Psyllid ID: psy11439

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKREL
ccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHc
ccccEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHc
menkevdgmDILAVREAARFAVNHcrsdkgpilletatyrysghsmsdpgtsyrtrdEIQEVrqtrdpissLKDKILNASLVTPEELKREL
menkevdgmdILAVREAARFAVnhcrsdkgpillETATyrysghsmsdpgtsyrtrDEIQEVrqtrdpisslkdkilnaslvtpeelkrel
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKREL
*********DILAVREAARFAVNHCRSDKGPILLETATYRY**************************************************
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKREL
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVT********
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSM*DPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEEL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKREL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
P52899397 Probable pyruvate dehydro yes N/A 0.912 0.209 0.710 8e-31
P26267396 Pyruvate dehydrogenase E1 N/A N/A 0.912 0.209 0.686 6e-30
P29803388 Pyruvate dehydrogenase E1 yes N/A 0.923 0.216 0.690 6e-30
P26268391 Pyruvate dehydrogenase E1 N/A N/A 0.912 0.212 0.686 3e-29
Q5R490390 Pyruvate dehydrogenase E1 yes N/A 0.912 0.212 0.698 7e-29
P08559390 Pyruvate dehydrogenase E1 no N/A 0.912 0.212 0.698 7e-29
P29804389 Pyruvate dehydrogenase E1 yes N/A 0.912 0.213 0.698 7e-29
Q8HXW9390 Pyruvate dehydrogenase E1 N/A N/A 0.912 0.212 0.698 7e-29
P26284390 Pyruvate dehydrogenase E1 yes N/A 0.912 0.212 0.686 2e-28
A7MB35390 Pyruvate dehydrogenase E1 yes N/A 0.912 0.212 0.686 2e-28
>sp|P52899|ODPA_CAEEL Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=T05H10.6 PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (85%)

Query: 6   VDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQT 65
           VDGMDILAVREA ++A  +C S KGP+++E ATYRY GHSMSDPGTSYRTR+EIQEVR+T
Sbjct: 248 VDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKT 307

Query: 66  RDPISSLKDKILNASLVTPEELK 88
           RDPI+  KD+I+ +SL T EELK
Sbjct: 308 RDPITGFKDRIITSSLATEEELK 330
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 1
>sp|P26267|ODPA_ASCSU Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial OS=Ascaris suum PE=1 SV=1 Back     alignment and function description
>sp|P29803|ODPAT_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens GN=PDHA2 PE=1 SV=1 Back     alignment and function description
>sp|P26268|ODPT_ASCSU Pyruvate dehydrogenase E1 component subunit alpha type II, mitochondrial (Fragment) OS=Ascaris suum PE=2 SV=1 Back     alignment and function description
>sp|Q5R490|ODPA_PONAB Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Pongo abelii GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|P08559|ODPA_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens GN=PDHA1 PE=1 SV=3 Back     alignment and function description
>sp|P29804|ODPA_PIG Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (Fragment) OS=Sus scrofa GN=PDHA1 PE=1 SV=1 Back     alignment and function description
>sp|Q8HXW9|ODPA_MACFA Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Macaca fascicularis GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|P26284|ODPA_RAT Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Rattus norvegicus GN=Pdha1 PE=1 SV=2 Back     alignment and function description
>sp|A7MB35|ODPA_BOVIN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Bos taurus GN=PDHA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
91078982 397 PREDICTED: similar to pyruvate dehydroge 0.912 0.209 0.819 6e-35
328725071 341 PREDICTED: probable pyruvate dehydrogena 0.923 0.246 0.785 2e-33
312381015 369 hypothetical protein AND_06771 [Anophele 0.912 0.224 0.807 4e-33
380029415 402 PREDICTED: probable pyruvate dehydrogena 0.912 0.206 0.759 4e-33
170036247 398 pyruvate dehydrogenase [Culex quinquefas 0.912 0.208 0.807 5e-33
322780442 379 hypothetical protein SINV_11234 [Solenop 0.912 0.218 0.759 6e-33
328793432 387 PREDICTED: probable pyruvate dehydrogena 0.912 0.214 0.746 7e-33
442759763 396 Putative pyruvate dehydrogenase e1 alpha 0.923 0.212 0.773 8e-33
157107633 371 pyruvate dehydrogenase [Aedes aegypti] g 0.912 0.223 0.795 8e-33
242004222 393 pyruvate dehydrogenase, putative [Ixodes 0.945 0.218 0.755 9e-33
>gi|91078982|ref|XP_974523.1| PREDICTED: similar to pyruvate dehydrogenase [Tribolium castaneum] gi|270003684|gb|EFA00132.1| hypothetical protein TcasGA2_TC002948 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 68/83 (81%), Positives = 78/83 (93%)

Query: 6   VDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQT 65
           +DGMD+LAVREAA+FAV+HC S KGPILLE ATYRYSGHSMSDPGTSYRTR+EIQEVRQT
Sbjct: 253 IDGMDVLAVREAAKFAVDHCTSGKGPILLEAATYRYSGHSMSDPGTSYRTREEIQEVRQT 312

Query: 66  RDPISSLKDKILNASLVTPEELK 88
           RDPI+S K+KI+ A+LV+PEELK
Sbjct: 313 RDPITSFKEKIITANLVSPEELK 335

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328725071|ref|XP_001949530.2| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312381015|gb|EFR26866.1| hypothetical protein AND_06771 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|380029415|ref|XP_003698369.1| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|170036247|ref|XP_001845976.1| pyruvate dehydrogenase [Culex quinquefasciatus] gi|167878853|gb|EDS42236.1| pyruvate dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|322780442|gb|EFZ09930.1| hypothetical protein SINV_11234 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328793432|ref|XP_623502.3| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|442759763|gb|JAA72040.1| Putative pyruvate dehydrogenase e1 alpha subunit [Ixodes ricinus] Back     alignment and taxonomy information
>gi|157107633|ref|XP_001649868.1| pyruvate dehydrogenase [Aedes aegypti] gi|108868670|gb|EAT32895.1| AAEL014865-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|242004222|ref|XP_002436278.1| pyruvate dehydrogenase, putative [Ixodes scapularis] gi|215499614|gb|EEC09108.1| pyruvate dehydrogenase, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
WB|WBGene00011510414 pdha-1 [Caenorhabditis elegans 0.912 0.200 0.710 2.4e-28
UNIPROTKB|P29803388 PDHA2 "Pyruvate dehydrogenase 0.923 0.216 0.690 8.2e-28
ZFIN|ZDB-GENE-040426-2719393 pdha1a "pyruvate dehydrogenase 0.912 0.211 0.686 4.5e-27
UNIPROTKB|E2RL90390 PDHA1 "Pyruvate dehydrogenase 0.912 0.212 0.698 7.3e-27
UNIPROTKB|P08559390 PDHA1 "Pyruvate dehydrogenase 0.912 0.212 0.698 7.3e-27
UNIPROTKB|I3LCI2390 PDHA1 "Pyruvate dehydrogenase 0.912 0.212 0.698 7.3e-27
UNIPROTKB|K7GMN8359 PDHA1 "Pyruvate dehydrogenase 0.912 0.231 0.698 7.3e-27
UNIPROTKB|P29804389 PDHA1 "Pyruvate dehydrogenase 0.912 0.213 0.698 7.3e-27
UNIPROTKB|Q5R490390 PDHA1 "Pyruvate dehydrogenase 0.912 0.212 0.698 7.3e-27
UNIPROTKB|Q8HXW9390 PDHA1 "Pyruvate dehydrogenase 0.912 0.212 0.698 7.3e-27
WB|WBGene00011510 pdha-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
 Identities = 59/83 (71%), Positives = 71/83 (85%)

Query:     6 VDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQT 65
             VDGMDILAVREA ++A  +C S KGP+++E ATYRY GHSMSDPGTSYRTR+EIQEVR+T
Sbjct:   265 VDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKT 324

Query:    66 RDPISSLKDKILNASLVTPEELK 88
             RDPI+  KD+I+ +SL T EELK
Sbjct:   325 RDPITGFKDRIITSSLATEEELK 347
GO:0008152 "metabolic process" evidence=IEA
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
GO:0004739 "pyruvate dehydrogenase (acetyl-transferring) activity" evidence=IEA
GO:0006096 "glycolysis" evidence=IEA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0016477 "cell migration" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
UNIPROTKB|P29803 PDHA2 "Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2719 pdha1a "pyruvate dehydrogenase (lipoamide) alpha 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RL90 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P08559 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCI2 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GMN8 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P29804 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R490 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXW9 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6Z5N4ODPA1_ORYSJ1, ., 2, ., 4, ., 10.59520.91200.2128yesN/A
P52899ODPA_CAEEL1, ., 2, ., 4, ., 10.71080.91200.2090yesN/A
P29803ODPAT_HUMAN1, ., 2, ., 4, ., 10.69040.92300.2164yesN/A
P29804ODPA_PIG1, ., 2, ., 4, ., 10.69870.91200.2133yesN/A
P35486ODPA_MOUSE1, ., 2, ., 4, ., 10.68670.91200.2128yesN/A
Q54C70ODPA_DICDI1, ., 2, ., 4, ., 10.55420.91200.2201yesN/A
O13366ODPA_KLULA1, ., 2, ., 4, ., 10.57140.92300.2038yesN/A
P52901ODPA1_ARATH1, ., 2, ., 4, ., 10.59520.91200.2133yesN/A
P16387ODPA_YEAST1, ., 2, ., 4, ., 10.57140.92300.2yesN/A
A7MB35ODPA_BOVIN1, ., 2, ., 4, ., 10.68670.91200.2128yesN/A
Q5R490ODPA_PONAB1, ., 2, ., 4, ., 10.69870.91200.2128yesN/A
Q9R9N5ODPA_RHIME1, ., 2, ., 4, ., 10.54110.92300.2413yesN/A
Q10489ODPA_SCHPO1, ., 2, ., 4, ., 10.51800.91200.2029yesN/A
P26284ODPA_RAT1, ., 2, ., 4, ., 10.68670.91200.2128yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 8e-40
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 2e-38
PLN02269362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp 2e-37
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph 4e-35
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena 4e-32
CHL00149341 CHL00149, odpA, pyruvate dehydrogenase E1 componen 2e-22
TIGR03181341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E 2e-20
PLN02374433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl 1e-18
>gnl|CDD|201386 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information 
 Score =  132 bits (335), Expect = 8e-40
 Identities = 44/84 (52%), Positives = 60/84 (71%)

Query: 5   EVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQ 64
            VDGMD LAV +A +FA    R+  GP L+E  TYRY GHSMSD  ++YRTR+E++EVR+
Sbjct: 194 RVDGMDPLAVYQAVKFAAERARTGNGPTLIELVTYRYGGHSMSDDPSTYRTREEVEEVRK 253

Query: 65  TRDPISSLKDKILNASLVTPEELK 88
            +DPI  LK  +++  +V+ EELK
Sbjct: 254 KKDPIKRLKKHLVSRGVVSEEELK 277

This family uses thiamine pyrophosphate as a cofactor. This family includes pyruvate dehydrogenase, 2-oxoglutarate dehydrogenase and 2-oxoisovalerate dehydrogenase. Length = 303
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>gnl|CDD|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>gnl|CDD|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 99.98
KOG0225|consensus394 99.97
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 99.97
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 99.96
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 99.95
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 99.95
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 99.95
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 99.95
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 99.94
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 99.94
KOG1182|consensus432 99.93
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.84
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 99.83
KOG0450|consensus 1017 99.58
KOG0451|consensus 913 99.54
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 99.52
PTZ00089 661 transketolase; Provisional 98.23
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.09
PRK05899 624 transketolase; Reviewed 97.96
PRK12754 663 transketolase; Reviewed 97.74
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 97.67
PRK12753 663 transketolase; Reviewed 97.45
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 97.31
PLN02790 654 transketolase 97.22
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 97.01
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 96.47
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 96.31
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 96.2
PRK05261 785 putative phosphoketolase; Provisional 95.13
COG0021 663 TktA Transketolase [Carbohydrate transport and met 95.06
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 95.03
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 94.95
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 94.49
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 93.99
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 93.64
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 93.13
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 93.09
PRK07524535 hypothetical protein; Provisional 92.93
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 92.36
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 91.89
PRK08327569 acetolactate synthase catalytic subunit; Validated 91.84
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 91.6
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 91.5
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 91.44
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 91.37
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 91.36
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 89.54
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 89.5
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 88.23
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 87.07
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 86.48
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 86.03
PRK06163202 hypothetical protein; Provisional 85.89
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 85.03
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 84.49
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 84.23
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 84.19
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 83.93
PRK08266542 hypothetical protein; Provisional 83.65
PF0985131 SHOCT: Short C-terminal domain; InterPro: IPR01864 83.48
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 83.13
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 82.9
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 82.17
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 82.04
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 81.48
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 80.43
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 80.1
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-35  Score=218.22  Aligned_cols=89  Identities=44%  Similarity=0.750  Sum_probs=86.0

Q ss_pred             CceEEeeCCCHHHHHHHHHHHHHHHHccCCCEEEEEeeecCCCCCCCCCCCCCCCHHHHHHHHhCCChHHHHHHHHHHcC
Q psy11439          1 MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNAS   80 (91)
Q Consensus         1 i~~~~vDG~D~~~v~~a~~~a~~~~R~~~gP~lie~~tyR~~gHs~~D~~~~Yr~~~e~~~~~~~~DPi~~~~~~L~~~g   80 (91)
                      ||+++|||||+++||+++++|++++|+|+||+|||+.|||++|||++|++..|||++|+++|+ ++|||.+|+++|++.|
T Consensus       223 ipgv~VDG~D~~avy~~~~~A~e~AR~g~GPtLIE~~tYR~~~HS~sDd~~~YRskeE~~~~~-~~DPi~r~~~~L~~~g  301 (358)
T COG1071         223 IPGVRVDGNDVLAVYEAAKEAVERARAGEGPTLIEAVTYRYGGHSTSDDPSKYRSKEEVEEWK-KRDPIVRLRKYLIEAG  301 (358)
T ss_pred             CCeEEECCcCHHHHHHHHHHHHHHHHcCCCCEEEEEEEeecCCCCCCCCccccCCHHHHHHHh-ccChHHHHHHHHHHcC
Confidence            799999999999999999999999999999999999999999999999977899999999998 5999999999999999


Q ss_pred             CCCHHHHhhh
Q psy11439         81 LVTPEELKRE   90 (91)
Q Consensus        81 ~~~~~e~~~~   90 (91)
                      ++|+++++++
T Consensus       302 ~~see~~~~i  311 (358)
T COG1071         302 ILSEEELEAI  311 (358)
T ss_pred             CCCHHHHHHH
Confidence            9999998875

>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>KOG1182|consensus Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>KOG0450|consensus Back     alignment and domain information
>KOG0451|consensus Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PF09851 SHOCT: Short C-terminal domain; InterPro: IPR018649 This family of hypothetical prokaryotic proteins has no known function Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 7e-30
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 7e-30
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 1e-29
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 2e-29
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 4e-29
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 2e-27
1dtw_A400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 3e-08
1um9_A367 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 5e-08
2bff_A400 Reactivity Modulation Of Human Branched-Chain Alpha 5e-08
2j9f_A400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 7e-08
1x7y_A400 Crystal Structure Of The Human Mitochondrial Branch 7e-08
2bfe_A400 Reactivity Modulation Of Human Branched-Chain Alpha 8e-08
1x7w_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-07
1x80_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-07
1x7x_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-07
1x7z_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-07
2bp7_A410 New Crystal Form Of The Pseudomonas Putida Branched 1e-07
1qs0_A407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 1e-07
1w88_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 3e-07
1w85_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1 4e-07
3duf_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 4e-07
3dva_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 4e-07
1olu_A400 Roles Of His291-Alpha And His146-Beta' In The Reduc 5e-07
2bfd_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-06
2bfc_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-06
1v16_A400 Crosstalk Between Cofactor Binding And The Phosphor 1e-06
2bfb_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-06
1v11_A400 Crosstalk Between Cofactor Binding And The Phosphor 3e-06
1v1m_A400 Crosstalk Between Cofactor Binding And The Phosphor 1e-05
>pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (314), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 67/83 (80%)
Query: 6   VDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQT 65
           VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY GHSMSDPG SYRTR+EIQEVR  
Sbjct: 246 VDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSK 305
Query: 66  RDPISSLKDKILNASLVTPEELK 88
            DPI  LKD+++N++L + EELK
Sbjct: 306 SDPIMLLKDRMVNSNLASVEELK 328
>pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure
>pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1UM9|A Chain A, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 367 Back     alignment and structure
>pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure
>pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BP7|A Chain A, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 410 Back     alignment and structure
>pdb|1QS0|A Chain A, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 407 Back     alignment and structure
>pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|3DVA|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1V1M|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 1e-46
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 2e-27
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 6e-25
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 6e-25
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 2e-24
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Length = 365 Back     alignment and structure
 Score =  151 bits (384), Expect = 1e-46
 Identities = 57/88 (64%), Positives = 67/88 (76%)

Query: 1   MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQ 60
           +    VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY GH MSDPG SYRTR+EIQ
Sbjct: 224 IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPGVSYRTREEIQ 283

Query: 61  EVRQTRDPISSLKDKILNASLVTPEELK 88
           EVR   DPI  LKD+++N++L + EELK
Sbjct: 284 EVRSKSDPIMLLKDRMVNSNLASVEELK 311
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Length = 368 Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 99.96
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 99.95
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 99.94
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 99.93
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 99.93
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 99.92
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.92
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 99.89
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 99.19
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 98.93
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 98.8
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 98.78
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 98.53
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 98.29
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 98.18
3uk1_A 711 Transketolase; structural genomics, seattle struct 98.04
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 98.0
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 97.97
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 97.87
3l84_A 632 Transketolase; TKT, structural genomics, center fo 97.85
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 97.56
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 97.55
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 97.31
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 95.1
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 94.34
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 92.2
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 89.68
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 89.01
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 88.31
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 87.95
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 87.94
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 87.9
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 87.5
2kl8_A85 OR15; structural genomics, PSI-2, protein structur 86.83
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 86.4
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 86.28
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 86.18
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 86.11
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 85.54
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 84.58
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 83.5
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 83.35
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 83.23
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 80.58
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 80.44
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
Probab=99.96  E-value=1.1e-28  Score=182.76  Aligned_cols=90  Identities=63%  Similarity=0.995  Sum_probs=85.3

Q ss_pred             CceEEeeCCCHHHHHHHHHHHHHHHHccCCCEEEEEeeecCCCCCCCCCCCCCCCHHHHHHHHhCCChHHHHHHHHHHcC
Q psy11439          1 MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNAS   80 (91)
Q Consensus         1 i~~~~vDG~D~~~v~~a~~~a~~~~R~~~gP~lie~~tyR~~gHs~~D~~~~Yr~~~e~~~~~~~~DPi~~~~~~L~~~g   80 (91)
                      +|+++|||+|+++|+.+++.|++++|+++||+|||+.|||++|||++|++..||+++|++.|++.+|||.+|+++|+++|
T Consensus       224 ~p~~~VdG~D~~av~~a~~~A~~~~r~~~gP~lIe~~t~R~~gHs~~D~~~~Yr~~~e~~~~~~~~dpi~~~~~~L~~~g  303 (365)
T 2ozl_A          224 IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSN  303 (365)
T ss_dssp             SCEEEEETTCHHHHHHHHHHHHHHHHTTCCCEEEEEECCCSSCSSTTCCSCSSSCHHHHHHHHHHHCHHHHHHHHHHHTT
T ss_pred             CCEEEEeCCCHHHHHHHHHHHHHHHHhCCCCEEEEEEeecCCCCCCCCCCcccCCHHHHHHHHhCCCHHHHHHHHHHhcC
Confidence            68999999999999999999999999999999999999999999999987679999999999855799999999999999


Q ss_pred             CCCHHHHhhh
Q psy11439         81 LVTPEELKRE   90 (91)
Q Consensus        81 ~~~~~e~~~~   90 (91)
                      ++|+++++++
T Consensus       304 ~~~~~~~~~i  313 (365)
T 2ozl_A          304 LASVEELKEI  313 (365)
T ss_dssp             SSCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            9999998764
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2kl8_A OR15; structural genomics, PSI-2, protein structure initiative, de novo protein, ferrodoxin fold; NMR {Artificial gene} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d2ozla1361 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate de 8e-16
d1qs0a_407 c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B 3e-14
d2bfda1395 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid 2e-13
d1w85a_365 c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, Pd 7e-12
d1umda_362 c.36.1.11 (A:) Branched-chain alpha-keto acid dehy 4e-11
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: E1-beta subunit of pyruvate dehydrogenase (PP module)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.4 bits (166), Expect = 8e-16
 Identities = 57/88 (64%), Positives = 67/88 (76%)

Query: 1   MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQ 60
           +    VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY GH MSDPG SYRTR+EIQ
Sbjct: 220 IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPGVSYRTREEIQ 279

Query: 61  EVRQTRDPISSLKDKILNASLVTPEELK 88
           EVR   DPI  LKD+++N++L + EELK
Sbjct: 280 EVRSKSDPIMLLKDRMVNSNLASVEELK 307
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Length = 407 Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Length = 395 Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Length = 365 Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 99.97
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 99.97
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 99.97
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 99.97
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 99.96
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 97.27
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 94.28
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 93.23
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 92.97
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 92.85
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 88.62
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 85.14
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 84.86
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 84.59
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 84.55
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 84.13
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 81.55
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 80.58
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 80.16
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: 2-oxoisovalerate dehydrogenase (E1B), PP module
species: Pseudomonas putida [TaxId: 303]

Probab=99.97  E-value=5.3e-32  Score=201.40  Aligned_cols=89  Identities=35%  Similarity=0.521  Sum_probs=85.2

Q ss_pred             CceEEeeCCCHHHHHHHHHHHHHHHHccCCCEEEEEeeecCCCCCCCCCCCCCCCHHHHHHHHhCCChHHHHHHHHHHcC
Q psy11439          1 MENKEVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNAS   80 (91)
Q Consensus         1 i~~~~vDG~D~~~v~~a~~~a~~~~R~~~gP~lie~~tyR~~gHs~~D~~~~Yr~~~e~~~~~~~~DPi~~~~~~L~~~g   80 (91)
                      ||+++|||||+++||+++++|++++|+|+||+|||+.|||++|||++|++..||+++|++.|+ ++|||.+|+++|++.|
T Consensus       268 i~~~~VDGnD~~avy~a~~~A~e~aR~g~gP~lIE~~TyR~~gHs~sDD~~~YR~~~E~~~w~-~~DPI~rl~~~Li~~g  346 (407)
T d1qs0a_         268 IASLRVDGNDFVAVYAASRWAAERARRGLGPSLIEWVTYRAGPHSTSDDPSKYRPADDWSHFP-LGDPIARLKQHLIKIG  346 (407)
T ss_dssp             CEEEEEETTCHHHHHHHHHHHHHHHHTTSCCEEEEEECCCCSCSSTTCCGGGTSCTTHHHHCT-TCCHHHHHHHHHHHTT
T ss_pred             cceEEeccccHHHHHHHHHHHHHHHhcCCCceEEEEeeecCCCCCccccccccCCHHHHHHHH-hCCHHHHHHHHHHHCC
Confidence            789999999999999999999999999999999999999999999998888899999999998 6999999999999999


Q ss_pred             CCCHHHHhhh
Q psy11439         81 LVTPEELKRE   90 (91)
Q Consensus        81 ~~~~~e~~~~   90 (91)
                      ++|+++++++
T Consensus       347 ~~se~e~~~i  356 (407)
T d1qs0a_         347 HWSEEEHQAT  356 (407)
T ss_dssp             SCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            9999988764
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure