Psyllid ID: psy11418


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MINERIRHLPNLSGAENSQQHTTAQTVTHLNTNYTQQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNGE
ccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccEEEEEEEEEHHccccccEEEEEEEEccEEEEEEEEccccccHHHHHHHHcccccccEEEEEEEcccccccEEEEEccEEEEEccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHcccccHHHHHHcccccEEEccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHcccccccEEEEEEccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccHHHHHHccHHHHHHHHccccEEEccccccccccccccccccccEEEHHHHHHHHHcccccccccccHHHHHHHHHccccc
cHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHcccEEEEEEHHEEEcccccEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHcccccEEEEEEEEEEcccEEEEEEccHEEEccHccccccHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEccccHccHHHHHHHHHHHHHHHHHHccHHHHEEHcHcHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHccccccccEEEEEEEEEEccccEEEEEHHHHHHHHHHccccccHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccEccccHccHHHHHHHHHHHHHHHHHccHHHHHHHcHcHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccc
minerirhlpnlsgaensqqhtTAQTVTHLntnytqqcLTSEFFRLRSAAVEQMkeqgphpyphkftvtSSLEDFIEKysdlpdaqvlENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKikrgdiigvtgspgktkkgelsiipkkltllspclhmlphmhfgvkdkETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSlgflevetpmmnmiaggatakpfvthhndlnmDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRnegidlthnpefttceFYMAYADYNDLMHLTEDLIsgrkedrnrpcvmanarmyqSEEEFASDLVKikrgdiigvtgspgktkkgelsiipkkltllspclhmlphmhfgvkdkETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSlgflevetpmmnmiaggatakpfvthhndlnMDLYMRIAPElylksthgsykvtyhpdgpesgspveidftppfrrlhmfPALEAalgvklpnptefdtpeankflsdpnge
MINERIrhlpnlsgaensqQHTTAQTVTHLNTNYTQQCLTSEFFRLRSAAVEQMkeqgphpypHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIigvtgspgktkkgelSIIPKKLTLLSPCLHMLPhmhfgvkdkeTRFRQRYLDLMinerirhkfIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFrnegidlthnpeFTTCEFYMAYADYNDLMHLTEDLIsgrkedrnrPCVMANARMYQSEEEFASDLVKIKRGDIigvtgspgktkkgelSIIPKKLTLLSPCLHMLPhmhfgvkdkeTRFRQRYLDLMinerirhkfIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYhpdgpesgspVEIDFTPPFRRLHMFPALEAALGVKlpnptefdtpeankflsdpnge
MINERIRHLPNLSGAENSQQHTTAQTVTHLNTNYTQQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNGE
**************************VTHLNTNYTQQCLTSEFFRLRSAA*************HKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGS****KKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG********CVMANARMY****EFASDLVKIKRGDIIGVTGS*****KGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYH**********EIDFTPPFRRLHMFPALEAALGVK**********************
********************************************RLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNG*
MINERIRHLPNLS**********AQTVTHLNTNYTQQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNGE
MINERIRHLPNLSGAENS*****************QQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNGE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINERIRHLPNLSGAENSQQHTTAQTVTHLNTNYTQQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDPNGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query553 2.2.26 [Sep-21-2011]
Q99MN1595 Lysine--tRNA ligase OS=Mu yes N/A 0.412 0.383 0.703 1e-123
Q15046597 Lysine--tRNA ligase OS=Ho yes N/A 0.412 0.381 0.700 1e-123
P37879597 Lysine--tRNA ligase OS=Cr yes N/A 0.517 0.479 0.700 1e-122
Q22099572 Lysine--tRNA ligase OS=Ca yes N/A 0.515 0.498 0.639 1e-111
Q6F2U9602 Lysine--tRNA ligase OS=Or yes N/A 0.518 0.476 0.564 1e-100
P15180591 Lysine--tRNA ligase, cyto yes N/A 0.517 0.483 0.575 3e-98
Q9UUE6591 Lysine--tRNA ligase, cyto yes N/A 0.524 0.490 0.579 2e-96
Q9ZPI1626 Lysine--tRNA ligase OS=Ar yes N/A 0.564 0.498 0.522 2e-96
Q43776588 Lysine--tRNA ligase OS=So N/A N/A 0.515 0.484 0.509 2e-89
Q8SS56440 Probable lysine--tRNA lig yes N/A 0.405 0.509 0.576 1e-76
>sp|Q99MN1|SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus GN=Kars PE=1 SV=1 Back     alignment and function desciption
 Score =  442 bits (1136), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/287 (70%), Positives = 249/287 (86%)

Query: 41  SEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVH 100
           ++++++RS AV+Q+K  G  PYPHKF V  SL  FI++YS L     L +VTL VAGR+H
Sbjct: 72  NQYYKIRSQAVQQLKVTGEDPYPHKFHVDISLTQFIQEYSHLQPGDHLTDVTLKVAGRIH 131

Query: 101 AIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKK 160
           A R SG KL+FYDLRGEG+K+QVMAN+R Y+SEEEF     K++RGDIIGV G+PGKTKK
Sbjct: 132 AKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFVHINNKLRRGDIIGVEGNPGKTKK 191

Query: 161 GELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAY 220
           GELSIIP+++TLLSPCLHMLPH+HFG+KDKETR+RQRYLDL++N+ +R KFIVR++II Y
Sbjct: 192 GELSIIPQEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIVRSKIITY 251

Query: 221 VRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLD 280
           +R +LD LGFLE+ETPMMN+I GGA AKPF+T+HN+L+M+LYMRIAPELY KMLVVGG+D
Sbjct: 252 IRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID 311

Query: 281 RVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG 327
           RVYE+GRQFRNEGIDLTHNPEFTTCEFYMAYADY+DLM +TE ++SG
Sbjct: 312 RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMLSG 358




Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 6
>sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens GN=KARS PE=1 SV=3 Back     alignment and function description
>sp|P37879|SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus GN=KARS PE=1 SV=1 Back     alignment and function description
>sp|Q22099|SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans GN=krs-1 PE=2 SV=1 Back     alignment and function description
>sp|Q6F2U9|SYK_ORYSJ Lysine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os03g0586800 PE=2 SV=1 Back     alignment and function description
>sp|P15180|SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRS1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UUE6|SYKC_SCHPO Lysine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krs1 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZPI1|SYK_ARATH Lysine--tRNA ligase OS=Arabidopsis thaliana GN=At3g11710 PE=2 SV=1 Back     alignment and function description
>sp|Q43776|SYK_SOLLC Lysine--tRNA ligase OS=Solanum lycopersicum GN=LYSRS PE=2 SV=1 Back     alignment and function description
>sp|Q8SS56|SYKC_ENCCU Probable lysine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0580 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
328712348595 PREDICTED: lysyl-tRNA synthetase-like is 0.412 0.383 0.770 1e-134
328712346579 PREDICTED: lysyl-tRNA synthetase-like is 0.412 0.393 0.770 1e-134
328712350610 PREDICTED: lysyl-tRNA synthetase-like is 0.412 0.373 0.770 1e-134
357607828579 hypothetical protein KGM_09581 [Danaus p 0.564 0.538 0.685 1e-130
389611239578 lysyl-tRNA synthetase [Papilio polytes] 0.549 0.525 0.709 1e-130
170064641585 lysyl-tRNA synthetase [Culex quinquefasc 0.518 0.490 0.743 1e-129
312371338 1172 hypothetical protein AND_22229 [Anophele 0.518 0.244 0.743 1e-129
198467359584 GA11433 [Drosophila pseudoobscura pseudo 0.518 0.491 0.739 1e-129
350401411588 PREDICTED: lysyl-tRNA synthetase-like [B 0.518 0.488 0.743 1e-128
383857048586 PREDICTED: lysine--tRNA ligase-like [Meg 0.558 0.527 0.699 1e-128
>gi|328712348|ref|XP_001951614.2| PREDICTED: lysyl-tRNA synthetase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/287 (77%), Positives = 256/287 (89%)

Query: 41  SEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVH 100
           +EFF LR   + QMK+ G  PYPHKF VT SLE+FIEK+S L + Q+L +   SVAGRVH
Sbjct: 74  NEFFSLRLQTIAQMKKDGEEPYPHKFNVTISLEEFIEKFSSLAETQILHDEKYSVAGRVH 133

Query: 101 AIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKK 160
           AIRESG KL+FYDLRGEG+KIQVMANA+ Y +EE F SD  KI+RGDIIGVTGSPGKTKK
Sbjct: 134 AIRESGPKLIFYDLRGEGVKIQVMANAKQYTTEESFLSDTSKIRRGDIIGVTGSPGKTKK 193

Query: 161 GELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAY 220
           GELSI P+ + LL+PCLHMLPHMH+G+KDKETR+RQRYLDL+INE +R+KFIVRA++I+Y
Sbjct: 194 GELSIFPQNIKLLTPCLHMLPHMHYGLKDKETRYRQRYLDLIINEHVRNKFIVRAKVISY 253

Query: 221 VRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLD 280
           VRR+LD+LGFLE+ETPMMNMIAGGATAKPF+THHNDLNMDL+MR+APELY KMLVVGG+D
Sbjct: 254 VRRFLDNLGFLEIETPMMNMIAGGATAKPFITHHNDLNMDLFMRVAPELYHKMLVVGGID 313

Query: 281 RVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG 327
           RVYE+GRQFRNE IDLTHNPEFTTCEFYMAYADYNDLM +TEDL+SG
Sbjct: 314 RVYEIGRQFRNEAIDLTHNPEFTTCEFYMAYADYNDLMQITEDLLSG 360




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328712346|ref|XP_003244783.1| PREDICTED: lysyl-tRNA synthetase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328712350|ref|XP_003244784.1| PREDICTED: lysyl-tRNA synthetase-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357607828|gb|EHJ65702.1| hypothetical protein KGM_09581 [Danaus plexippus] Back     alignment and taxonomy information
>gi|389611239|dbj|BAM19231.1| lysyl-tRNA synthetase [Papilio polytes] Back     alignment and taxonomy information
>gi|170064641|ref|XP_001867610.1| lysyl-tRNA synthetase [Culex quinquefasciatus] gi|167881959|gb|EDS45342.1| lysyl-tRNA synthetase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312371338|gb|EFR19556.1| hypothetical protein AND_22229 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|198467359|ref|XP_001354371.2| GA11433 [Drosophila pseudoobscura pseudoobscura] gi|198149207|gb|EAL31424.2| GA11433 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|350401411|ref|XP_003486141.1| PREDICTED: lysyl-tRNA synthetase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857048|ref|XP_003704018.1| PREDICTED: lysine--tRNA ligase-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
UNIPROTKB|F1S458625 KARS "Lysine--tRNA ligase" [Su 0.585 0.518 0.654 3.3e-132
MGI|MGI:1934754595 Kars "lysyl-tRNA synthetase" [ 0.558 0.519 0.664 4.2e-132
UNIPROTKB|Q15046597 KARS "Lysine--tRNA ligase" [Ho 0.566 0.524 0.649 1.1e-131
RGD|1359653626 Kars "lysyl-tRNA synthetase" [ 0.566 0.5 0.650 1.1e-131
UNIPROTKB|D4ABR8597 Kars "Lysine--tRNA ligase" [Ra 0.566 0.524 0.650 1.1e-131
UNIPROTKB|E2RSP4625 KARS "Lysine--tRNA ligase" [Ca 0.566 0.500 0.649 6.1e-131
UNIPROTKB|F1MMK8623 KARS "Lysine--tRNA ligase" [Bo 0.518 0.460 0.700 3.3e-130
UNIPROTKB|E1C3E0581 KARS "Lysine--tRNA ligase" [Ga 0.564 0.537 0.658 1.4e-129
UNIPROTKB|F1NE72590 KARS "Lysine--tRNA ligase" [Ga 0.564 0.528 0.655 1.4e-129
ZFIN|ZDB-GENE-021115-8602 kars "lysyl-tRNA synthetase" [ 0.518 0.476 0.693 1.4e-129
UNIPROTKB|F1S458 KARS "Lysine--tRNA ligase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 1117 (398.3 bits), Expect = 3.3e-132, Sum P(2) = 3.3e-132
 Identities = 216/330 (65%), Positives = 265/330 (80%)

Query:     2 INERIRHLPNLSGAENSQQHTTAQTVTHLNTNYT---QQCLT-SEFFRLRSAAVEQMKEQ 57
             I E+      LS  + SQ  TTA T  H   N     ++ L  +++F++RS AV Q+K  
Sbjct:    61 IAEKEAKQKELSEKQLSQA-TTAAT-NHTTDNGVAAEEESLDPNQYFKIRSQAVHQLKVS 118

Query:    58 GPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGE 117
             G  PYPHKF V  SL  FIE+YS L     L ++TL VAGR+HA R SG KL+FYDLRGE
Sbjct:   119 GEDPYPHKFHVDISLTHFIEEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGE 178

Query:   118 GLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCL 177
             G+K+QVMAN+R Y+SEEEF     K++RGDIIGV GSPGKTKKGELSIIP ++TLLSPCL
Sbjct:   179 GVKLQVMANSRNYKSEEEFVRINNKLRRGDIIGVQGSPGKTKKGELSIIPYEITLLSPCL 238

Query:   178 HMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPM 237
             HMLPH+HFG+KDKETR+RQRYLDL++N+ +R KFI+R++II Y+R +LD+LGFLE+ETPM
Sbjct:   239 HMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDALGFLEIETPM 298

Query:   238 MNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLT 297
             MN+I GGA AKPF+T+HN+L+M+LYMRIAPELY KMLVVGG+DRVYE+GRQFRNEGIDLT
Sbjct:   299 MNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLT 358

Query:   298 HNPEFTTCEFYMAYADYNDLMHLTEDLISG 327
             HNPEFTTCEFYMAYADY+DLM +TE ++SG
Sbjct:   359 HNPEFTTCEFYMAYADYHDLMEITEKMVSG 388


GO:0015630 "microtubule cytoskeleton" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0004824 "lysine-tRNA ligase activity" evidence=IEA
GO:0006430 "lysyl-tRNA aminoacylation" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
MGI|MGI:1934754 Kars "lysyl-tRNA synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15046 KARS "Lysine--tRNA ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1359653 Kars "lysyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4ABR8 Kars "Lysine--tRNA ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSP4 KARS "Lysine--tRNA ligase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMK8 KARS "Lysine--tRNA ligase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3E0 KARS "Lysine--tRNA ligase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE72 KARS "Lysine--tRNA ligase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021115-8 kars "lysyl-tRNA synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q22099SYK_CAEEL6, ., 1, ., 1, ., 60.63980.51530.4982yesN/A
Q15046SYK_HUMAN6, ., 1, ., 1, ., 60.70030.41220.3819yesN/A
Q8SS56SYKC_ENCCU6, ., 1, ., 1, ., 60.57690.40500.5090yesN/A
Q9ZPI1SYK_ARATH6, ., 1, ., 1, ., 60.52230.56410.4984yesN/A
Q6F2U9SYK_ORYSJ6, ., 1, ., 1, ., 60.56490.51890.4767yesN/A
Q9UUE6SYKC_SCHPO6, ., 1, ., 1, ., 60.57910.52440.4906yesN/A
P15180SYKC_YEAST6, ., 1, ., 1, ., 60.57530.51710.4839yesN/A
Q99MN1SYK_MOUSE6, ., 1, ., 1, ., 60.70380.41220.3831yesN/A
P37879SYK_CRIGR6, ., 1, ., 1, ., 60.70030.51710.4790yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.1.1.60.914
3rd Layer6.1.10.921

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
PLN02502553 PLN02502, PLN02502, lysyl-tRNA synthetase 1e-166
PRK00484491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 1e-135
COG1190502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [T 1e-135
TIGR00499496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukar 1e-122
PTZ00417585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisiona 1e-120
PRK029831094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 3e-88
cd00775329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) c 1e-86
PLN02502 553 PLN02502, PLN02502, lysyl-tRNA synthetase 1e-77
PRK12445505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewe 2e-75
PRK00484 491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 1e-73
COG1190 502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [T 2e-73
PTZ00385659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisi 4e-64
TIGR00499 496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukar 4e-61
PTZ00417 585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisiona 7e-58
pfam00152345 pfam00152, tRNA-synt_2, tRNA synthetases class II 5e-55
cd00775 329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) c 4e-51
cd04322108 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon r 9e-48
cd00669269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syn 1e-44
PRK02983 1094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 2e-44
PRK12445 505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewe 4e-41
cd04322108 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon r 7e-32
PTZ00385 659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisi 1e-26
COG0017435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetas 2e-26
PRK05159437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisio 1e-24
pfam00152 345 pfam00152, tRNA-synt_2, tRNA synthetases class II 1e-23
COG0173 585 COG0173, AspS, Aspartyl-tRNA synthetase [Translati 2e-23
TIGR00458428 TIGR00458, aspS_nondisc, nondiscriminating asparty 2e-22
PRK00476 588 PRK00476, aspS, aspartyl-tRNA synthetase; Validate 3e-21
TIGR00459 583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, ba 4e-21
PLN02903 652 PLN02903, PLN02903, aminoacyl-tRNA ligase 3e-19
COG2269322 COG2269, COG2269, Truncated, possibly inactive, ly 5e-19
cd00669 269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syn 3e-18
TIGR00462290 TIGR00462, genX, EF-P lysine aminoacylase GenX 3e-17
cd0410085 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-ter 4e-17
PRK12820 706 PRK12820, PRK12820, bifunctional aspartyl-tRNA syn 6e-16
PRK09350306 PRK09350, PRK09350, poxB regulator PoxA; Provision 9e-16
cd00777280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) c 6e-14
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA am 1e-13
cd00776322 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/As 1e-13
PRK00476 588 PRK00476, aspS, aspartyl-tRNA synthetase; Validate 4e-13
PLN02850530 PLN02850, PLN02850, aspartate-tRNA ligase 9e-13
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding 4e-12
TIGR00457453 TIGR00457, asnS, asparaginyl-tRNA synthetase 7e-11
COG0173 585 COG0173, AspS, Aspartyl-tRNA synthetase [Translati 1e-10
PTZ00401550 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Prov 3e-09
PRK06462335 PRK06462, PRK06462, asparagine synthetase A; Revie 5e-09
PRK05159 437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisio 2e-08
COG0017 435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetas 1e-07
cd04317135 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-termina 2e-07
TIGR00459 583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, ba 1e-06
PLN02903 652 PLN02903, PLN02903, aminoacyl-tRNA ligase 3e-06
TIGR00458 428 TIGR00458, aspS_nondisc, nondiscriminating asparty 3e-05
PTZ00385 659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisi 5e-05
cd0410085 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-ter 6e-05
PRK12820 706 PRK12820, PRK12820, bifunctional aspartyl-tRNA syn 2e-04
cd00777 280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) c 2e-04
COG2269 322 COG2269, COG2269, Truncated, possibly inactive, ly 4e-04
PRK03932450 PRK03932, asnC, asparaginyl-tRNA synthetase; Valid 4e-04
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA am 5e-04
cd04316108 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-t 8e-04
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding 0.002
TIGR00468293 TIGR00468, pheS, phenylalanyl-tRNA synthetase, alp 0.003
>gnl|CDD|215278 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
 Score =  481 bits (1241), Expect = e-166
 Identities = 172/288 (59%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 41  SEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVH 100
           +++   R   VE ++ +G  PYP+KF VT +  +  EKY  L + + LE+V++SVAGR+ 
Sbjct: 59  TQYRANRLKKVEALRAKGVEPYPYKFDVTHTAPELQEKYGSLENGEELEDVSVSVAGRIM 118

Query: 101 AIRESGTKLMFYDLRGEGLKIQVMANARMY-QSEEEFASDLVKIKRGDIIGVTGSPGKTK 159
           A R  G KL FYDLR +G KIQ+ A+ +     EEEF      + RGDI+GVTG+PGKTK
Sbjct: 119 AKRAFG-KLAFYDLRDDGGKIQLYADKKRLDLDEEEFEKLHSLVDRGDIVGVTGTPGKTK 177

Query: 160 KGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIA 219
           KGELSI P    +L+ CL MLP  + G+ D+ETR+RQRYLDL+ N  +R  F  RA+II+
Sbjct: 178 KGELSIFPTSFEVLTKCLLMLPDKYHGLTDQETRYRQRYLDLIANPEVRDIFRTRAKIIS 237

Query: 220 YVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGL 279
           Y+RR+LD  GFLEVETPM+NMIAGGA A+PFVTHHNDLNMDLY+RIA EL+LK LVVGG 
Sbjct: 238 YIRRFLDDRGFLEVETPMLNMIAGGAAARPFVTHHNDLNMDLYLRIATELHLKRLVVGGF 297

Query: 280 DRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG 327
           +RVYE+GRQFRNEGI   HNPEFTTCEFY AYADYND+M LTE+++SG
Sbjct: 298 ERVYEIGRQFRNEGISTRHNPEFTTCEFYQAYADYNDMMELTEEMVSG 345


Length = 553

>gnl|CDD|234778 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|224111 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232998 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|235095 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|238398 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|215278 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|234778 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|224111 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|232998 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|215753 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|238398 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|239817 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>gnl|CDD|238358 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|235095 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|239817 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223096 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235354 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215753 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|223251 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_nondisc, nondiscriminating aspartyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234775 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|211576 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|215490 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|225178 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238358 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|232984 TIGR00462, genX, EF-P lysine aminoacylase GenX Back     alignment and domain information
>gnl|CDD|239766 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|236474 PRK09350, PRK09350, poxB regulator PoxA; Provisional Back     alignment and domain information
>gnl|CDD|238400 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|238399 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>gnl|CDD|234775 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215456 PLN02850, PLN02850, aspartate-tRNA ligase Back     alignment and domain information
>gnl|CDD|216440 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information
>gnl|CDD|232982 TIGR00457, asnS, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223251 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235808 PRK06462, PRK06462, asparagine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|235354 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223096 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239812 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>gnl|CDD|211576 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|215490 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_nondisc, nondiscriminating aspartyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|239766 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|238400 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|225178 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235176 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|239811 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|216440 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information
>gnl|CDD|232988 TIGR00468, pheS, phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 553
KOG1885|consensus 560 100.0
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation 100.0
PLN02502553 lysyl-tRNA synthetase 100.0
TIGR00499496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 100.0
PRK12445505 lysyl-tRNA synthetase; Reviewed 100.0
PTZ00417585 lysine-tRNA ligase; Provisional 100.0
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 100.0
PRK029831094 lysS lysyl-tRNA synthetase; Provisional 100.0
PTZ00385659 lysyl-tRNA synthetase; Provisional 100.0
PLN02850530 aspartate-tRNA ligase 100.0
TIGR00458428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 100.0
PRK05159437 aspC aspartyl-tRNA synthetase; Provisional 100.0
PTZ00401550 aspartyl-tRNA synthetase; Provisional 100.0
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 100.0
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 100.0
PRK03932450 asnC asparaginyl-tRNA synthetase; Validated 100.0
TIGR00457453 asnS asparaginyl-tRNA synthetase. In a multiple se 100.0
PLN02903 652 aminoacyl-tRNA ligase 100.0
PRK00476 588 aspS aspartyl-tRNA synthetase; Validated 100.0
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 100.0
PLN02603565 asparaginyl-tRNA synthetase 100.0
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, riboso 100.0
PLN02221572 asparaginyl-tRNA synthetase 100.0
PTZ00425586 asparagine-tRNA ligase; Provisional 100.0
KOG0556|consensus533 100.0
PLN02532633 asparagine-tRNA synthetase 100.0
KOG0555|consensus545 100.0
KOG2411|consensus 628 100.0
KOG0554|consensus446 100.0
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 100.0
PF00152335 tRNA-synt_2: tRNA synthetases class II (D, K and N 100.0
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 100.0
PRK06462335 asparagine synthetase A; Reviewed 100.0
PRK12445 505 lysyl-tRNA synthetase; Reviewed 99.98
KOG1885|consensus 560 99.98
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 99.97
COG1190 502 LysU Lysyl-tRNA synthetase (class II) [Translation 99.97
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 99.97
PTZ00417 585 lysine-tRNA ligase; Provisional 99.97
PLN02502 553 lysyl-tRNA synthetase 99.97
TIGR00462304 genX lysyl-tRNA synthetase-like protein GenX. Many 99.97
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 99.97
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 99.97
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 99.97
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, riboso 99.97
PRK00476 588 aspS aspartyl-tRNA synthetase; Validated 99.97
PTZ00385 659 lysyl-tRNA synthetase; Provisional 99.97
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 99.96
PLN02903 652 aminoacyl-tRNA ligase 99.96
PLN02532 633 asparagine-tRNA synthetase 99.96
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 99.96
PLN02850 530 aspartate-tRNA ligase 99.96
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 99.96
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 99.96
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 99.96
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 99.96
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 99.96
PLN02221 572 asparaginyl-tRNA synthetase 99.96
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II co 99.95
PTZ00425 586 asparagine-tRNA ligase; Provisional 99.95
PRK09350306 poxB regulator PoxA; Provisional 99.95
PLN02603 565 asparaginyl-tRNA synthetase 99.95
KOG0556|consensus 533 99.94
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetas 99.91
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 99.89
KOG2411|consensus 628 99.88
KOG0554|consensus 446 99.88
PF00152 335 tRNA-synt_2: tRNA synthetases class II (D, K and N 99.84
PRK06462 335 asparagine synthetase A; Reviewed 99.82
cd00776 322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 99.82
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod 99.81
KOG0555|consensus 545 99.79
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 99.73
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 99.72
TIGR00462 304 genX lysyl-tRNA synthetase-like protein GenX. Many 99.7
COG2269 322 Truncated, possibly inactive, lysyl-tRNA synthetas 99.7
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 99.69
cd00775 329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 99.64
cd00777 280 AspRS_core Asp tRNA synthetase (aspRS) class II co 99.61
PRK09350 306 poxB regulator PoxA; Provisional 99.59
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 99.58
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a 99.55
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 99.52
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod 99.51
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 99.5
PRK09537417 pylS pyrolysyl-tRNA synthetase; Reviewed 99.32
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 99.13
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl s 99.12
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 99.05
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod 98.93
TIGR02367453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 98.92
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetas 98.7
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 98.67
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe 98.62
PF01409247 tRNA-synt_2d: tRNA synthetases class II core domai 98.61
COG0124429 HisS Histidyl-tRNA synthetase [Translation, riboso 98.59
TIGR00442397 hisS histidyl-tRNA synthetase. This model finds a 98.54
PF00587173 tRNA-synt_2b: tRNA synthetase class II core domain 98.51
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 98.49
CHL00201430 syh histidine-tRNA synthetase; Provisional 98.47
PRK12292391 hisZ ATP phosphoribosyltransferase regulatory subu 98.44
PLN02972763 Histidyl-tRNA synthetase 98.41
PLN02530487 histidine-tRNA ligase 98.39
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 98.37
TIGR00468294 pheS phenylalanyl-tRNA synthetase, alpha subunit. 98.37
PTZ00326494 phenylalanyl-tRNA synthetase alpha chain; Provisio 98.36
PRK00037412 hisS histidyl-tRNA synthetase; Reviewed 98.34
TIGR00443314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 98.33
PRK04172489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 98.32
PRK12421392 ATP phosphoribosyltransferase regulatory subunit; 98.3
PRK00488339 pheS phenylalanyl-tRNA synthetase subunit alpha; V 98.3
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 98.29
PF13393311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 98.28
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 98.26
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subu 98.25
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 98.23
PRK12420423 histidyl-tRNA synthetase; Provisional 98.23
PLN02853492 Probable phenylalanyl-tRNA synthetase alpha chain 98.2
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 98.15
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [T 98.14
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 98.13
PRK09194 565 prolyl-tRNA synthetase; Provisional 98.13
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 98.12
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 98.05
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subu 98.05
PLN02788402 phenylalanine-tRNA synthetase 98.0
PRK00413638 thrS threonyl-tRNA synthetase; Reviewed 97.97
PLN02908686 threonyl-tRNA synthetase 97.95
TIGR00418563 thrS threonyl-tRNA synthetase. This model represen 97.94
PRK14799545 thrS threonyl-tRNA synthetase; Provisional 97.94
PRK12305575 thrS threonyl-tRNA synthetase; Reviewed 97.93
PRK12444639 threonyl-tRNA synthetase; Reviewed 97.85
PRK08661477 prolyl-tRNA synthetase; Provisional 97.78
TIGR00408472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 97.77
KOG1936|consensus518 97.76
TIGR00414418 serS seryl-tRNA synthetase. This model represents 97.74
PRK12325439 prolyl-tRNA synthetase; Provisional 97.71
PRK05431425 seryl-tRNA synthetase; Provisional 97.66
PRK03991613 threonyl-tRNA synthetase; Validated 97.65
KOG2784|consensus483 97.63
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 97.62
PRK12294272 hisZ ATP phosphoribosyltransferase regulatory subu 97.36
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol 97.35
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a 97.29
PLN02837614 threonine-tRNA ligase 97.27
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 97.26
PLN02678448 seryl-tRNA synthetase 97.24
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 97.06
PRK04173456 glycyl-tRNA synthetase; Provisional 97.04
PLN02320502 seryl-tRNA synthetase 96.79
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 96.77
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 96.72
TIGR00470533 sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam 96.69
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod 96.69
TIGR00415520 serS_MJ seryl-tRNA synthetase, Methanococcus janna 96.46
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp 96.43
COG3705390 HisZ ATP phosphoribosyltransferase involved in his 96.3
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds cor 96.28
PF1374299 tRNA_anti_2: OB-fold nucleic acid binding domain 96.27
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal 96.08
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligo 96.01
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, riboso 95.98
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol 95.86
PRK09616552 pheT phenylalanyl-tRNA synthetase subunit beta; Re 95.84
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 95.84
PRK00960517 seryl-tRNA synthetase; Provisional 95.73
PRK07373449 DNA polymerase III subunit alpha; Reviewed 95.61
KOG2324|consensus457 95.52
TIGR00469460 pheS_mito phenylalanyl-tRNA synthetase, mitochondr 95.48
TIGR00389 551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 95.23
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds s 95.23
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds 95.15
PRK068261151 dnaE DNA polymerase III DnaE; Reviewed 94.93
PF10451256 Stn1: Telomere regulation protein Stn1; InterPro: 94.72
PRK09537417 pylS pyrolysyl-tRNA synthetase; Reviewed 94.67
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 94.51
PF04076103 BOF: Bacterial OB fold (BOF) protein; InterPro: IP 94.5
PRK056721046 dnaE2 error-prone DNA polymerase; Validated 94.31
PRK073741170 dnaE DNA polymerase III subunit alpha; Validated 94.14
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 94.09
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 94.07
PRK056731135 dnaE DNA polymerase III subunit alpha; Validated 93.89
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheR 93.04
PRK072791034 dnaE DNA polymerase III DnaE; Reviewed 92.82
PRK14894539 glycyl-tRNA synthetase; Provisional 92.59
TIGR00156126 conserved hypothetical protein TIGR00156. As of th 92.58
COG3111128 Periplasmic protein with OB-fold [Function unknown 92.52
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f 92.29
PRK10053130 hypothetical protein; Provisional 92.23
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.01
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl s 91.9
KOG1035|consensus1351 91.25
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds corresp 91.03
COG1107715 Archaea-specific RecJ-like exonuclease, contains D 90.1
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor 89.72
PRK00286438 xseA exodeoxyribonuclease VII large subunit; Revie 89.54
PF12869144 tRNA_anti-like: tRNA_anti-like; InterPro: IPR02442 88.97
PRK15491374 replication factor A; Provisional 88.76
cd04479101 RPA3 RPA3: A subfamily of OB folds similar to huma 88.38
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 88.33
COG5235258 RFA2 Single-stranded DNA-binding replication prote 88.3
PRK14699484 replication factor A; Provisional 87.59
COG1570440 XseA Exonuclease VII, large subunit [DNA replicati 87.42
COG4085204 Predicted RNA-binding protein, contains TRAM domai 87.1
KOG2509|consensus455 86.89
TIGR00237432 xseA exodeoxyribonuclease VII, large subunit. This 85.6
PRK06461129 single-stranded DNA-binding protein; Reviewed 85.18
cd0449182 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds simil 84.43
TIGR00471551 pheT_arch phenylalanyl-tRNA synthetase, beta subun 84.03
PRK12366637 replication factor A; Reviewed 83.04
PRK07459121 single-stranded DNA-binding protein; Provisional 82.7
PRK04036504 DNA polymerase II small subunit; Validated 80.06
PRK07211485 replication factor A; Reviewed 80.01
>KOG1885|consensus Back     alignment and domain information
Probab=100.00  E-value=8.3e-86  Score=676.92  Aligned_cols=359  Identities=64%  Similarity=1.116  Sum_probs=337.8

Q ss_pred             ccccCChhHHHHHHHHHHHHHHHcCCCCCCCCccccCCHHHHHHHhCCCCcccccCCcEEEEEEEEEeeecCCCceEEEE
Q psy11418         34 YTQQCLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYD  113 (553)
Q Consensus        34 ~~~~~~~~~~~~~R~~kl~~l~~~g~~pyp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~v~Gri~~~R~~g~kl~Fi~  113 (553)
                      .+++.|++++++.|.+.+++|+..|.+|||++|.+++|+.+|.++|.++..+++..+..|+|+|||+++|.+|+||+|+|
T Consensus        48 ~e~~~d~~qy~~~R~r~i~~l~~s~~~Pyphkf~vs~si~~fieky~~l~~ge~~~n~~~svaGRI~s~R~sGsKL~Fyd  127 (560)
T KOG1885|consen   48 SEETSDPEQYFKIRSRAIEELRASGLNPYPHKFHVSISIPDFIEKYLHLATGEHLDNEIVSVAGRIHSKRESGSKLVFYD  127 (560)
T ss_pred             ccccCCHHHHHHHHHHHHHHHhhcCCCCCcchhhccccHHHHHHHhcCcccccccccceeeeeeeEeeeeccCCceEEEE
Confidence            45566999999999999999999999999999999999999999999988888888889999999999999999999999


Q ss_pred             EEeCCEEEEEEEecccCCCHHHHHHHhccCCCCcEEEEEeecccccCCceeEeeeeEEEeccCCCCCCCCCCCCCCcchh
Q psy11418        114 LRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETR  193 (553)
Q Consensus       114 l~d~~~~iQvv~~~~~~~~~~~~~~~~~~l~~gd~V~v~G~~~~t~~ge~~l~~~~i~il~~~~~~lP~~~~~l~~~e~r  193 (553)
                      |++++.+||||++.+...+++.|....+.|++||+|+|.|.+++|++||+||.+.++.+|+||++++|..++||+|.|+|
T Consensus       128 l~~~g~klQvm~~~~~~~~~~~F~~~~~~lkrGDiig~~G~pgrt~~gELSi~~~~~~lLspcLh~lP~~~~gLkD~EtR  207 (560)
T KOG1885|consen  128 LHGDGVKLQVMANAKKITSEEDFEQLHKFLKRGDIIGVSGYPGRTKSGELSIIPNEIILLSPCLHMLPHEHFGLKDKETR  207 (560)
T ss_pred             EecCCeEEEEEEehhhcCCHHHHHHHHhhhhccCEEeeecCCCcCCCceEEEeecchheecchhccCChhhcCCCcHHHH
Confidence            99999999999999886678889999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccchhhhccHHHHHHHHHHHHHHHHHHHHhhhCCeEEEecceeccccCCCCCcceeeccCCCCcceeeeeCHHHHHHH
Q psy11418        194 FRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKM  273 (553)
Q Consensus       194 ~~~R~ldl~~~~~~~~~~~~rs~i~~~ir~fl~~~gF~EV~TPil~~~~gga~a~~F~t~~~~~~~~~~L~~Spql~lk~  273 (553)
                      ||+|||||+.|+.++.+|++|++|+..||.||+++||+||+||||+..+|||+|+||+|+||.+++++|||+|||||||+
T Consensus       208 yrqRylDlilN~~~r~~f~~RakII~~iRkfld~rgFlEVETPmmn~iaGGA~AkPFIT~hndldm~LylRiAPEL~lK~  287 (560)
T KOG1885|consen  208 YRKRYLDLILNPEVRDRFRIRAKIISYIRKFLDSRGFLEVETPMMNMIAGGATAKPFITHHNDLDMDLYLRIAPELYLKM  287 (560)
T ss_pred             HHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHhhhcCceEecchhhccccCccccCceeecccccCcceeeeechHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHccCCcEEEEccccccCCCCCCccCCcceeeeEeccCCHHHHHHHHHHHHhcccccCCCcccccccccccChHHHHHh
Q psy11418        274 LVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEFASD  353 (553)
Q Consensus       274 l~~~g~~rVfei~~~FR~E~~~~~H~~EFt~lE~e~a~~~~~~~m~~~e~li~~~~~~~~~iqv~~n~r~~~~~e~~~~~  353 (553)
                      |+|||++||||||+.|||||+|.+||||||.||+||||+||+|+|+++|+|++.+                         
T Consensus       288 LvVGGldrVYEIGr~FRNEGIDlTHNPEFTTcEfY~AYady~dlm~~TE~l~s~m-------------------------  342 (560)
T KOG1885|consen  288 LVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYEDLMDMTEELLSGM-------------------------  342 (560)
T ss_pred             HHhccHHHHHHHHHHhhhcCcccccCCCcchHHHHHHHhhHHHHHHHHHHHHHHH-------------------------
Confidence            9999999999999999999999999999999999999999999999999999988                         


Q ss_pred             hcccCCccEEEEEcccccCCCCceeEEeeeEEEEeccCCCCCccccCCCChhhhccccceeeecChHHHHHHHHHHHHHH
Q psy11418        354 LVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIA  433 (553)
Q Consensus       354 ~~~L~~gs~V~V~G~v~~~~~g~~El~~~~i~vl~~~~~~~P~~~~~~~~~e~~~~~R~L~lR~~~~~~~~l~~Rs~i~~  433 (553)
                                                                                                      
T Consensus       343 --------------------------------------------------------------------------------  342 (560)
T KOG1885|consen  343 --------------------------------------------------------------------------------  342 (560)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHhCCcEEeeCceeeccCCCcceeeeeecCCCCCcceeEEeChhHHHHHhccCcceEecCCCCCCCCCcccCCCC
Q psy11418        434 YVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKSTHGSYKVTYHPDGPESGSPVEIDFTP  513 (553)
Q Consensus       434 ~iR~f~~~~~F~EV~TPiL~~~~~ga~~~~~~t~~~~~~~~~yL~~Spel~~k~l~~~~~~~~~~e~~~~~~~~~~~~~~  513 (553)
                                                                         .+.+.|+|++.|+|+..... ...++|.+
T Consensus       343 ---------------------------------------------------v~~i~G~~~i~y~p~~~~~~-~~eldf~~  370 (560)
T KOG1885|consen  343 ---------------------------------------------------VKNITGSYKITYHPNGPEEP-ELELDFTR  370 (560)
T ss_pred             ---------------------------------------------------HHhhcCceeEeecCCCCCCC-ceeeeccC
Confidence                                                               24566778888887655422 56789999


Q ss_pred             CceeeeHHHHHHHHhCCCCCCCCCCChHHHHHHHhC
Q psy11418        514 PFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSD  549 (553)
Q Consensus       514 ~f~rit~~eA~~~~~g~~~~~~~~~~~~~~~~~~~~  549 (553)
                      ||+|++|.+.+++.+|++++.++.+++++..+++.+
T Consensus       371 pfrri~mi~~L~k~lgi~l~~~~~l~~~e~~~~L~~  406 (560)
T KOG1885|consen  371 PFRRIEMIEELEKELGIKLPPGSTLHTEETRELLKS  406 (560)
T ss_pred             CeeeeeHHHHHHHHhCCCCCCccccCchhhHHHHHH
Confidence            999999999999999999998777888877666543



>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02221 asparaginyl-tRNA synthetase Back     alignment and domain information
>PTZ00425 asparagine-tRNA ligase; Provisional Back     alignment and domain information
>KOG0556|consensus Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information
>KOG0555|consensus Back     alignment and domain information
>KOG2411|consensus Back     alignment and domain information
>KOG0554|consensus Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1885|consensus Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>PLN02221 asparaginyl-tRNA synthetase Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PTZ00425 asparagine-tRNA ligase; Provisional Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>KOG0556|consensus Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>KOG2411|consensus Back     alignment and domain information
>KOG0554|consensus Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>KOG0555|consensus Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PLN02788 phenylalanine-tRNA synthetase Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>KOG1936|consensus Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG2784|consensus Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02320 seryl-tRNA synthetase Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>KOG2324|consensus Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase, mitochondrial Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PF10451 Stn1: Telomere regulation protein Stn1; InterPro: IPR018856 The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>PF04076 BOF: Bacterial OB fold (BOF) protein; InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif) Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00156 conserved hypothetical protein TIGR00156 Back     alignment and domain information
>COG3111 Periplasmic protein with OB-fold [Function unknown] Back     alignment and domain information
>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>PRK10053 hypothetical protein; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PF12869 tRNA_anti-like: tRNA_anti-like; InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [] Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>cd04479 RPA3 RPA3: A subfamily of OB folds similar to human RPA3 (also called RPA14) Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>COG5235 RFA2 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information
>KOG2509|consensus Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK06461 single-stranded DNA-binding protein; Reviewed Back     alignment and domain information
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK07459 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
4dpg_A513 Crystal Structure Of Human Lysrs: P38/aimp2 Complex 1e-123
4dpg_A 513 Crystal Structure Of Human Lysrs: P38/aimp2 Complex 7e-63
4dpg_A 513 Crystal Structure Of Human Lysrs: P38/aimp2 Complex 6e-15
3bju_A521 Crystal Structure Of Tetrameric Form Of Human Lysyl 1e-123
3bju_A 521 Crystal Structure Of Tetrameric Form Of Human Lysyl 7e-63
3bju_A 521 Crystal Structure Of Tetrameric Form Of Human Lysyl 7e-15
1lyl_A504 Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexe 3e-66
1lyl_A 504 Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexe 4e-38
3e9h_A493 Lysyl-Trna Synthetase From Bacillus Stearothermophi 1e-65
3e9h_A 493 Lysyl-Trna Synthetase From Bacillus Stearothermophi 6e-36
1bbu_A504 Lysyl-Trna Synthetase (Lyss) Complexed With Lysine 4e-63
1bbu_A 504 Lysyl-Trna Synthetase (Lyss) Complexed With Lysine 1e-36
4ex5_A529 Crystal Structure Of Lysyl-Trna Synthetase Lysrs Fr 3e-56
4ex5_A 529 Crystal Structure Of Lysyl-Trna Synthetase Lysrs Fr 1e-32
4ah6_A 617 Human Mitochondrial Aspartyl-Trna Synthetase Length 6e-16
1wyd_A429 Crystal Structure Of Aspartyl-Trna Synthetase From 1e-14
1c0a_A 585 Crystal Structure Of The E. Coli Aspartyl-Trna Synt 3e-14
1c0a_A 585 Crystal Structure Of The E. Coli Aspartyl-Trna Synt 3e-07
3a5y_A345 Crystal Structure Of Genx From Escherichia Coli In 3e-14
1eqr_A 590 Crystal Structure Of Free Aspartyl-Trna Synthetase 3e-14
1eqr_A 590 Crystal Structure Of Free Aspartyl-Trna Synthetase 3e-07
3a5z_A328 Crystal Structure Of Escherichia Coli Genx In Compl 3e-14
3g1z_A326 Structure Of Idp01693YJEA, A POTENTIAL T-Rna Synthe 1e-13
1b8a_A438 Aspartyl-trna Synthetase Length = 438 1e-13
1b8a_A 438 Aspartyl-trna Synthetase Length = 438 2e-04
3nel_A438 Aspartyl-Trna Synthetase Complexed With Aspartic Ac 1e-13
3nel_A 438 Aspartyl-Trna Synthetase Complexed With Aspartic Ac 2e-04
1efw_A580 Crystal Structure Of Aspartyl-Trna Synthetase From 1e-12
1n9w_A422 Crystal Structure Of The Non-Discriminating And Arc 4e-09
1eov_A487 Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.1 2e-08
1asy_A490 Class Ii Aminoacyl Transfer Rna Synthetases: Crysta 2e-08
3i7f_A548 Aspartyl Trna Synthetase From Entamoeba Histolytica 8e-06
>pdb|4DPG|A Chain A, Crystal Structure Of Human Lysrs: P38/aimp2 Complex I Length = 513 Back     alignment and structure

Iteration: 1

Score = 439 bits (1129), Expect = e-123, Method: Compositional matrix adjust. Identities = 201/287 (70%), Positives = 248/287 (86%) Query: 41 SEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVH 100 ++++++RS A+ Q+K G PYPHKF V SL DFI+KYS L L ++TL VAGR+H Sbjct: 6 NQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIH 65 Query: 101 AIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKK 160 A R SG KL+FYDLRGEG+K+QVMAN+R Y+SEEEF K++RGDIIGV G+PGKTKK Sbjct: 66 AKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKK 125 Query: 161 GELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAY 220 GELSIIP ++TLLSPCLHMLPH+HFG+KDKETR+RQRYLDL++N+ +R KFI+R++II Y Sbjct: 126 GELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITY 185 Query: 221 VRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLD 280 +R +LD LGFLE+ETPMMN+I GGA AKPF+T+HN+L+M+LYMRIAPELY KMLVVGG+D Sbjct: 186 IRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID 245 Query: 281 RVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG 327 RVYE+GRQFRNEGIDLTHNPEFTTCEFYMAYADY+DLM +TE ++SG Sbjct: 246 RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSG 292
>pdb|4DPG|A Chain A, Crystal Structure Of Human Lysrs: P38/aimp2 Complex I Length = 513 Back     alignment and structure
>pdb|4DPG|A Chain A, Crystal Structure Of Human Lysrs: P38/aimp2 Complex I Length = 513 Back     alignment and structure
>pdb|3BJU|A Chain A, Crystal Structure Of Tetrameric Form Of Human Lysyl-Trna Synthetase Length = 521 Back     alignment and structure
>pdb|3BJU|A Chain A, Crystal Structure Of Tetrameric Form Of Human Lysyl-Trna Synthetase Length = 521 Back     alignment and structure
>pdb|3BJU|A Chain A, Crystal Structure Of Tetrameric Form Of Human Lysyl-Trna Synthetase Length = 521 Back     alignment and structure
>pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine Length = 504 Back     alignment and structure
>pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine Length = 504 Back     alignment and structure
>pdb|3E9H|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus Complexed With L-Lysylsulfamoyl Adenosine Length = 493 Back     alignment and structure
>pdb|3E9H|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus Complexed With L-Lysylsulfamoyl Adenosine Length = 493 Back     alignment and structure
>pdb|1BBU|A Chain A, Lysyl-Trna Synthetase (Lyss) Complexed With Lysine Length = 504 Back     alignment and structure
>pdb|1BBU|A Chain A, Lysyl-Trna Synthetase (Lyss) Complexed With Lysine Length = 504 Back     alignment and structure
>pdb|4EX5|A Chain A, Crystal Structure Of Lysyl-Trna Synthetase Lysrs From Burkholderia Thailandensis Bound To Lysine Length = 529 Back     alignment and structure
>pdb|4EX5|A Chain A, Crystal Structure Of Lysyl-Trna Synthetase Lysrs From Burkholderia Thailandensis Bound To Lysine Length = 529 Back     alignment and structure
>pdb|4AH6|A Chain A, Human Mitochondrial Aspartyl-Trna Synthetase Length = 617 Back     alignment and structure
>pdb|1WYD|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Sulfolobus Tokodaii Length = 429 Back     alignment and structure
>pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex Length = 585 Back     alignment and structure
>pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex Length = 585 Back     alignment and structure
>pdb|3A5Y|A Chain A, Crystal Structure Of Genx From Escherichia Coli In Complex With Lysyladenylate Analog Length = 345 Back     alignment and structure
>pdb|1EQR|A Chain A, Crystal Structure Of Free Aspartyl-Trna Synthetase From Escherichia Coli Length = 590 Back     alignment and structure
>pdb|1EQR|A Chain A, Crystal Structure Of Free Aspartyl-Trna Synthetase From Escherichia Coli Length = 590 Back     alignment and structure
>pdb|3A5Z|A Chain A, Crystal Structure Of Escherichia Coli Genx In Complex With Elongation Factor P Length = 328 Back     alignment and structure
>pdb|3G1Z|A Chain A, Structure Of Idp01693YJEA, A POTENTIAL T-Rna Synthetase From Salmonella Typhimurium Length = 326 Back     alignment and structure
>pdb|1B8A|A Chain A, Aspartyl-trna Synthetase Length = 438 Back     alignment and structure
>pdb|1B8A|A Chain A, Aspartyl-trna Synthetase Length = 438 Back     alignment and structure
>pdb|3NEL|A Chain A, Aspartyl-Trna Synthetase Complexed With Aspartic Acid Length = 438 Back     alignment and structure
>pdb|3NEL|A Chain A, Aspartyl-Trna Synthetase Complexed With Aspartic Acid Length = 438 Back     alignment and structure
>pdb|1EFW|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Thermus Thermophilus Complexed To Trnaasp From Escherichia Coli Length = 580 Back     alignment and structure
>pdb|1N9W|A Chain A, Crystal Structure Of The Non-Discriminating And Archaeal- Type Aspartyl-Trna Synthetase From Thermus Thermophilus Length = 422 Back     alignment and structure
>pdb|1EOV|A Chain A, Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.12) From Yeast Length = 487 Back     alignment and structure
>pdb|1ASY|A Chain A, Class Ii Aminoacyl Transfer Rna Synthetases: Crystal Structure Of Yeast Aspartyl-Trna Synthetase Complexed With Trna Asp Length = 490 Back     alignment and structure
>pdb|3I7F|A Chain A, Aspartyl Trna Synthetase From Entamoeba Histolytica Length = 548 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 1e-178
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 1e-101
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 1e-130
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 4e-66
4ex5_A529 Lysine--tRNA ligase; structural genomics, niaid, n 1e-128
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 9e-66
1e1o_A504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 1e-128
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 2e-66
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 2e-68
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 2e-29
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 8e-29
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 4e-09
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 1e-28
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 7e-10
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 3e-28
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 7e-10
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 2e-24
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 2e-08
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 2e-20
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 2e-05
1l0w_A580 Aspartyl-tRNA synthetase; space-grown crystal, dim 4e-20
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 3e-11
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 6e-20
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 1e-11
2xgt_A435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 3e-19
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 1e-18
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 7e-16
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 5e-05
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; struc 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 6e-07
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Length = 521 Back     alignment and structure
 Score =  512 bits (1321), Expect = e-178
 Identities = 201/287 (70%), Positives = 248/287 (86%)

Query: 41  SEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVH 100
           ++++++RS A+ Q+K  G  PYPHKF V  SL DFI+KYS L     L ++TL VAGR+H
Sbjct: 6   NQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIH 65

Query: 101 AIRESGTKLMFYDLRGEGLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKK 160
           A R SG KL+FYDLRGEG+K+QVMAN+R Y+SEEEF     K++RGDIIGV G+PGKTKK
Sbjct: 66  AKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKK 125

Query: 161 GELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAY 220
           GELSIIP ++TLLSPCLHMLPH+HFG+KDKETR+RQRYLDL++N+ +R KFI+R++II Y
Sbjct: 126 GELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITY 185

Query: 221 VRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLD 280
           +R +LD LGFLE+ETPMMN+I GGA AKPF+T+HN+L+M+LYMRIAPELY KMLVVGG+D
Sbjct: 186 IRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID 245

Query: 281 RVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISG 327
           RVYE+GRQFRNEGIDLTHNPEFTTCEFYMAYADY+DLM +TE ++SG
Sbjct: 246 RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSG 292


>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Length = 521 Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Length = 493 Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Length = 493 Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Length = 529 Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Length = 529 Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Length = 504 Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Length = 504 Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Length = 345 Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Length = 345 Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Length = 429 Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Length = 429 Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Length = 422 Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Length = 422 Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Length = 580 Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Length = 580 Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585 Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585 Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Length = 435 Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Length = 456 Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Length = 294 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 100.0
4ex5_A529 Lysine--tRNA ligase; structural genomics, niaid, n 100.0
1e1o_A504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 100.0
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 100.0
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 100.0
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 100.0
1l0w_A580 Aspartyl-tRNA synthetase; space-grown crystal, dim 100.0
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 100.0
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 100.0
2xgt_A435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 100.0
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 100.0
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 100.0
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 100.0
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 100.0
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 100.0
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 100.0
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 100.0
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 99.98
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.98
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 99.97
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 99.97
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 99.97
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 99.97
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 99.97
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 99.97
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; struc 99.97
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 99.97
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 99.96
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 99.96
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 99.96
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 99.96
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 99.95
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 99.85
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 99.79
1nnh_A 294 Asparaginyl-tRNA synthetase-related peptide; struc 99.58
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterote 99.2
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enz 99.07
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 98.99
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 98.93
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; 98.67
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; 98.58
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 98.52
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 98.49
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 98.49
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 98.48
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, 98.48
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 98.48
3rac_A373 Histidine-tRNA ligase; structural genomics, PSI-bi 98.46
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 98.45
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 98.4
3pco_A327 Phenylalanyl-tRNA synthetase, alpha subunit; amino 98.36
4g85_A517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 98.35
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 98.35
4g84_A464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 98.32
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 98.22
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 98.21
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 98.21
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.19
3a32_A471 Probable threonyl-tRNA synthetase 1; aeropyrum per 98.17
1nj8_A459 Proline-tRNA synthetase, proline--tRNA ligase; cla 98.16
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 98.16
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 98.15
3uh0_A460 Threonyl-tRNA synthetase, mitochondrial; threonine 98.06
1nj1_A501 PROR, proline-tRNA synthetase, proline--tRNA ligas 98.0
4hvc_A519 Bifunctional glutamate/proline--tRNA ligase; ligas 97.98
3ial_A518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 97.98
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 97.98
1ses_A421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 97.95
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 97.91
12as_A330 Asparagine synthetase; ligase, nitrogen fixation; 97.9
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; 97.89
3vbb_A522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 97.78
3qne_A485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 97.71
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 97.69
3err_A536 Fusion protein of microtubule binding domain from 97.68
1ati_A 505 Glycyl-tRNA synthetase; protein biosynthesis, liga 97.61
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 97.57
2du3_A534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 97.37
2du7_A549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 97.29
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; class 97.24
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.22
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.2
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.19
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.17
2k50_A115 Replication factor A related protein; uncharacteri 97.03
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 96.96
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl- 96.81
1g5h_A454 Mitochondrial DNA polymerase accessory subunit; in 96.63
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-bi 96.46
3ikl_A459 DNA polymerase subunit gamma-2, mitochondrial; tra 96.42
4gop_B136 Putative uncharacterized protein; OB fold, ssDNA b 96.27
3dm3_A105 Replication factor A; probably plays AN essential 96.11
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM c 96.02
3e0e_A97 Replication protein A; structural genomics, PSI-2, 95.98
2rhq_B795 Phenylalanyl-tRNA synthetase beta chain; heterotet 95.92
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacyl 95.88
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, MC 95.49
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692. 95.45
1nnx_A109 Protein YGIW; structural genomics, hypothetical pr 95.17
3au7_A402 TIAS, putative uncharacterized protein; ATP hydrol 94.73
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 93.22
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nu 91.99
1b7y_B785 Phers, protein (phenylalanyl-tRNA synthetase); enz 91.48
1ynx_A114 Replication factor-A protein 1; canonical OB fold, 91.29
2kbn_A109 Conserved protein; nucleic acid binding protein, b 90.85
2k75_A106 Uncharacterized protein TA0387; closed beta barrel 90.7
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 89.39
3kf8_A220 Protein STN1; OB fold; 2.40A {Candida tropicalis m 89.22
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 89.09
3kdf_A121 Replication protein A 14 kDa subunit; wheat GERM c 86.2
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 83.18
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RA 81.77
3pco_B795 Phenylalanyl-tRNA synthetase, beta chain; aminoacy 81.15
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 80.73
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.2e-76  Score=647.88  Aligned_cols=292  Identities=69%  Similarity=1.179  Sum_probs=273.7

Q ss_pred             CChhHHHHHHHHHHHHHHHcCCCCCCCCccccCCHHHHHHHhCCCCcccccCCcEEEEEEEEEeeecCCCceEEEEEEeC
Q psy11418         38 CLTSEFFRLRSAAVEQMKEQGPHPYPHKFTVTSSLEDFIEKYSDLPDAQVLENVTLSVAGRVHAIRESGTKLMFYDLRGE  117 (553)
Q Consensus        38 ~~~~~~~~~R~~kl~~l~~~g~~pyp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~v~Gri~~~R~~g~kl~Fi~l~d~  117 (553)
                      .+++++.+.|++|+++|++.|++|||++|.+++++++++++|.++..++...+++|+|+|||+++|.+|+|++|++|+|+
T Consensus         3 ~~~~~~~~~r~~k~~~l~~~g~~pyp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~v~Grv~~~R~~gkk~~F~~LrD~   82 (521)
T 3bju_A            3 VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGE   82 (521)
T ss_dssp             CCHHHHHHHHHHHHHHHHHTTCCSSCSCCCCCSCHHHHHHHHTTCCTTCBCSSCCEEEEEEEEEEEESSSSEEEEEEEET
T ss_pred             CCHHHHHHHHHHHHHHHHHcCCCCCCCcCcCccchHHHHHHhhhhccccccCCcEEEEEEEEEEEecCCCCcEEEEEEEC
Confidence            46788999999999999999999999999999999999999998877666678889999999999999988999999999


Q ss_pred             CEEEEEEEecccCCCHHHHHHHhccCCCCcEEEEEeecccccCCceeEeeeeEEEeccCCCCCCCCCCCCCCcchhhccc
Q psy11418        118 GLKIQVMANARMYQSEEEFASDLVKIKRGDIIGVTGSPGKTKKGELSIIPKKLTLLSPCLHMLPHMHFGVKDKETRFRQR  197 (553)
Q Consensus       118 ~~~iQvv~~~~~~~~~~~~~~~~~~l~~gd~V~v~G~~~~t~~ge~~l~~~~i~il~~~~~~lP~~~~~l~~~e~r~~~R  197 (553)
                      ++.||||++++...+++.|..+.+.|++||+|+|+|++.++++|++||.|++|++|++|+.|+|.+++++.++++|+++|
T Consensus        83 sg~iQvv~~~~~~~~~~~~~~~~~~l~~gd~V~V~G~v~~t~~ge~ei~~~~i~~l~~~~~~lP~~~~~~~~~e~r~r~R  162 (521)
T 3bju_A           83 GVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQR  162 (521)
T ss_dssp             TEEEEEEEEGGGSSCHHHHHHHHHHCCTTCEEEEEEEEEECTTCCEEEEEEEEEEEECCCSCCCCC----CCHHHHHHCH
T ss_pred             CEEEEEEEECCccCCHHHHHHHHhcCCCCCEEEEEEEEEecCCCCEEEEEeEEEEeecCCCCCCCccccccChhhhhhhh
Confidence            99999999887542455675556789999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhccHHHHHHHHHHHHHHHHHHHHhhhCCeEEEecceeccccCCCCCcceeeccCCCCcceeeeeCHHHHHHHHHHc
Q psy11418        198 YLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVG  277 (553)
Q Consensus       198 ~ldl~~~~~~~~~~~~rs~i~~~ir~fl~~~gF~EV~TPil~~~~gga~a~~F~t~~~~~~~~~~L~~Spql~lk~l~~~  277 (553)
                      |||||+|+.++++|++||+|++++|+||.++||+||+||+|++++|||+|+||.|++|+||+++||+||||||||+|+++
T Consensus       163 yLdLr~~~~~~~~~r~Rs~i~~~iR~f~~~~gF~EVeTPiL~~~~gGa~a~~F~t~~~~~~~~~yL~~SpqL~lk~liv~  242 (521)
T 3bju_A          163 YLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVG  242 (521)
T ss_dssp             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHTTCEECCCCSEESSCCSSSCCCCEEEETTTTEEEEECSCSHHHHHHHHHT
T ss_pred             hhhHhcCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEeCceeeccCCCccccceeeecccCCcceEeeCCHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcEEEEccccccCCCCCCccCCcceeeeEeccCCHHHHHHHHHHHHhccc
Q psy11418        278 GLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRK  329 (553)
Q Consensus       278 g~~rVfei~~~FR~E~~~~~H~~EFt~lE~e~a~~~~~~~m~~~e~li~~~~  329 (553)
                      |++||||||||||||+++++|||||||||+|+||+|++|+|+++|+||++++
T Consensus       243 g~~rVyeig~~FR~E~~~trH~pEFtmlE~e~af~d~~dlm~l~E~li~~v~  294 (521)
T 3bju_A          243 GIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMV  294 (521)
T ss_dssp             TCCEEEEEEEEECCSCCBTTBCSEEEEEEEEEETCCHHHHHHHHHHHHHHHH
T ss_pred             CcCceEEEEcceeCCCCCCccchhhhhhhhhhhcCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999994



>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>12as_A Asparagine synthetase; ligase, nitrogen fixation; HET: AMP; 2.20A {Escherichia coli K12} SCOP: d.104.1.1 PDB: 11as_A* Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.09A {Bacteroides fragilis} Back     alignment and structure
>3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, phenylalanyl-tRNA SYNT beta subunit, structural genomics, PSI-2; HET: TAM; 2.44A {Porphyromonas gingivalis} Back     alignment and structure
>1nnx_A Protein YGIW; structural genomics, hypothetical protein, OB-fold, structure 2 function project, S2F, unknown function; 1.45A {Escherichia coli} SCOP: b.40.10.1 Back     alignment and structure
>3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold, transferase; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 3teh_B* 2iy5_B* Back     alignment and structure
>1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Back     alignment and structure
>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>3kf8_A Protein STN1; OB fold; 2.40A {Candida tropicalis mya-3404} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>3kdf_A Replication protein A 14 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 1quq_B 1l1o_A Back     alignment and structure
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 553
d1c0aa3346 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synt 2e-40
d1c0aa3 346 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synt 5e-25
d1l0wa3356 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synt 5e-36
d1l0wa3 356 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synt 1e-21
d1e1oa2342 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS 6e-36
d1e1oa2 342 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS 4e-26
d1n9wa2304 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (As 2e-26
d1n9wa2 304 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (As 6e-18
d1nnha_293 d.104.1.1 (A:) Hypothetical protein PF1951 {Archae 2e-26
d1nnha_ 293 d.104.1.1 (A:) Hypothetical protein PF1951 {Archae 6e-15
d1eova2353 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (As 5e-26
d1eova2 353 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (As 8e-17
d1e1oa1143 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) 6e-26
d1e1oa1143 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) 1e-10
d1b8aa2335 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (As 7e-25
d1b8aa2 335 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (As 9e-18
d1eova1134 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspR 4e-12
d1n9wa193 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) 2e-10
d1b8aa1103 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS 3e-07
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Aspartyl-tRNA synthetase (AspRS)
species: Escherichia coli [TaxId: 562]
 Score =  147 bits (373), Expect = 2e-40
 Identities = 44/172 (25%), Positives = 78/172 (45%), Gaps = 1/172 (0%)

Query: 179 MLPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMM 238
           +LP     V  +E R + RYLDL     +  +   RA+I + VRR++D  GFL++ETPM+
Sbjct: 1   VLPLDSNHVNTEEARLKYRYLDLR-RPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML 59

Query: 239 NMIAGGATAKPFVTHHNDLNMDLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTH 298
                       V           +  +P+L+ ++L++ G DR Y++ + FR+E +    
Sbjct: 60  TKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADR 119

Query: 299 NPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPCVMANARMYQSEEEF 350
            PEFT  +   ++     +  + E L+     +     +     M  +E E 
Sbjct: 120 QPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAER 171


>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 356 Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 356 Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 304 Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 304 Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 293 Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 293 Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 353 Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 353 Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Length = 143 Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Length = 143 Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 335 Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 335 Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
d1c0aa3346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 100.0
d1e1oa2342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 100.0
d1eova2353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 100.0
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 100.0
d1b8aa2335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 100.0
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 100.0
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 99.98
d1n9wa2304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.97
d1e1oa2 342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 99.87
d1l0wa3 356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.86
d1b8aa2 335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 99.86
d1c0aa3 346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 99.85
d1eova2 353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 99.84
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 99.75
d1n9wa2 304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.73
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.72
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 99.72
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 99.7
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.68
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 99.67
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 98.52
d1z7ma1318 ATP phosphoribosyltransferase regulatory subunit H 98.5
d1qe0a2325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 98.28
d1wu7a2327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 98.19
d1nyra4291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 98.18
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS 98.16
d1h4vb2324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 98.1
d1kmma2322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 98.01
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 97.92
d1qf6a4291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 97.84
d1nj8a3268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 97.83
d1hc7a2272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 97.76
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 97.72
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 97.68
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 97.57
d1usya_275 ATP phosphoribosyltransferase regulatory subunit H 97.5
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 97.49
d1b76a2331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 97.38
d1nj1a3265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 97.35
d1seta2311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 96.83
d1nnxa_106 Hypothetical protein YgiW {Escherichia coli [TaxId 95.64
d2pi2a1128 Replication protein A 32 KDa subunit (RPA32) fragm 95.3
d1o7ia_115 Archaeal ssDNA-binding protein {Archaeon Sulfolobu 95.14
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Huma 94.39
d1gm5a2180 RecG "wedge" domain {Thermotoga maritima [TaxId: 2 89.07
d1jjcb5207 Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, 88.82
d2pi2e1115 Replication protein A 14 KDa (RPA14) subunit {Huma 88.31
d1v1qa_111 Primosomal replication protein N, PriB {Escherichi 86.02
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 84.91
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Aspartyl-tRNA synthetase (AspRS)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=9.3e-40  Score=339.25  Aligned_cols=156  Identities=26%  Similarity=0.459  Sum_probs=143.9

Q ss_pred             CCCCCCCCCCcchhhcccchhhhccHHHHHHHHHHHHHHHHHHHHhhhCCeEEEecceeccccCCCCCcceeeccCCCCc
Q psy11418        180 LPHMHFGVKDKETRFRQRYLDLMINERIRHKFIVRAQIIAYVRRYLDSLGFLEVETPMMNMIAGGATAKPFVTHHNDLNM  259 (553)
Q Consensus       180 lP~~~~~l~~~e~r~~~R~ldl~~~~~~~~~~~~rs~i~~~ir~fl~~~gF~EV~TPil~~~~gga~a~~F~t~~~~~~~  259 (553)
                      ||.+++++++.|+|+++|||||| |+..+++|++||+|++++|+||.++||+||+||+|+++++++++..|....++++.
T Consensus         2 lP~~~~~~~~~e~Rl~~R~LdLr-~~~~~~ilr~Rs~i~~~iR~ff~~~gFlEV~TPiL~~~~~~g~~~~~~~~~~~~~~   80 (346)
T d1c0aa3           2 LPLDSNHVNTEEARLKYRYLDLR-RPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGK   80 (346)
T ss_dssp             CSSCTTSCCCHHHHHHTHHHHTT-SHHHHHHHHHHHHHHHHHHHHHHHTTCEECCCCSSBCCCSSSSCCCEEECSSSTTC
T ss_pred             CCCCCCCCCCHHHHhhchHHhhC-CHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCccCCCCCccccccccccccCCCc
Confidence            67777888899999999999995 99999999999999999999999999999999999877766666777777778899


Q ss_pred             ceeeeeCHHHHHHHHHHccCCcEEEEccccccCCCCCCccCCcceeeeEeccCCHHHHHHHHHHHHhcccccCCCcc
Q psy11418        260 DLYMRIAPELYLKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMHLTEDLISGRKEDRNRPC  336 (553)
Q Consensus       260 ~~~L~~Spql~lk~l~~~g~~rVfei~~~FR~E~~~~~H~~EFt~lE~e~a~~~~~~~m~~~e~li~~~~~~~~~iq  336 (553)
                      .+||++|||||+|+|+++|++|||+||||||||+++++|+|||||||||++|+|++++|+++|+|++++++.+..++
T Consensus        81 ~~~L~~Spel~lk~ll~~g~~~Vf~i~~~FR~E~~~~~H~~EFtmLE~e~a~~~~~~~m~~~E~li~~l~~~~~~~~  157 (346)
T d1c0aa3          81 FYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVD  157 (346)
T ss_dssp             EEECCSCSHHHHHHHHHTTCCEEEEEEEEECCCCCBTTBCSEEEEEEEEEESCCHHHHHHHHHHHHHHHHHHHHSCC
T ss_pred             cccCCcCHHHHHHHHhhcCCCceEEEeeeccccccCchhhhHhhhhccccccccHhHhHHHHHHHHHHHHHHHhCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999987655433



>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pi2e1 b.40.4.3 (E:3-117) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure