93.72
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.69
PRK13684334 Ycf48-like protein; Provisional 93.58
PRK10115 686 protease 2; Provisional 93.55
COG1520370 FOG: WD40-like repeat [Function unknown] 93.47
PLN02193470 nitrile-specifier protein 93.38
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.3
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.17
PF14727 418 PHTB1_N: PTHB1 N-terminus 92.96
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 92.67
KOG1900|consensus 1311 92.46
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.15
KOG1916|consensus 1283 92.06
COG5276370 Uncharacterized conserved protein [Function unknow 91.95
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.93
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 91.78
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 91.77
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 91.66
KOG1898|consensus 1205 91.56
COG1520 370 FOG: WD40-like repeat [Function unknown] 91.4
PLN00033398 photosystem II stability/assembly factor; Provisio 91.24
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 91.12
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 90.85
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 90.63
PRK13684334 Ycf48-like protein; Provisional 89.97
KOG1983|consensus 993 89.56
PF13449326 Phytase-like: Esterase-like activity of phytase 89.32
KOG1896|consensus1366 89.24
COG4590 733 ABC-type uncharacterized transport system, permeas 89.2
COG5276370 Uncharacterized conserved protein [Function unknow 88.51
PF09826521 Beta_propel: Beta propeller domain; InterPro: IPR0 88.51
COG3823262 Glutamine cyclotransferase [Posttranslational modi 88.39
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 88.38
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.37
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 88.31
KOG4460|consensus 741 88.18
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 87.62
TIGR03118 336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 87.47
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 87.14
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 87.13
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 86.84
PLN02193470 nitrile-specifier protein 86.64
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 86.55
KOG3616|consensus 1636 86.34
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 86.2
PF14779257 BBS1: Ciliary BBSome complex subunit 1 86.19
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 85.77
KOG1898|consensus 1205 85.61
KOG2280|consensus 829 84.22
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 84.19
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 83.43
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 83.17
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 82.6
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 82.17
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 82.1
>KOG0272|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-41  Score=246.33  Aligned_cols=203  Identities=17%  Similarity=0.211  Sum_probs=186.8

Q ss_pred             ceEEEEEeCCCcEEEEeCCCCceeeEE-eccCCeeEEEEcCCCCcEEEEecCCCEEEEEecCCcccceeeccCCcCeEEE
Q psy11351          7 IKVLRVIGNDDHVISHDMASGDPIDFY-LHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVNSGPFHAV   85 (224)
Q Consensus         7 ~~~l~~~~~dg~i~iwd~~~~~~~~~~-~~~~~v~~~~~~~~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~~~~~i~~~   85 (224)
                      +..+|+|+.||++++|++.+..++..+ +|...|..++|+|+| ++|+|++.|.+-++||++++..+...++|...|.++
T Consensus       231 ~~~lat~s~Dgtvklw~~~~e~~l~~l~gH~~RVs~VafHPsG-~~L~TasfD~tWRlWD~~tk~ElL~QEGHs~~v~~i  309 (459)
T KOG0272|consen  231 DLNLATASADGTVKLWKLSQETPLQDLEGHLARVSRVAFHPSG-KFLGTASFDSTWRLWDLETKSELLLQEGHSKGVFSI  309 (459)
T ss_pred             ccceeeeccCCceeeeccCCCcchhhhhcchhhheeeeecCCC-ceeeecccccchhhcccccchhhHhhccccccccee
Confidence            458999999999999999998888777 899999999999999 899999999999999999999888889999999999


Q ss_pred             EEcCCCCCeEEEecCCCcEEEEecCCCceeeEeecCCCceeEEEEcCCCCeEeeeecCCCcEEEECCCCCcceec-ccCC
Q psy11351         86 MFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQF-DHEG  164 (224)
Q Consensus        86 ~~~~~~~~~l~~~~~dg~v~i~d~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~v~d~~~~~~~~~~-~~~~  164 (224)
                      +|+| ++.++++|+.|..-+|||+|++.++..+.+|..+|.+|+|+|+|-.|++|+.|++++|||++..+++..+ .|..
T Consensus       310 af~~-DGSL~~tGGlD~~~RvWDlRtgr~im~L~gH~k~I~~V~fsPNGy~lATgs~Dnt~kVWDLR~r~~ly~ipAH~n  388 (459)
T KOG0272|consen  310 AFQP-DGSLAATGGLDSLGRVWDLRTGRCIMFLAGHIKEILSVAFSPNGYHLATGSSDNTCKVWDLRMRSELYTIPAHSN  388 (459)
T ss_pred             EecC-CCceeeccCccchhheeecccCcEEEEecccccceeeEeECCCceEEeecCCCCcEEEeeecccccceecccccc
Confidence            9999 9999999999999999999999999999999999999999999999999999999999999998888888 5777


Q ss_pred             cccceeeeEEEEeCCCCeEEEEcCCCCeEEEEeCCCCCeEeeeeeeEe-eCCceeEEE
Q psy11351        165 YYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIYVSSDIYVC-RHGSLEVSI  221 (224)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~l~s~~~d~~v~iw~~~~~~~~~~~~~~~~-~~~~~~~~~  221 (224)
                      -|+.     ++|+|..|.+|+|++.|++++||...+.++.     ..| ||..-.+++
T Consensus       389 lVS~-----Vk~~p~~g~fL~TasyD~t~kiWs~~~~~~~-----ksLaGHe~kV~s~  436 (459)
T KOG0272|consen  389 LVSQ-----VKYSPQEGYFLVTASYDNTVKIWSTRTWSPL-----KSLAGHEGKVISL  436 (459)
T ss_pred             hhhh-----eEecccCCeEEEEcccCcceeeecCCCcccc-----hhhcCCccceEEE
Confidence            6665     6777767899999999999999999999887     666 888766553



>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF14779 BBS1: Ciliary BBSome complex subunit 1 Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
1pgu_A615 Yeast Actin Interacting Protein 1 (aip1), Se-met Pr 3e-04
1pi6_A615 Yeast Actin Interacting Protein 1 (Aip1), Orthorhom 5e-04
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 7e-04
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 7e-04
>pdb|1PGU|A Chain A, Yeast Actin Interacting Protein 1 (aip1), Se-met Protein, Monoclinic Crystal Form Length = 615 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 21/126 (16%) Query: 1 MASGDPIKVLRVIGNDDHVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGR 60 + G+ I+V ++ D +S D+ + L +P Y +S+ PS+ I A G+ Sbjct: 463 LEEGNTIQVFKL---SDLEVSFDLKTP------LRAKPSY-ISISPSETYIAAGDVX-GK 511 Query: 61 VLLFDTRSRE-EATELAVNSGPFHAVMFNP---------VEARLVATANSKDGIALYDTR 110 +LL+D +SRE + + A + +A+ + P +E LVAT + I +Y + Sbjct: 512 ILLYDLQSREVKTSRWAFRTSKINAISWKPAEKGANEEEIEEDLVATGSLDTNIFIYSVK 571 Query: 111 KPKEVL 116 +P +++ Sbjct: 572 RPXKII 577
>pdb|1PI6|A Chain A, Yeast Actin Interacting Protein 1 (Aip1), Orthorhombic Crystal Form Length = 615 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2xyi_A430 Probable histone-binding protein CAF1; transcripti 8e-12
2xyi_A430 Probable histone-binding protein CAF1; transcripti 2e-11
2xyi_A430 Probable histone-binding protein CAF1; transcripti 1e-07
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-05
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-11
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 4e-07
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-09
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-07
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-06
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 4e-08
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 1e-07
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 5e-07
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 6e-07
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 1e-06
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 1e-06
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 3e-06
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 5e-06
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 2e-05
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 8e-05
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 3e-04
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 4e-06
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 4e-06
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 2e-05
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 3e-04
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 8e-04
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 7e-06
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 9e-06
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 2e-05
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 2e-04
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 2e-05
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 9e-05
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 1e-04
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-04
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 1e-04
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 2e-04
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 4e-04
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 7e-04
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 2e-04
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 6e-04
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 9e-04
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
 Score = 62.8 bits (153), Expect = 8e-12
 Identities = 32/192 (16%), Positives = 75/192 (39%), Gaps = 22/192 (11%)

Query: 35  HERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAVN---SGPFHAVMFNPVE 91
           H   V  ++     +++F S  DD +++++DTR+   +         +   + + FNP  
Sbjct: 230 HTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYS 289

Query: 92  ARLVATANSKDG-IALYDTRKPKEVLMQY-GSCESCMSIRFNKAGTQLLG---------- 139
             ++AT  S D  +AL+D R  K  L  +    +    ++++     +L           
Sbjct: 290 EFILATG-SADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHV 348

Query: 140 ---LRRRLPPVLYNTRSSSPVAQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMW 196
               +        +     P   F H G+     +    +   +   + S S+D ++ +W
Sbjct: 349 WDLSKIGEEQSTEDAEDGPPELLFIHGGHTAK--ISDFSWNPNEPWIICSVSEDNIMQVW 406

Query: 197 RVPRDDIYVSSD 208
           ++  +++Y   +
Sbjct: 407 QM-AENVYNDEE 417


>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 100.0
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.98
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.98
3jro_A 753 Fusion protein of protein transport protein SEC13 99.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.91
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.91
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.9
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.9
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.89
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.88
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.82
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.82
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.81
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.81
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.81
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.8
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.78
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.77
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.76
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.76
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.75
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.74
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.74
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.74
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.73
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.72
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.7
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.68
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.68
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.67
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.67
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.67
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.67
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.65
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.63
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.62
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.61
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.6
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.59
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.59
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.58
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.57
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.56
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.55
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.54
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.54
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.52
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.51
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.51
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.5
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.49
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.47
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.44
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.44
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.43
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.43
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 99.41
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.41
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.4
2qe8_A343 Uncharacterized protein; structural genomics, join 99.36
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.35
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.35
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.34
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.33
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.32
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.3
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.3
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.26
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.25
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.25
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.24
2qe8_A343 Uncharacterized protein; structural genomics, join 99.24
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.21
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.21
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.18
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.16
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.15
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.13
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.1
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.09
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.08
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.08
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.07
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.06
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.06
2ece_A462 462AA long hypothetical selenium-binding protein; 99.06
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.04
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.04
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.01
2ece_A462 462AA long hypothetical selenium-binding protein; 98.99
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.98
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.96
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.96
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.96
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.95
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.91
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.9
3v65_B386 Low-density lipoprotein receptor-related protein; 98.9
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.9
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.89
3v65_B386 Low-density lipoprotein receptor-related protein; 98.87
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.87
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.84
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.82
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.79
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.76
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.73
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.7
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.69
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.63
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.62
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.62
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.62
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.59
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.57
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.53
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.52
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.52
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.5
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.49
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.49
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.48
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.48
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.42
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.38
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.37
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.36
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.35
3kya_A496 Putative phosphatase; structural genomics, joint c 98.34
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.32
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.27
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.26
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.23
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.2
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.13
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.12
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.08
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.07
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.0
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.99
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.96
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.94
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.91
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.9
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.88
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.87
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.78
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.69
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.66
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.62
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.62
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.6
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.6
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.6
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.59
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.56
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.53
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.51
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.46
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.41
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.28
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.26
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.19
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.15
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.1
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.98
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.93
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.88
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.69
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.66
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.64
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 96.56
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.26
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 96.25
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.17
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.09
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.05
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 96.03
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.44
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.39
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.25
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 94.85
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.7
3ott_A 758 Two-component system sensor histidine kinase; beta 93.43
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.05
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 92.98
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 92.32
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 91.84
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.26
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 90.66
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 89.88
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.94
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 88.0
3ott_A 758 Two-component system sensor histidine kinase; beta 87.25
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 84.8
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 84.06
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 80.18
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.9e-40  Score=251.77  Aligned_cols=198  Identities=16%  Similarity=0.223  Sum_probs=170.1

Q ss_pred             CCCCcceEEEEEeCCCcEEEEeCCCCceeeEE-eccCCeeEEEEcCCCCcEEEEecCCCEEEEEecCCcccceeec--cC
Q psy11351          2 ASGDPIKVLRVIGNDDHVISHDMASGDPIDFY-LHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELA--VN   78 (224)
Q Consensus         2 a~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~-~~~~~v~~~~~~~~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~--~~   78 (224)
                      ++++++++|++|+.|++|++||+++++++..+ +|...|++++|+|++..+|++++.|++|++||++++++...+.  .+
T Consensus       134 ~~spdg~~l~sgs~d~~i~iwd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~l~s~s~D~~v~iwd~~~~~~~~~~~~~~~  213 (344)
T 4gqb_B          134 SVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAP  213 (344)
T ss_dssp             EECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECSSCTTEEEEEETTSCEEEEETTSSSCEEECC----
T ss_pred             EECCCCCEEEEEeCCCeEEEEECCCCcEEEEEcCcCCceEEEEecCCCCCceeeeccccccccccccccceeeeeeccee
Confidence            45678899999999999999999999998888 8999999999999986789999999999999999998877764  45


Q ss_pred             CcCeEEEEEcCCCCCeEEEecCCCcEEEEecCCCceeeEeecCCCceeEEEEcCCC-CeEeeeecCCCcEEEECCCCCcc
Q psy11351         79 SGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAG-TQLLGLRRRLPPVLYNTRSSSPV  157 (224)
Q Consensus        79 ~~~i~~~~~~~~~~~~l~~~~~dg~v~i~d~~~~~~~~~~~~~~~~v~~~~~~~~~-~~l~~~~~d~~v~v~d~~~~~~~  157 (224)
                      ...+.+++|+|.+++++++|+.||.|++||+++++.+..+.+|...|++++|+|++ ++|++++.|++|++||+++++.+
T Consensus       214 ~~~~~~~~~~p~~~~~l~sg~~dg~v~~wd~~~~~~~~~~~~h~~~v~~v~fsp~g~~~lasgs~D~~i~vwd~~~~~~~  293 (344)
T 4gqb_B          214 GYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELF  293 (344)
T ss_dssp             CCCEEEEEECSSCTTEEEEEETTSEEEEEESCC--CCEEEECCSSCEEEEEECSSSSCCEEEEETTSCEEEECTTCCEEE
T ss_pred             eccceeeeecCCCCcceEEeccCCcEEEEECCCCcEEEEEcCCCCCEEEEEEccCCCeEEEEEeCCCeEEEEECCCCcEE
Confidence            56799999999778899999999999999999999889999999999999999998 57899999999999999998876


Q ss_pred             eecccCCcccceeeeEEEEeCCCCeEEEEcCCCCeEEEEeCCCCCeE
Q psy11351        158 AQFDHEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIY  204 (224)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~~~d~~v~iw~~~~~~~~  204 (224)
                      ....|.+.|.+     ++|+|.+..+|++++.|++|++|++.+....
T Consensus       294 ~~~~H~~~V~~-----v~~sp~~~~llas~s~D~~v~~w~v~~~~~~  335 (344)
T 4gqb_B          294 RSQAHRDFVRD-----ATWSPLNHSLLTTVGWDHQVVHHVVPTEPLP  335 (344)
T ss_dssp             EECCCSSCEEE-----EEECSSSTTEEEEEETTSCEEEEECCC----
T ss_pred             EEcCCCCCEEE-----EEEeCCCCeEEEEEcCCCeEEEEECCCCCCC
Confidence            65578777654     7778854567889999999999999886553



>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-06
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.002
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.003
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-05
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-04
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.001
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.004
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.004
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 51.0 bits (120), Expect = 2e-08
 Identities = 27/201 (13%), Positives = 63/201 (31%), Gaps = 21/201 (10%)

Query: 18  HVISHDMASGDPIDFYLHERPVYGLSVDPSQDAIFASACDDGRVLLFDTRSREEATELAV 77
            V   D+ +G        E  V  ++V P      A+   D  V ++D+ +      L  
Sbjct: 186 TVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 245

Query: 78  N-------SGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCM---- 126
                       ++V+F   + + V + +    + L++ +                    
Sbjct: 246 ENESGTGHKDSVYSVVFTR-DGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTY 304

Query: 127 --------SIRFNKAGTQLLGLRRRLPPVLYNTRSSSPVAQFD-HEGYYNSCTMKSCCFA 177
                   S+   +    +L   +    + ++ +S +P+     H     S  + +    
Sbjct: 305 IGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSL 364

Query: 178 GTQDEYVVSGSDDFVLYMWRV 198
           G +     +GS D    +W+ 
Sbjct: 365 GPEYNVFATGSGDCKARIWKY 385


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.91
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.89
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.76
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.75
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.67
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.5
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.4
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.39
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.34
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.29
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.23
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.23
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.21
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.14
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.06
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.05
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.01
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.96
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.95
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.95
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.9
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.89
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.83
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.67
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.55
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.47
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.46
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.39
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.17
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.12
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.01
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.8
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.71
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.64
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.61
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.6
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.54
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.5
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.47
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.45
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.41
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.36
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.24
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.16
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.11
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 97.08
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 96.98
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 96.25
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.33
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.28
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.27
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.04
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 93.54
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.35
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 93.27
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.73
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.06
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.16
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 89.66
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.37
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 85.25
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 81.88
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 80.55
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=100.00  E-value=9.3e-37  Score=226.93  Aligned_cols=196  Identities=16%  Similarity=0.164  Sum_probs=170.2

Q ss_pred             CCCCcceEEEEEeCCCcEEEEeCCCCceee--EE-eccCCeeEEEEcCCCCcEEEEecC--CCEEEEEecCCcccceeec
Q psy11351          2 ASGDPIKVLRVIGNDDHVISHDMASGDPID--FY-LHERPVYGLSVDPSQDAIFASACD--DGRVLLFDTRSREEATELA   76 (224)
Q Consensus         2 a~~~~~~~l~~~~~dg~i~iwd~~~~~~~~--~~-~~~~~v~~~~~~~~~~~~l~s~~~--d~~i~iwd~~~~~~~~~~~   76 (224)
                      +..+++++|++|+.||+|+|||+.+++...  .+ .|..+|.+++|+|++ +++++++.  +..+++|++++++....+.
T Consensus        65 ~~sp~g~~latg~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~d~-~~l~~~~~~~~~~~~v~~~~~~~~~~~l~  143 (311)
T d1nr0a1          65 KTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSES-KRIAAVGEGRERFGHVFLFDTGTSNGNLT  143 (311)
T ss_dssp             EECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTS-CEEEEEECCSSCSEEEEETTTCCBCBCCC
T ss_pred             EEeCCCCeEeccccCceEeeeeeeccccccccccccccCccccccccccc-ccccccccccccccccccccccccccccc
Confidence            456789999999999999999999876543  33 799999999999998 78888875  4569999999999999999


Q ss_pred             cCCcCeEEEEEcCCCCCeEEEecCCCcEEEEecCCCceeeEeecCCCceeEEEEcCCCCeEeeeecCCCcEEEECCCCCc
Q psy11351         77 VNSGPFHAVMFNPVEARLVATANSKDGIALYDTRKPKEVLMQYGSCESCMSIRFNKAGTQLLGLRRRLPPVLYNTRSSSP  156 (224)
Q Consensus        77 ~~~~~i~~~~~~~~~~~~l~~~~~dg~v~i~d~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~v~d~~~~~~  156 (224)
                      +|...|.+++|+|++...+++|+.|+.|++||+++.+.......|...|+++.|+|+++++++++.|+.+++||+++++.
T Consensus       144 ~h~~~v~~v~~~~~~~~~l~sgs~d~~i~i~d~~~~~~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v~~~d~~~~~~  223 (311)
T d1nr0a1         144 GQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTK  223 (311)
T ss_dssp             CCSSCEEEEEECSSSSCEEEEEETTSCEEEEETTTBEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCE
T ss_pred             ccccccccccccccceeeecccccccccccccccccccccccccccccccccccCccccccccccccccccccccccccc
Confidence            99999999999994445688999999999999999988888888999999999999999999999999999999998877


Q ss_pred             ceecc--------cCCcccceeeeEEEEeCCCCeEEEEcCCCCeEEEEeCCCCCeE
Q psy11351        157 VAQFD--------HEGYYNSCTMKSCCFAGTQDEYVVSGSDDFVLYMWRVPRDDIY  204 (224)
Q Consensus       157 ~~~~~--------~~~~~~~~~~~~~~~~~~~~~~l~s~~~d~~v~iw~~~~~~~~  204 (224)
                      ...+.        |.+.     +..++|+| ++++|++|+.||.|++||++++++.
T Consensus       224 ~~~~~~~~~~~~~h~~~-----V~~~~~s~-~~~~l~tgs~Dg~v~iwd~~t~~~~  273 (311)
T d1nr0a1         224 TGVFEDDSLKNVAHSGS-----VFGLTWSP-DGTKIASASADKTIKIWNVATLKVE  273 (311)
T ss_dssp             EEECBCTTSSSCSSSSC-----EEEEEECT-TSSEEEEEETTSEEEEEETTTTEEE
T ss_pred             ccccccccccccccccc-----ccccccCC-CCCEEEEEeCCCeEEEEECCCCcEE
Confidence            66652        2333     44578888 7899999999999999999999775



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure