Psyllid ID: psy11415


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70
MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRHI
ccccccccccHHHHEcccccccccHHHHHHHHHHHccccccEEEccccccEEEEEccccccccccccccc
ccccccccccEEEEEEEEccccccccHHHHHHHHHcccEEEEEcccccccEEEEccccccEccccccccc
mvkcdprhgkymaccmlyrgdvvpkdvNSAIATIktkrtiqfvdwcptgfkvginyqpptvvpggdlrhi
mvkcdprhgKYMACCMLYRGDVVPKDVNSAIAtiktkrtiqfvDWCPTGfkvginyqpptvvpggdlrhi
MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRHI
********GKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTV*********
MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRH*
MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRHI
*VKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDL***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query70 2.2.26 [Sep-21-2011]
Q68FR8450 Tubulin alpha-3 chain OS= yes N/A 1.0 0.155 0.942 2e-37
P05214450 Tubulin alpha-3 chain OS= yes N/A 1.0 0.155 0.942 2e-37
Q32KN8450 Tubulin alpha-3 chain OS= yes N/A 1.0 0.155 0.942 2e-37
Q13748450 Tubulin alpha-3C/D chain yes N/A 1.0 0.155 0.942 2e-37
P02552412 Tubulin alpha-1 chain (Fr yes N/A 1.0 0.169 0.928 2e-37
P18288450 Tubulin alpha chain, test N/A N/A 1.0 0.155 0.942 2e-37
Q6PEY2450 Tubulin alpha-3E chain OS yes N/A 1.0 0.155 0.942 2e-37
P06603450 Tubulin alpha-1 chain OS= yes N/A 1.0 0.155 0.942 2e-37
Q6AYZ1449 Tubulin alpha-1C chain OS yes N/A 1.0 0.155 0.928 3e-37
P52273450 Tubulin alpha chain OS=Bo N/A N/A 1.0 0.155 0.942 3e-37
>sp|Q68FR8|TBA3_RAT Tubulin alpha-3 chain OS=Rattus norvegicus GN=Tuba3a PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (388), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/70 (94%), Positives = 68/70 (97%)

Query: 1   MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
           MVKCDPRHGKYMACCMLYRGDVVPKDVN+AIATIKTKRTIQFVDWCPTGFKVGINYQPPT
Sbjct: 302 MVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 361

Query: 61  VVPGGDLRHI 70
           VVPGGDL  +
Sbjct: 362 VVPGGDLAKV 371




Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Rattus norvegicus (taxid: 10116)
>sp|P05214|TBA3_MOUSE Tubulin alpha-3 chain OS=Mus musculus GN=Tuba3a PE=1 SV=1 Back     alignment and function description
>sp|Q32KN8|TBA3_BOVIN Tubulin alpha-3 chain OS=Bos taurus GN=TUBA3 PE=2 SV=1 Back     alignment and function description
>sp|Q13748|TBA3C_HUMAN Tubulin alpha-3C/D chain OS=Homo sapiens GN=TUBA3C PE=1 SV=3 Back     alignment and function description
>sp|P02552|TBA1_CHICK Tubulin alpha-1 chain (Fragment) OS=Gallus gallus PE=1 SV=1 Back     alignment and function description
>sp|P18288|TBAT_ONCMY Tubulin alpha chain, testis-specific OS=Oncorhynchus mykiss PE=2 SV=1 Back     alignment and function description
>sp|Q6PEY2|TBA3E_HUMAN Tubulin alpha-3E chain OS=Homo sapiens GN=TUBA3E PE=1 SV=2 Back     alignment and function description
>sp|P06603|TBA1_DROME Tubulin alpha-1 chain OS=Drosophila melanogaster GN=alphaTub84B PE=2 SV=1 Back     alignment and function description
>sp|Q6AYZ1|TBA1C_RAT Tubulin alpha-1C chain OS=Rattus norvegicus GN=Tuba1c PE=1 SV=1 Back     alignment and function description
>sp|P52273|TBA_BOMMO Tubulin alpha chain OS=Bombyx mori PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
432094860 791 Tubulin alpha-3 chain [Myotis davidii] 1.0 0.088 0.942 1e-36
357613203 1068 Moesin [Danaus plexippus] 1.0 0.065 0.942 1e-36
344295288 758 PREDICTED: tubulin alpha-3 chain-like [L 1.0 0.092 0.942 1e-36
195157178 1216 GL12416 [Drosophila persimilis] gi|19411 1.0 0.057 0.942 1e-36
405955095 427 Tubulin alpha-1C chain [Crassostrea giga 1.0 0.163 0.942 2e-36
126306763 449 PREDICTED: tubulin alpha-1C chain-like [ 1.0 0.155 0.942 2e-36
338727446 506 PREDICTED: tubulin alpha-3 chain-like [E 1.0 0.138 0.942 2e-36
395531101 449 PREDICTED: tubulin alpha-1C chain-like [ 1.0 0.155 0.942 2e-36
444515377 1188 Protein LMBR1L [Tupaia chinensis] 1.0 0.058 0.928 3e-36
449271034 453 Tubulin alpha-3 chain, partial [Columba 1.0 0.154 0.942 3e-36
>gi|432094860|gb|ELK26268.1| Tubulin alpha-3 chain [Myotis davidii] Back     alignment and taxonomy information
 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/70 (94%), Positives = 68/70 (97%)

Query: 1   MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
           MVKCDPRHGKYMACCMLYRGDVVPKDVN+AIATIKTKRTIQFVDWCPTGFKVGINYQPPT
Sbjct: 643 MVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 702

Query: 61  VVPGGDLRHI 70
           VVPGGDL  +
Sbjct: 703 VVPGGDLAKV 712




Source: Myotis davidii

Species: Myotis davidii

Genus: Myotis

Family: Vespertilionidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|357613203|gb|EHJ68371.1| Moesin [Danaus plexippus] Back     alignment and taxonomy information
>gi|344295288|ref|XP_003419344.1| PREDICTED: tubulin alpha-3 chain-like [Loxodonta africana] Back     alignment and taxonomy information
>gi|195157178|ref|XP_002019473.1| GL12416 [Drosophila persimilis] gi|194116064|gb|EDW38107.1| GL12416 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|405955095|gb|EKC22338.1| Tubulin alpha-1C chain [Crassostrea gigas] Back     alignment and taxonomy information
>gi|126306763|ref|XP_001369340.1| PREDICTED: tubulin alpha-1C chain-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|338727446|ref|XP_001496291.3| PREDICTED: tubulin alpha-3 chain-like [Equus caballus] Back     alignment and taxonomy information
>gi|395531101|ref|XP_003767621.1| PREDICTED: tubulin alpha-1C chain-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|444515377|gb|ELV10876.1| Protein LMBR1L [Tupaia chinensis] Back     alignment and taxonomy information
>gi|449271034|gb|EMC81649.1| Tubulin alpha-3 chain, partial [Columba livia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
FB|FBgn0003884450 alphaTub84B "alpha-Tubulin at 1.0 0.155 0.942 2.2e-34
UNIPROTKB|F1N9J7450 LOC100859737 "Uncharacterized 1.0 0.155 0.942 2.2e-34
UNIPROTKB|F2Z4K0450 TUBA3E "Uncharacterized protei 1.0 0.155 0.942 2.2e-34
UNIPROTKB|F6RP72449 F6RP72 "Uncharacterized protei 1.0 0.155 0.942 2.2e-34
UNIPROTKB|Q32KN8450 TUBA3 "Tubulin alpha-3 chain" 1.0 0.155 0.942 2.2e-34
UNIPROTKB|F1PE21450 TUBA3C "Uncharacterized protei 1.0 0.155 0.942 2.2e-34
UNIPROTKB|J9NXT1450 LOC608051 "Uncharacterized pro 1.0 0.155 0.942 2.2e-34
UNIPROTKB|Q13748450 TUBA3C "Tubulin alpha-3C/D cha 1.0 0.155 0.942 2.2e-34
UNIPROTKB|Q6PEY2450 TUBA3E "Tubulin alpha-3E chain 1.0 0.155 0.942 2.2e-34
UNIPROTKB|F1RK98450 LOC100510930 "Uncharacterized 1.0 0.155 0.942 2.2e-34
FB|FBgn0003884 alphaTub84B "alpha-Tubulin at 84B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 66/70 (94%), Positives = 68/70 (97%)

Query:     1 MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
             MVKCDPRHGKYMACCMLYRGDVVPKDVN+AIATIKTKRTIQFVDWCPTGFKVGINYQPPT
Sbjct:   302 MVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 361

Query:    61 VVPGGDLRHI 70
             VVPGGDL  +
Sbjct:   362 VVPGGDLAKV 371




GO:0045298 "tubulin complex" evidence=NAS
GO:0005525 "GTP binding" evidence=IEA;NAS
GO:0005874 "microtubule" evidence=ISS;NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=IEA;ISS
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0051258 "protein polymerization" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0007094 "mitotic spindle assembly checkpoint" evidence=IDA
GO:0009987 "cellular process" evidence=IMP
GO:0005819 "spindle" evidence=IDA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0005813 "centrosome" evidence=IDA
GO:0000235 "astral microtubule" evidence=IDA
UNIPROTKB|F1N9J7 LOC100859737 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4K0 TUBA3E "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6RP72 F6RP72 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KN8 TUBA3 "Tubulin alpha-3 chain" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PE21 TUBA3C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXT1 LOC608051 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13748 TUBA3C "Tubulin alpha-3C/D chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PEY2 TUBA3E "Tubulin alpha-3E chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RK98 LOC100510930 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P68365TBA1C_CRIGRNo assigned EC number0.92851.00.1559yesN/A
P36220TBA_TORMANo assigned EC number0.91421.00.1552N/AN/A
P68361TBA1B_CRIGRNo assigned EC number0.91421.00.1552yesN/A
P68360TBA1B_MERUNNo assigned EC number0.91421.00.1552N/AN/A
P68363TBA1B_HUMANNo assigned EC number0.91421.00.1552yesN/A
Q6PEY2TBA3E_HUMANNo assigned EC number0.94281.00.1555yesN/A
P18258TBA1_PARLINo assigned EC number0.92851.00.1548N/AN/A
P06605TBA3_DROMENo assigned EC number0.92851.00.1555yesN/A
P68369TBA1A_MOUSENo assigned EC number0.92851.00.1552yesN/A
Q71U36TBA1A_HUMANNo assigned EC number0.92851.00.1552yesN/A
Q6P9V9TBA1B_RATNo assigned EC number0.91421.00.1552yesN/A
P09645TBA8_CHICKNo assigned EC number0.92851.00.2160noN/A
Q2HJ86TBA1D_BOVINNo assigned EC number0.92851.00.1548yesN/A
Q8T6A5TBA1_APLCANo assigned EC number0.92851.00.1552N/AN/A
P02552TBA1_CHICKNo assigned EC number0.92851.00.1699yesN/A
P02550TBA1A_PIGNo assigned EC number0.91421.00.1552yesN/A
P41383TBA2_PATVUNo assigned EC number0.92851.00.1548N/AN/A
P68362TBA1A_CRIGRNo assigned EC number0.92851.00.1552yesN/A
P52273TBA_BOMMONo assigned EC number0.94281.00.1555N/AN/A
A5A6J1TBA1A_PANTRNo assigned EC number0.92851.00.1552yesN/A
Q6AY56TBA8_RATNo assigned EC number0.92851.00.1559noN/A
Q32KN8TBA3_BOVINNo assigned EC number0.94281.00.1555yesN/A
Q3ZCJ7TBA1C_BOVINNo assigned EC number0.92851.00.1559yesN/A
Q06331TBA_ENTDONo assigned EC number0.92851.00.1552N/AN/A
Q2XVP4TBA1B_PIGNo assigned EC number0.91421.00.1552yesN/A
Q6AYZ1TBA1C_RATNo assigned EC number0.92851.00.1559yesN/A
P68373TBA1C_MOUSENo assigned EC number0.92851.00.1559yesN/A
P68370TBA1A_RATNo assigned EC number0.92851.00.1552yesN/A
Q4R538TBA1B_MACFANo assigned EC number0.91421.00.1552N/AN/A
Q68FR8TBA3_RATNo assigned EC number0.94281.00.1555yesN/A
P05214TBA3_MOUSENo assigned EC number0.94281.00.1555yesN/A
P06603TBA1_DROMENo assigned EC number0.94281.00.1555yesN/A
Q9NY65TBA8_HUMANNo assigned EC number0.92851.00.1559noN/A
P06604TBA2_DROMENo assigned EC number0.91421.00.1559yesN/A
P05213TBA1B_MOUSENo assigned EC number0.91421.00.1552yesN/A
Q9JJZ2TBA8_MOUSENo assigned EC number0.92851.00.1559noN/A
P81947TBA1B_BOVINNo assigned EC number0.91421.00.1552yesN/A
Q13748TBA3C_HUMANNo assigned EC number0.94281.00.1555yesN/A
Q9BQE3TBA1C_HUMANNo assigned EC number0.92851.00.1559yesN/A
P18288TBAT_ONCMYNo assigned EC number0.94281.00.1555N/AN/A
P08537TBA_XENLANo assigned EC number0.91421.00.1559N/AN/A
Q2HJB8TBA8_BOVINNo assigned EC number0.92851.00.1559noN/A
P30436TBA_ONCKENo assigned EC number0.91421.00.1555N/AN/A
Q5R1W4TBA1B_PANTRNo assigned EC number0.91421.00.1552yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
PLN00221450 PLN00221, PLN00221, tubulin alpha chain; Provision 2e-52
cd02186434 cd02186, alpha_tubulin, The tubulin superfamily in 4e-52
PTZ00335448 PTZ00335, PTZ00335, tubulin alpha chain; Provision 2e-51
pfam03953126 pfam03953, Tubulin_C, Tubulin C-terminal domain 8e-39
COG5023443 COG5023, COG5023, Tubulin [Cytoskeleton] 3e-30
cd00286328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ 1e-18
cd06059382 cd06059, Tubulin, The tubulin superfamily includes 3e-15
cd02187425 cd02187, beta_tubulin, The tubulin superfamily inc 3e-12
PTZ00387465 PTZ00387, PTZ00387, epsilon tubulin; Provisional 8e-12
cd02190379 cd02190, epsilon_tubulin, The tubulin superfamily 8e-12
PLN00220447 PLN00220, PLN00220, tubulin beta chain; Provisiona 2e-11
PTZ00010445 PTZ00010, PTZ00010, tubulin beta chain; Provisiona 7e-10
smart00865120 smart00865, Tubulin_C, Tubulin/FtsZ family, C-term 8e-08
cd02188431 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquit 3e-07
PLN00222454 PLN00222, PLN00222, tubulin gamma chain; Provision 1e-04
>gnl|CDD|177802 PLN00221, PLN00221, tubulin alpha chain; Provisional Back     alignment and domain information
 Score =  167 bits (425), Expect = 2e-52
 Identities = 61/67 (91%), Positives = 65/67 (97%)

Query: 1   MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
           M KCDPRHGKYMACC++YRGDVVPKDVN+A+ATIKTKRTIQFVDWCPTGFK GINYQPPT
Sbjct: 302 MAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPT 361

Query: 61  VVPGGDL 67
           VVPGGDL
Sbjct: 362 VVPGGDL 368


Length = 450

>gnl|CDD|100015 cd02186, alpha_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|185562 PTZ00335, PTZ00335, tubulin alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|217812 pfam03953, Tubulin_C, Tubulin C-terminal domain Back     alignment and domain information
>gnl|CDD|227356 COG5023, COG5023, Tubulin [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>gnl|CDD|100023 cd06059, Tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|100016 cd02187, beta_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|240395 PTZ00387, PTZ00387, epsilon tubulin; Provisional Back     alignment and domain information
>gnl|CDD|100019 cd02190, epsilon_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|215107 PLN00220, PLN00220, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|240228 PTZ00010, PTZ00010, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|214868 smart00865, Tubulin_C, Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|100017 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>gnl|CDD|215108 PLN00222, PLN00222, tubulin gamma chain; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 70
PF03953126 Tubulin_C: Tubulin C-terminal domain; InterPro: IP 99.9
COG5023443 Tubulin [Cytoskeleton] 99.8
PTZ00335448 tubulin alpha chain; Provisional 99.57
PLN00221450 tubulin alpha chain; Provisional 99.55
cd02188431 gamma_tubulin Gamma-tubulin is a ubiquitous phylog 99.55
PTZ00010445 tubulin beta chain; Provisional 99.54
cd02186434 alpha_tubulin The tubulin superfamily includes fiv 99.54
PLN00222454 tubulin gamma chain; Provisional 99.52
cd02187425 beta_tubulin The tubulin superfamily includes five 99.5
PLN00220447 tubulin beta chain; Provisional 99.49
PTZ00387465 epsilon tubulin; Provisional 99.49
cd02190379 epsilon_tubulin The tubulin superfamily includes f 99.46
KOG1375|consensus369 99.24
cd06059382 Tubulin The tubulin superfamily includes five dist 99.16
KOG1376|consensus407 98.86
cd02189446 delta_tubulin The tubulin superfamily includes fiv 98.81
cd00286328 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin 98.77
KOG1374|consensus448 98.68
smart00865120 Tubulin_C Tubulin/FtsZ family, C-terminal domain. 96.5
>PF03953 Tubulin_C: Tubulin C-terminal domain; InterPro: IPR018316 This domain is found in the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
Probab=99.90  E-value=4.3e-24  Score=122.00  Aligned_cols=65  Identities=68%  Similarity=1.210  Sum_probs=58.7

Q ss_pred             CccccCCCCchhhhhhhhcccCChHHHHHHHHHhhhhccccccccCCcceeEEEeccCCccccCC
Q psy11415          1 MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGG   65 (70)
Q Consensus         1 ~~~~~~~~g~~ls~~~~~rG~~~~~~i~~~i~~~~~~~~~~f~~W~p~~~kv~~~~~~p~~~~~~   65 (70)
                      |+++|+++|+|||++++|||+++++||++++.+++++.+++|++|+|+|||+++|++||.+.+.+
T Consensus        40 m~~~~~~~gkyla~~~l~RG~v~~~di~~~i~~ik~~~~~~Fv~W~p~~~kv~~~~~~p~~~~~s  104 (126)
T PF03953_consen   40 MVSCDPRQGKYLACALLYRGDVSPKDINEAIAKIKQKNSIQFVDWIPTGFKVGICKVPPYGQPNS  104 (126)
T ss_dssp             SSSS-TTSS-EEEEEEEEEESSTHHHHHHHHHHHHCTSTTSB-SSSTTCEEEEEESS-STSTTTS
T ss_pred             ccccccccchhhhhhhccccccccchhhhHHHhhhhccccceeeecCchhhcccccCCCcccCCC
Confidence            67899999999999999999999999999999999999999999999999999999999988877



These proteins are GTPases and are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea. This is the C-terminal domain.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006184 GTP catabolic process, 0051258 protein polymerization, 0043234 protein complex; PDB: 3RYH_A 3RYI_A 3HKE_C 3HKD_C 3HKB_A 3N2K_A 3N2G_A 3HKC_C 3RYF_C 3RYC_A ....

>COG5023 Tubulin [Cytoskeleton] Back     alignment and domain information
>PTZ00335 tubulin alpha chain; Provisional Back     alignment and domain information
>PLN00221 tubulin alpha chain; Provisional Back     alignment and domain information
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>PTZ00010 tubulin beta chain; Provisional Back     alignment and domain information
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PLN00222 tubulin gamma chain; Provisional Back     alignment and domain information
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PLN00220 tubulin beta chain; Provisional Back     alignment and domain information
>PTZ00387 epsilon tubulin; Provisional Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>KOG1375|consensus Back     alignment and domain information
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>KOG1376|consensus Back     alignment and domain information
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>KOG1374|consensus Back     alignment and domain information
>smart00865 Tubulin_C Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
3du7_A449 Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domai 3e-38
3hkb_A451 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 4e-38
1z2b_A448 Tubulin-Colchicine-Vinblastine: Stathmin-Like Domai 5e-38
4i4t_A450 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 9e-38
4drx_A437 Gtp-Tubulin In Complex With A Darpin Length = 437 9e-38
3ryc_A451 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 9e-38
1ffx_A451 Tubulin:stathmin-Like Domain Complex Length = 451 1e-37
2xrp_B452 Human Doublecortin N-Dc Repeat (1mjd) And Mammalian 1e-37
1jff_A451 Refined Structure Of Alpha-Beta Tubulin From Zinc-I 1e-37
1sa0_A451 Tubulin-Colchicine: Stathmin-Like Domain Complex Le 1e-37
1tub_A440 Tubulin Alpha-Beta Dimer, Electron Diffraction Leng 1e-37
4ffb_A447 A Tog:alphaBETA-Tubulin Complex Structure Reveals C 1e-25
3ryc_B445 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 9e-09
4i4t_B445 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 1e-08
4drx_B431 Gtp-Tubulin In Complex With A Darpin Length = 431 1e-08
4f61_B445 Tubulin:stathmin-Like Domain Complex Length = 445 1e-08
1z2b_B445 Tubulin-Colchicine-Vinblastine: Stathmin-Like Domai 2e-08
1tub_B427 Tubulin Alpha-Beta Dimer, Electron Diffraction Leng 2e-08
1ffx_B445 Tubulin:stathmin-Like Domain Complex Length = 445 2e-08
2xrp_A445 Human Doublecortin N-Dc Repeat (1mjd) And Mammalian 2e-08
3du7_B445 Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domai 2e-08
4ffb_B463 A Tog:alphaBETA-Tubulin Complex Structure Reveals C 2e-05
2bto_A473 Structure Of Btuba From Prosthecobacter Dejongeii L 9e-05
>pdb|3DU7|A Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domain Complex Length = 449 Back     alignment and structure

Iteration: 1

Score = 152 bits (385), Expect = 3e-38, Method: Composition-based stats. Identities = 65/70 (92%), Positives = 68/70 (97%) Query: 1 MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60 MVKCDPRHGKYMACC+LYRGDVVPKDVN+AIATIKTKRTIQFVDWCPTGFKVGINYQPPT Sbjct: 302 MVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 361 Query: 61 VVPGGDLRHI 70 VVPGGDL + Sbjct: 362 VVPGGDLAKV 371
>pdb|3HKB|A Chain A, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|1Z2B|A Chain A, Tubulin-Colchicine-Vinblastine: Stathmin-Like Domain Complex Length = 448 Back     alignment and structure
>pdb|4I4T|A Chain A, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 450 Back     alignment and structure
>pdb|4DRX|A Chain A, Gtp-Tubulin In Complex With A Darpin Length = 437 Back     alignment and structure
>pdb|3RYC|A Chain A, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|1FFX|A Chain A, Tubulin:stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|2XRP|B Chain B, Human Doublecortin N-Dc Repeat (1mjd) And Mammalian Tubulin (1jff And 3hke) Docked Into The 8-Angstrom Cryo-Em Map Of Doublecortin-Stabilised Microtubules Length = 452 Back     alignment and structure
>pdb|1JFF|A Chain A, Refined Structure Of Alpha-Beta Tubulin From Zinc-Induced Sheets Stabilized With Taxol Length = 451 Back     alignment and structure
>pdb|1SA0|A Chain A, Tubulin-Colchicine: Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|1TUB|A Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction Length = 440 Back     alignment and structure
>pdb|4FFB|A Chain A, A Tog:alphaBETA-Tubulin Complex Structure Reveals Conformation-Based Mechanisms For A Microtubule Polymerase Length = 447 Back     alignment and structure
>pdb|3RYC|B Chain B, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|4I4T|B Chain B, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 445 Back     alignment and structure
>pdb|4DRX|B Chain B, Gtp-Tubulin In Complex With A Darpin Length = 431 Back     alignment and structure
>pdb|4F61|B Chain B, Tubulin:stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|1Z2B|B Chain B, Tubulin-Colchicine-Vinblastine: Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|1TUB|B Chain B, Tubulin Alpha-Beta Dimer, Electron Diffraction Length = 427 Back     alignment and structure
>pdb|1FFX|B Chain B, Tubulin:stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|2XRP|A Chain A, Human Doublecortin N-Dc Repeat (1mjd) And Mammalian Tubulin (1jff And 3hke) Docked Into The 8-Angstrom Cryo-Em Map Of Doublecortin-Stabilised Microtubules Length = 445 Back     alignment and structure
>pdb|3DU7|B Chain B, Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|4FFB|B Chain B, A Tog:alphaBETA-Tubulin Complex Structure Reveals Conformation-Based Mechanisms For A Microtubule Polymerase Length = 463 Back     alignment and structure
>pdb|2BTO|A Chain A, Structure Of Btuba From Prosthecobacter Dejongeii Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
3ryc_A451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 1e-41
3cb2_A475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 9e-36
3ryc_B445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 2e-35
2bto_A473 Tubulin btuba; bacterial tubulin, polymerization, 1e-32
2btq_B426 Tubulin btubb; structural protein, cytoskeletal pr 1e-32
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* 2p4n_A* 1jff_A* 2wbe_A* 3dco_A* ... Length = 451 Back     alignment and structure
 Score =  139 bits (351), Expect = 1e-41
 Identities = 64/67 (95%), Positives = 67/67 (100%)

Query: 1   MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
           MVKCDPRHGKYMACC+LYRGDVVPKDVN+AIATIKTKR+IQFVDWCPTGFKVGINYQPPT
Sbjct: 302 MVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPT 361

Query: 61  VVPGGDL 67
           VVPGGDL
Sbjct: 362 VVPGGDL 368


>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Length = 475 Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 1tvk_B* 1tub_B* 1jff_B* 1ia0_B* 1ffx_B* 1sa0_B* 1sa1_B* ... Length = 445 Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Length = 473 Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Length = 426 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
3ryc_A451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 99.86
3ryc_B445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 99.8
3cb2_A475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 99.76
2btq_B426 Tubulin btubb; structural protein, cytoskeletal pr 99.66
2bto_A473 Tubulin btuba; bacterial tubulin, polymerization, 99.55
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP 97.5
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polyme 97.49
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell d 97.43
2vaw_A394 FTSZ, cell division protein FTSZ; bacterial cell d 97.42
2vxy_A382 FTSZ, cell division protein FTSZ; GTP-binding, nuc 97.17
1rq2_A382 Cell division protein FTSZ; cell cycle, tubulin, G 97.13
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, 96.86
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... Back     alignment and structure
Probab=99.86  E-value=1.9e-22  Score=133.32  Aligned_cols=69  Identities=93%  Similarity=1.644  Sum_probs=65.4

Q ss_pred             CccccCCCCchhhhhhhhcccCChHHHHHHHHHhhhhccccccccCCcceeEEEeccCCccccCCCCcC
Q psy11415          1 MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLRH   69 (70)
Q Consensus         1 ~~~~~~~~g~~ls~~~~~rG~~~~~~i~~~i~~~~~~~~~~f~~W~p~~~kv~~~~~~p~~~~~~~l~~   69 (70)
                      |++|||+.|+|||++++|||+++++||++++.++|.|+.++|++|+|+|||+++|++||...|.++|+.
T Consensus       302 m~~~dp~~gky~a~~~~~RG~v~~~dv~~~i~~ik~k~~~~Fv~W~p~~~kv~i~~~pP~~~p~~~la~  370 (451)
T 3ryc_A          302 MVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAK  370 (451)
T ss_dssp             SSCCCGGGSCEEEEEEEEEESCCHHHHHHHHHHHHHHCCCCBCTTSCEEEEEEEECSCCCCCTTSSBCC
T ss_pred             eEecCCCCCchheehhhcccCCCHHHHHHHHHHHhhcCCcceEEEccCceeeeeeccCCccCCCccccc
Confidence            678999999999999999999999999999999999999999999999999999999999998877653



>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Back     alignment and structure
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 70
d1tuba2195 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (S 6e-31
d1tubb2184 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Su 7e-23
d2btoa2180 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosth 1e-16
>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: Tubulin C-terminal domain-like
family: Tubulin, C-terminal domain
domain: Tubulin alpha-subunit
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  104 bits (261), Expect = 6e-31
 Identities = 64/69 (92%), Positives = 67/69 (97%)

Query: 1   MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPT 60
           MVKCDPRHGKYMACC+LYRGDVVPKDVN+AIATIKTKRTIQFVDWCPTGFKVGINY+PPT
Sbjct: 57  MVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPT 116

Query: 61  VVPGGDLRH 69
           VVPGGDL  
Sbjct: 117 VVPGGDLAK 125


>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 184 Back     information, alignment and structure
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
d1tuba2195 Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 99.79
d1tubb2184 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 99.75
d2btoa2180 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 99.61
>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: Tubulin C-terminal domain-like
family: Tubulin, C-terminal domain
domain: Tubulin alpha-subunit
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.79  E-value=3.2e-20  Score=110.20  Aligned_cols=68  Identities=94%  Similarity=1.665  Sum_probs=62.8

Q ss_pred             CccccCCCCchhhhhhhhcccCChHHHHHHHHHhhhhccccccccCCcceeEEEeccCCccccCCCCc
Q psy11415          1 MVKCDPRHGKYMACCMLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLR   68 (70)
Q Consensus         1 ~~~~~~~~g~~ls~~~~~rG~~~~~~i~~~i~~~~~~~~~~f~~W~p~~~kv~~~~~~p~~~~~~~l~   68 (70)
                      |++++++.|+||++++++||+++++||.+++.+++.++.++|++|+|+++|+++|++||...+.++++
T Consensus        57 ~~~~~~~~~~yls~~~~~RG~~~~~ei~~~i~~ik~~~~~~fv~W~~~~~kv~~~~~~p~~~~~~~l~  124 (195)
T d1tuba2          57 MVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLA  124 (195)
T ss_dssp             SSCCCTTSSCEEEEEEEEESSCCHHHHHHHHHHHTTSSTTCCCSSCSSCCEEEEESSCCCCCTGGGCC
T ss_pred             hcccCCCccHHHHHHHHHhCCCCcchHHHHHHHHHHhCCcchhhhhccceeeeecCCCCccCCCcchh
Confidence            56789999999999999999999999999999999999999999999999999999999877765543



>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure