Psyllid ID: psy11490


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MAEEKVSDNSGPASSGDHGPEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
ccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccccEEEcccccccccccccc
ccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccEcccccccccHHHHccccHHHHHHHccccccccccccEEEcHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEc
maeekvsdnsgpassgdhgpefkskpiCLIVlgmagsgktSFVKKFSSylydkqdnpyvinldpacrdvpylvnvdpacrdvpylvNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVqanfikmgpnptlpplvqvi
maeekvsdnsgpassgdhgpefKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIkmgpnptlpplvqvi
MAEEKVSDNSGPASSGDHGPEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
*************************PICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKM*************
***************************CLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
********************EFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
*********************FKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEKVSDNSGPASSGDHGPEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVDPACRDVPYLVNVGELSMLLLNGNKLEHQILNFQKLATWMAFGFAFMRSSCVQANFIKMGPNPTLPPLVQVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
Q8VCE2 372 GPN-loop GTPase 1 OS=Mus yes N/A 0.346 0.137 0.588 1e-12
A4FUD1 373 GPN-loop GTPase 1 OS=Bos yes N/A 0.462 0.182 0.493 2e-12
Q9HCN4 374 GPN-loop GTPase 1 OS=Homo yes N/A 0.374 0.147 0.543 2e-12
P46577 355 GPN-loop GTPase 1 homolog yes N/A 0.510 0.211 0.506 2e-12
O42906 367 GTPase npa3 OS=Schizosacc yes N/A 0.367 0.147 0.5 2e-11
Q54C25 396 GPN-loop GTPase 1 homolog yes N/A 0.380 0.141 0.482 2e-09
P47122 385 GTPase NPA3 OS=Saccharomy yes N/A 0.333 0.127 0.530 1e-08
>sp|Q8VCE2|GPN1_MOUSE GPN-loop GTPase 1 OS=Mus musculus GN=Gpn1 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 42/51 (82%)

Query: 26 PICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVD 76
          P+CL+VLGMAGSGKT+FV++ + +L++K   PYVINLDPA  +VP+  N+D
Sbjct: 19 PVCLLVLGMAGSGKTTFVQRLTGHLHNKGCPPYVINLDPAVHEVPFPANID 69




Forms an interface between the RNA polymerase II enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. May be involved in nuclear localization of XPA.
Mus musculus (taxid: 10090)
>sp|A4FUD1|GPN1_BOVIN GPN-loop GTPase 1 OS=Bos taurus GN=GPN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCN4|GPN1_HUMAN GPN-loop GTPase 1 OS=Homo sapiens GN=GPN1 PE=1 SV=1 Back     alignment and function description
>sp|P46577|GPN1_CAEEL GPN-loop GTPase 1 homolog OS=Caenorhabditis elegans GN=gop-2 PE=1 SV=1 Back     alignment and function description
>sp|O42906|NPA3_SCHPO GTPase npa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npa3 PE=1 SV=1 Back     alignment and function description
>sp|Q54C25|GPN1_DICDI GPN-loop GTPase 1 homolog OS=Dictyostelium discoideum GN=xab1 PE=3 SV=1 Back     alignment and function description
>sp|P47122|NPA3_YEAST GTPase NPA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPA3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
157125085 372 xpa-binding protein 1 (mbdin) [Aedes aeg 0.442 0.174 0.561 1e-15
156544215 378 PREDICTED: GPN-loop GTPase 1-like [Nason 0.523 0.203 0.546 1e-14
170032652 376 XPA-binding protein 1 [Culex quinquefasc 0.414 0.162 0.6 1e-14
321459363 376 hypothetical protein DAPPUDRAFT_217322 [ 0.380 0.148 0.660 2e-14
427779305 391 Putative gtpase xab1 interacts with dna 0.510 0.191 0.460 8e-14
308321220 398 gpn-loop GTPase 1 [Ictalurus furcatus] 0.414 0.153 0.535 1e-13
328781508 388 PREDICTED: GPN-loop GTPase 1-like [Apis 0.360 0.136 0.666 2e-13
391330930 370 PREDICTED: GPN-loop GTPase 1-like [Metas 0.503 0.2 0.5 4e-13
350409915 391 PREDICTED: GPN-loop GTPase 1-like [Bombu 0.469 0.176 0.520 5e-13
340718521 391 PREDICTED: GPN-loop GTPase 1-like isofor 0.360 0.135 0.648 5e-13
>gi|157125085|ref|XP_001660613.1| xpa-binding protein 1 (mbdin) [Aedes aegypti] gi|108873772|gb|EAT37997.1| AAEL010077-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (73%), Gaps = 8/73 (10%)

Query: 4  EKVSDNSGPASSGDHGPEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLD 63
          +K+  + GP+S         +KPICLIVLGMAGSGKT+FV+K + Y +D+  NPY+INLD
Sbjct: 6  QKMDTDDGPSSQA-------TKPICLIVLGMAGSGKTTFVRKLAQYKHDEH-NPYLINLD 57

Query: 64 PACRDVPYLVNVD 76
          PACR+VPY  N+D
Sbjct: 58 PACREVPYPANID 70




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156544215|ref|XP_001606701.1| PREDICTED: GPN-loop GTPase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170032652|ref|XP_001844194.1| XPA-binding protein 1 [Culex quinquefasciatus] gi|167873024|gb|EDS36407.1| XPA-binding protein 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|321459363|gb|EFX70417.1| hypothetical protein DAPPUDRAFT_217322 [Daphnia pulex] Back     alignment and taxonomy information
>gi|427779305|gb|JAA55104.1| Putative gtpase xab1 interacts with dna repair protein xpa [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|308321220|gb|ADO27762.1| gpn-loop GTPase 1 [Ictalurus furcatus] Back     alignment and taxonomy information
>gi|328781508|ref|XP_001121554.2| PREDICTED: GPN-loop GTPase 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|391330930|ref|XP_003739904.1| PREDICTED: GPN-loop GTPase 1-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|350409915|ref|XP_003488886.1| PREDICTED: GPN-loop GTPase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718521|ref|XP_003397714.1| PREDICTED: GPN-loop GTPase 1-like isoform 1 [Bombus terrestris] gi|340718523|ref|XP_003397715.1| PREDICTED: GPN-loop GTPase 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
ZFIN|ZDB-GENE-040801-154 400 zgc:100927 "zgc:100927" [Danio 0.421 0.155 0.578 1.8e-15
WB|WBGene00001661 355 gop-2 [Caenorhabditis elegans 0.612 0.253 0.474 2.1e-13
UNIPROTKB|P46577 355 gop-2 "GPN-loop GTPase 1 homol 0.612 0.253 0.474 2.1e-13
FB|FBgn0040346 382 CG3704 [Drosophila melanogaste 0.360 0.138 0.574 4.3e-13
RGD|1589985 373 Gpn1 "GPN-loop GTPase 1" [Ratt 0.408 0.160 0.538 5.2e-13
MGI|MGI:1921504 372 Gpn1 "GPN-loop GTPase 1" [Mus 0.346 0.137 0.588 1.8e-12
UNIPROTKB|A4FUD1 373 GPN1 "GPN-loop GTPase 1" [Bos 0.435 0.171 0.507 2.4e-12
UNIPROTKB|F1SEE2 384 GPN1 "Uncharacterized protein" 0.408 0.156 0.523 2.5e-12
UNIPROTKB|E2RNQ3 390 LOC475707 "Uncharacterized pro 0.346 0.130 0.549 3.4e-12
UNIPROTKB|B4DQM4 388 GPN1 "cDNA FLJ61157, highly si 0.489 0.185 0.447 4.3e-12
ZFIN|ZDB-GENE-040801-154 zgc:100927 "zgc:100927" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 1.8e-15, P = 1.8e-15
 Identities = 37/64 (57%), Positives = 50/64 (78%)

Query:    13 ASSGDHGPEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYL 72
             +SS +H  E   KP+CLIVLGMAGSGKT+FV++ ++YL+ K+  PYVINLDPA  +VP+ 
Sbjct:    33 SSSNEHSTE--PKPVCLIVLGMAGSGKTTFVQRLTAYLHSKKTPPYVINLDPAVHEVPFP 90

Query:    73 VNVD 76
              N+D
Sbjct:    91 ANID 94




GO:0000166 "nucleotide binding" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
WB|WBGene00001661 gop-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P46577 gop-2 "GPN-loop GTPase 1 homolog" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0040346 CG3704 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1589985 Gpn1 "GPN-loop GTPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1921504 Gpn1 "GPN-loop GTPase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUD1 GPN1 "GPN-loop GTPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SEE2 GPN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNQ3 LOC475707 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQM4 GPN1 "cDNA FLJ61157, highly similar to XPA-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46577GPN1_CAEELNo assigned EC number0.50610.51020.2112yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
pfam03029 235 pfam03029, ATP_bind_1, Conserved hypothetical ATP 2e-13
PRK13768 253 PRK13768, PRK13768, GTPase; Provisional 4e-11
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 4e-08
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 0.003
>gnl|CDD|217326 pfam03029, ATP_bind_1, Conserved hypothetical ATP binding protein Back     alignment and domain information
 Score = 64.7 bits (158), Expect = 2e-13
 Identities = 22/46 (47%), Positives = 30/46 (65%)

Query: 31 VLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVD 76
          V+G AGSGKT+FV   S  L     + YV+NLDPA  ++PY  ++D
Sbjct: 1  VVGPAGSGKTTFVGALSEILPLLGRSVYVVNLDPAAENLPYEADID 46


Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity. Length = 235

>gnl|CDD|237498 PRK13768, PRK13768, GTPase; Provisional Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.81
PTZ00301210 uridine kinase; Provisional 99.74
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.63
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.61
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.61
KOG1532|consensus 366 99.58
PLN02348 395 phosphoribulokinase 99.57
PRK05439311 pantothenate kinase; Provisional 99.57
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.54
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.5
PRK05480209 uridine/cytidine kinase; Provisional 99.49
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.47
PRK15453 290 phosphoribulokinase; Provisional 99.46
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.44
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.42
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.41
PLN02796347 D-glycerate 3-kinase 99.4
PLN02318 656 phosphoribulokinase/uridine kinase 99.39
PLN03046460 D-glycerate 3-kinase; Provisional 99.38
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.32
PRK07667193 uridine kinase; Provisional 99.31
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 99.31
PRK06696223 uridine kinase; Validated 99.28
KOG1534|consensus 273 99.24
KOG1533|consensus 290 99.19
PRK07429 327 phosphoribulokinase; Provisional 99.19
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.17
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.14
PRK04040188 adenylate kinase; Provisional 99.1
KOG4203|consensus 473 98.93
PRK06547172 hypothetical protein; Provisional 98.73
PRK13768 253 GTPase; Provisional 98.68
KOG3308|consensus 225 98.65
COG4240 300 Predicted kinase [General function prediction only 98.62
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 98.6
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.55
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 98.51
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.47
PRK09435 332 membrane ATPase/protein kinase; Provisional 98.47
PRK08233182 hypothetical protein; Provisional 98.41
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.37
PRK10416318 signal recognition particle-docking protein FtsY; 98.37
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.35
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.34
PRK00889175 adenylylsulfate kinase; Provisional 98.34
PRK06762166 hypothetical protein; Provisional 98.33
TIGR00064272 ftsY signal recognition particle-docking protein F 98.31
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 98.31
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.3
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 98.29
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.29
PRK05541176 adenylylsulfate kinase; Provisional 98.29
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 98.28
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.28
PRK03846198 adenylylsulfate kinase; Provisional 98.24
cd03115173 SRP The signal recognition particle (SRP) mediates 98.21
PRK14974336 cell division protein FtsY; Provisional 98.2
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.18
smart00382148 AAA ATPases associated with a variety of cellular 98.17
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.17
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.16
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.15
PRK10867 433 signal recognition particle protein; Provisional 98.14
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 98.14
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.14
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 98.13
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.11
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.1
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.09
cd03114148 ArgK-like The function of this protein family is u 98.09
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.08
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.08
cd03116159 MobB Molybdenum is an essential trace element in t 98.08
PRK06217183 hypothetical protein; Validated 98.06
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.06
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.06
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.05
PRK08118167 topology modulation protein; Reviewed 98.05
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.04
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.04
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.04
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.04
PRK00771 437 signal recognition particle protein Srp54; Provisi 98.04
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.03
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.03
TIGR00959 428 ffh signal recognition particle protein. This mode 98.03
PRK07261171 topology modulation protein; Provisional 98.03
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.03
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.02
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.02
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.02
PRK14493 274 putative bifunctional molybdopterin-guanine dinucl 98.02
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.02
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.02
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 98.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.01
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.01
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.01
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 98.01
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.01
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.01
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.01
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.99
PRK14527191 adenylate kinase; Provisional 97.99
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.99
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.99
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 97.98
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 97.98
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.98
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.98
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.98
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.98
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.98
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.97
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.97
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 97.97
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.97
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.97
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.97
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.96
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.96
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.96
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.96
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.95
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.95
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.95
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.95
cd03246173 ABCC_Protease_Secretion This family represents the 97.95
KOG2702|consensus323 97.95
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.95
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.95
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.94
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.94
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.94
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 97.94
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.94
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.94
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.94
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.93
COG1127 263 Ttg2A ABC-type transport system involved in resist 97.93
PLN02200234 adenylate kinase family protein 97.93
PRK10908222 cell division protein FtsE; Provisional 97.93
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.93
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.92
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.92
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.92
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.92
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.92
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.92
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.92
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.91
PRK00698205 tmk thymidylate kinase; Validated 97.91
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.91
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.91
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.91
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.91
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.91
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.91
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.91
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.9
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.9
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.9
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.9
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 97.9
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.9
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.89
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.89
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 97.89
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.89
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 97.89
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.89
PRK00300205 gmk guanylate kinase; Provisional 97.89
cd03234226 ABCG_White The White subfamily represents ABC tran 97.88
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.88
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.88
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.88
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.88
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.88
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.88
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.88
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 97.88
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 97.88
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.88
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.88
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.88
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.87
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.87
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.87
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.87
PHA02530 300 pseT polynucleotide kinase; Provisional 97.87
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.87
PRK00131175 aroK shikimate kinase; Reviewed 97.87
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.87
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.86
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.86
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.86
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.86
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.86
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 97.86
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.86
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.85
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 97.85
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.85
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 97.85
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.85
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.85
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 97.85
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.85
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.84
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.84
PRK03839180 putative kinase; Provisional 97.84
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 97.84
PRK14495 452 putative molybdopterin-guanine dinucleotide biosyn 97.83
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 97.83
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.83
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.83
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.83
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.83
cd02034116 CooC The accessory protein CooC, which contains a 97.83
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 97.83
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.83
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.83
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.83
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.83
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 97.83
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.83
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.83
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.82
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.82
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.82
KOG2878|consensus282 97.81
PRK14491 597 putative bifunctional molybdopterin-guanine dinucl 97.81
COG1341 398 Predicted GTPase or GTP-binding protein [General f 97.81
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.81
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.81
PRK13537 306 nodulation ABC transporter NodI; Provisional 97.81
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 97.81
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.81
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 97.81
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 97.81
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.8
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 97.8
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.8
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.8
COG4619223 ABC-type uncharacterized transport system, ATPase 97.8
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.79
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.79
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.79
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.78
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.78
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.78
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 97.78
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.78
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 97.78
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 97.78
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.77
PRK14738206 gmk guanylate kinase; Provisional 97.77
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.77
COG4559 259 ABC-type hemin transport system, ATPase component 97.77
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 97.77
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 97.77
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.76
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 97.76
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.76
cd02040 270 NifH NifH gene encodes component II (iron protein) 97.76
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.76
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.76
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK14242253 phosphate transporter ATP-binding protein; Provisi 97.75
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 97.75
COG1123 539 ATPase components of various ABC-type transport sy 97.75
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.75
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK14494 229 putative molybdopterin-guanine dinucleotide biosyn 97.75
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 97.75
PTZ00088 229 adenylate kinase 1; Provisional 97.75
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.75
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.74
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.74
PRK14530215 adenylate kinase; Provisional 97.74
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 97.74
PRK13536 340 nodulation factor exporter subunit NodI; Provision 97.74
cd01394218 radB RadB. The archaeal protein radB shares simila 97.74
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 97.74
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.74
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.74
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.73
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.73
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.73
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 97.73
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 97.73
COG3638 258 ABC-type phosphate/phosphonate transport system, A 97.73
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.73
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.73
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.73
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 97.73
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.73
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 97.73
cd02117212 NifH_like This family contains the NifH (iron prot 97.72
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.72
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.72
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 97.72
PLN02840 421 tRNA dimethylallyltransferase 97.72
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.72
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 97.72
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 97.72
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.72
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.72
TIGR01287 275 nifH nitrogenase iron protein. This model describe 97.72
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 97.71
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.71
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 97.71
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 97.71
PRK14238271 phosphate transporter ATP-binding protein; Provisi 97.71
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 97.71
PRK14737186 gmk guanylate kinase; Provisional 97.71
PRK13230 279 nitrogenase reductase-like protein; Reviewed 97.7
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 97.7
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.7
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.7
PRK13185 270 chlL protochlorophyllide reductase iron-sulfur ATP 97.7
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 97.7
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.69
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.69
PRK09825176 idnK D-gluconate kinase; Provisional 97.69
PRK06761 282 hypothetical protein; Provisional 97.69
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 97.69
COG4586 325 ABC-type uncharacterized transport system, ATPase 97.68
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 97.68
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 97.67
cd02032 267 Bchl_like This family of proteins contains bchL an 97.67
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 97.67
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 97.67
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.67
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.67
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 97.66
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 97.66
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 97.66
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 97.66
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.65
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.65
PRK09580248 sufC cysteine desulfurase ATPase component; Review 97.65
PRK10938 490 putative molybdenum transport ATP-binding protein 97.65
PF00004132 AAA: ATPase family associated with various cellula 97.65
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.65
PRK04220301 2-phosphoglycerate kinase; Provisional 97.65
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.64
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.64
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.64
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.64
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 97.64
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.64
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 97.64
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.64
PRK00081194 coaE dephospho-CoA kinase; Reviewed 97.64
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.63
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.63
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.63
PRK14237267 phosphate transporter ATP-binding protein; Provisi 97.63
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.63
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 97.63
PRK14531183 adenylate kinase; Provisional 97.63
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.63
PLN02748 468 tRNA dimethylallyltransferase 97.63
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.62
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 97.62
PRK04296190 thymidine kinase; Provisional 97.62
PF13173128 AAA_14: AAA domain 97.62
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 97.62
COG4181228 Predicted ABC-type transport system involved in ly 97.62
PRK09700510 D-allose transporter ATP-binding protein; Provisio 97.62
PRK14240250 phosphate transporter ATP-binding protein; Provisi 97.62
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 97.61
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 97.61
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.61
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 97.61
PRK05057172 aroK shikimate kinase I; Reviewed 97.61
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.61
PF1324576 AAA_19: Part of AAA domain 97.61
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.61
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 97.61
PRK09984 262 phosphonate/organophosphate ester transporter subu 97.61
PLN02165 334 adenylate isopentenyltransferase 97.6
PRK03695 248 vitamin B12-transporter ATPase; Provisional 97.6
KOG2749|consensus 415 97.6
PF1355562 AAA_29: P-loop containing region of AAA domain 97.6
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.6
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 97.6
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.6
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 97.6
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 97.59
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.59
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.59
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 97.59
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.59
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.58
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.58
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 97.58
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.58
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.58
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.57
PRK14236272 phosphate transporter ATP-binding protein; Provisi 97.57
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.57
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 97.57
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 97.57
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.57
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.56
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 97.56
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 97.56
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.56
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 97.56
TIGR01281 268 DPOR_bchL light-independent protochlorophyllide re 97.56
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 97.56
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.56
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.56
PRK08356195 hypothetical protein; Provisional 97.56
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.56
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 97.56
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 97.55
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.55
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 97.55
PF05729166 NACHT: NACHT domain 97.55
PRK13973213 thymidylate kinase; Provisional 97.55
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.54
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.54
COG4598 256 HisP ABC-type histidine transport system, ATPase c 97.54
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 97.54
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.54
PRK14532188 adenylate kinase; Provisional 97.54
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.54
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.54
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.54
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.53
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.53
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.53
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.52
KOG0635|consensus207 97.52
PRK13949169 shikimate kinase; Provisional 97.52
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.52
PRK12339197 2-phosphoglycerate kinase; Provisional 97.52
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 97.52
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 97.52
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 97.52
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.51
PRK13409 590 putative ATPase RIL; Provisional 97.51
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 97.51
PLN02924220 thymidylate kinase 97.51
PRK15064530 ABC transporter ATP-binding protein; Provisional 97.51
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.51
PRK13975196 thymidylate kinase; Provisional 97.51
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.51
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.51
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.51
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.5
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 97.5
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 97.5
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 97.5
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 97.5
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.49
PRK04182180 cytidylate kinase; Provisional 97.49
PRK12338 319 hypothetical protein; Provisional 97.49
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.49
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.49
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.48
PRK11147 635 ABC transporter ATPase component; Reviewed 97.48
PRK13231 264 nitrogenase reductase-like protein; Reviewed 97.48
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.48
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.48
PRK00279215 adk adenylate kinase; Reviewed 97.48
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.48
PRK09183259 transposase/IS protein; Provisional 97.48
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.47
PRK07933213 thymidylate kinase; Validated 97.47
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.47
PRK08084235 DNA replication initiation factor; Provisional 97.47
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 97.47
PRK13235 274 nifH nitrogenase reductase; Reviewed 97.46
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.46
cd02033 329 BchX Chlorophyllide reductase converts chlorophyll 97.46
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.46
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.46
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.46
COG0410237 LivF ABC-type branched-chain amino acid transport 97.46
PRK02496184 adk adenylate kinase; Provisional 97.46
COG4525 259 TauB ABC-type taurine transport system, ATPase com 97.46
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.46
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 97.46
PRK11147 635 ABC transporter ATPase component; Reviewed 97.45
PRK13232 273 nifH nitrogenase reductase; Reviewed 97.45
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 97.45
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 97.45
PRK13947171 shikimate kinase; Provisional 97.45
PRK14239252 phosphate transporter ATP-binding protein; Provisi 97.45
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.45
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
Probab=99.81  E-value=6.1e-20  Score=146.47  Aligned_cols=99  Identities=22%  Similarity=0.233  Sum_probs=84.0

Q ss_pred             CCCEEEEEEcCCCCcHHHHHHHHHHhhhcCCCCceeecCCCCCCCCCcccC--CCCcccccCCCCChH---HHHHHHhCC
Q psy11490         24 SKPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVN--VDPACRDVPYLVNVG---ELSMLLLNG   98 (147)
Q Consensus        24 ~~~~~I~I~G~SGSGKTTl~~~L~~~l~~~g~~v~vv~lD~~~~~l~~~~~--~d~~n~d~p~a~d~~---~~l~~L~~g   98 (147)
                      .++.+|||+|+|||||||+|+.|...+...  .+.++++|+||++....+.  .+..|||||+|||++   +++..|++|
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~l~~~~~~~--~~~~I~~D~YYk~~~~~~~~~~~~~n~d~p~A~D~dLl~~~L~~L~~g   83 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKELSEQLGVE--KVVVISLDDYYKDQSHLPFEERNKINYDHPEAFDLDLLIEHLKDLKQG   83 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHHHHHHhCcC--cceEeeccccccchhhcCHhhcCCcCccChhhhcHHHHHHHHHHHHcC
Confidence            456899999999999999999999999865  6999999999997433221  347899999999988   899999999


Q ss_pred             CeeeEeccchhhhhhh------hcceeEEeec
Q psy11490         99 NKLEHQILNFQKLATW------MAFGFAFMRS  124 (147)
Q Consensus        99 ~~i~~p~ydf~~~~~~------~~~g~iive~  124 (147)
                      +.|..|+|||.+..+.      .+..+||+|+
T Consensus        84 ~~v~~P~yd~~~~~r~~~~i~~~p~~VVIvEG  115 (218)
T COG0572          84 KPVDLPVYDYKTHTREPETIKVEPNDVVIVEG  115 (218)
T ss_pred             CcccccccchhcccccCCccccCCCcEEEEec
Confidence            9999999999866543      3467999998



>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG1534|consensus Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>KOG4203|consensus Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG3308|consensus Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG2702|consensus Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>KOG2878|consensus Back     alignment and domain information
>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>KOG2749|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>KOG0635|consensus Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1yr6_A 262 Pab0955 Crystal Structure : A Gtpase In Apo Form Fr 6e-04
>pdb|1YR6|A Chain A, Pab0955 Crystal Structure : A Gtpase In Apo Form From Pyrococcus Abyssi Length = 262 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query: 27 ICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVD 76 + ++ +G AGSGKT+ +F YL D YV NLD +++PY ++D Sbjct: 15 MIVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYV-NLDTGVKELPYEPSID 63

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 1e-04
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Back     alignment and structure
 Score = 62.8 bits (152), Expect = 7e-13
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 25 KPICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVD 76
            + ++ +G AGSGKT+   +F  YL D       +NLD   +++PY  ++D
Sbjct: 13 ASMIVVFVGTAGSGKTTLTGEFGRYLEDNY-KVAYVNLDTGVKELPYEPSID 63


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 99.47
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.34
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.22
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.13
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.11
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.07
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.06
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.01
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.92
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 98.85
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.82
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.49
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.49
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.42
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.4
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.4
1xjc_A169 MOBB protein homolog; structural genomics, midwest 98.39
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.37
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.34
2og2_A359 Putative signal recognition particle receptor; nuc 98.33
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.33
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.31
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.3
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.29
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 98.28
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.27
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.26
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.26
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.25
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.25
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 98.24
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.23
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.21
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.2
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.2
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.17
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.16
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.16
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.16
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.15
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.15
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.14
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.12
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.12
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.12
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.12
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.11
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.11
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.11
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.1
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.1
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.1
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.1
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.1
2eyu_A 261 Twitching motility protein PILT; pilus retraction 98.09
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.08
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.08
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.08
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.08
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 98.07
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 98.07
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 98.07
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.06
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.06
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.06
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.06
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.05
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.05
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.05
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.04
2xxa_A 433 Signal recognition particle protein; protein trans 98.04
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.04
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 98.03
1b0u_A 262 Histidine permease; ABC transporter, transport pro 98.03
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.03
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.02
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 98.02
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.02
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 98.02
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.01
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.01
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.0
1g6h_A 257 High-affinity branched-chain amino acid transport 98.0
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.99
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.99
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.99
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.99
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.99
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.98
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 97.98
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.98
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.97
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.97
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.97
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.97
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.97
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.96
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.96
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.96
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.96
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.96
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.95
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.94
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.94
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.94
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.94
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.94
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.93
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.92
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.92
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.91
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.91
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.91
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 97.91
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.9
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.9
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.9
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.9
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.89
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 97.89
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.89
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.89
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.89
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.88
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.88
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.88
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.87
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.87
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.87
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.87
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 97.87
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.86
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.86
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.86
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 97.86
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.86
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.85
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.85
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.85
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.84
2ghi_A260 Transport protein; multidrug resistance protein, M 97.84
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.84
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 97.84
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 97.83
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.82
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.82
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 97.82
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.82
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 97.81
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.81
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.81
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.8
3bos_A242 Putative DNA replication factor; P-loop containing 97.8
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.8
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.79
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.79
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.79
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.79
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.79
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.78
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 97.78
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.78
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.78
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.78
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.77
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 97.77
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.77
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.76
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.75
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.75
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 97.74
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.74
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.74
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.74
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.74
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.74
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.74
3end_A 307 Light-independent protochlorophyllide reductase ir 97.73
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 97.73
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 97.73
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.72
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.7
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 97.7
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.7
3fwy_A 314 Light-independent protochlorophyllide reductase I 97.69
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.69
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 97.69
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 97.69
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.69
1via_A175 Shikimate kinase; structural genomics, transferase 97.68
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.67
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.66
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.65
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.64
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.64
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 97.61
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.6
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 97.59
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.59
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.58
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.58
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.58
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.58
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.57
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.56
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.55
1cp2_A 269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 97.55
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.54
1wcv_1 257 SOJ, segregation protein; ATPase, bacterial, chrom 97.54
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 97.53
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.53
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.53
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.53
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.52
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.52
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.51
3kjh_A 254 CO dehydrogenase/acetyl-COA synthase complex, acce 97.51
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.51
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.5
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.5
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.5
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.5
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.49
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.49
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.49
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 97.49
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.48
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.48
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.47
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.47
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.47
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.46
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 97.46
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.46
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.45
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.43
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.43
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.43
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.43
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.42
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 97.42
3kta_A182 Chromosome segregation protein SMC; structural mai 97.42
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.41
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.41
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 97.4
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.4
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.4
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.39
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 97.38
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.38
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.38
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.37
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.37
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.37
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.36
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.36
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.36
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.35
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.33
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.33
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.33
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 97.33
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 97.32
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.32
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 97.32
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.31
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 97.31
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.31
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.31
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.3
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 97.3
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.3
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.3
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.29
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.29
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.29
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.29
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 97.28
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.28
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.27
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.26
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.26
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 97.26
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.26
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.26
3q9l_A 260 Septum site-determining protein MIND; ATPase, bact 97.25
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.25
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.24
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.24
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.23
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.23
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.23
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.22
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.22
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.21
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.21
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.21
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.21
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.21
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.2
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.2
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.19
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 97.19
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 97.19
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.18
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.18
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.18
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.18
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 97.18
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 97.17
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.17
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.17
2qgz_A308 Helicase loader, putative primosome component; str 97.17
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.17
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.16
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 97.16
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.15
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.15
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 97.14
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.14
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.13
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 97.13
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.13
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.13
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 97.12
2z43_A324 DNA repair and recombination protein RADA; archaea 97.11
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.11
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.11
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.11
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 97.1
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.1
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.09
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.08
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.08
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.08
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 97.08
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 97.08
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.08
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.08
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.07
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 97.07
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.07
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.07
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.07
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.06
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.05
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.05
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.05
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.05
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 97.04
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.03
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.03
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.03
2ged_A193 SR-beta, signal recognition particle receptor beta 97.03
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.03
1g3q_A 237 MIND ATPase, cell division inhibitor; alpha-beta-a 97.02
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.02
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.02
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.02
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.02
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 97.02
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.01
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.01
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.01
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.01
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.0
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 97.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.99
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.98
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.98
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.98
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.98
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 96.98
1hyq_A 263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 96.97
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.97
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.97
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.96
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.96
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.96
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 96.96
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.95
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.95
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.95
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.95
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 96.94
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.94
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.93
3cwq_A209 Para family chromosome partitioning protein; alpha 96.93
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.93
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.93
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.92
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.91
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.91
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.91
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 96.9
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.89
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.88
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.88
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.88
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 96.88
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.87
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 96.87
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.87
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 96.86
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.85
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.85
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.85
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.85
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 96.84
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.84
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 96.83
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.83
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 96.83
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.82
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 96.81
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 96.81
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 96.8
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.78
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 96.78
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.78
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 96.77
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.76
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.76
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.75
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.75
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.74
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.73
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 96.73
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 96.72
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 96.72
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 96.72
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.72
1tue_A212 Replication protein E1; helicase, replication, E1E 96.72
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.72
1byi_A 224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 96.7
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.7
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.7
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 96.7
2fh5_B214 SR-beta, signal recognition particle receptor beta 96.69
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 96.69
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.69
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.69
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.67
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.67
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.67
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 96.67
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 96.67
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.67
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.66
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.66
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.65
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.65
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.64
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.63
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 96.62
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.62
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.62
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.61
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 96.61
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.61
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.61
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.6
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.6
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 96.6
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.6
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 96.6
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 96.6
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.59
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.59
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.58
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 96.58
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 96.58
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 96.56
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.54
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.54
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.53
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 96.53
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.52
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 96.52
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.51
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.5
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.5
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.48
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.47
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 96.47
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 96.46
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 96.45
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.45
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 96.44
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.43
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 96.42
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 96.42
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 96.42
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.41
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.41
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.41
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
Probab=99.47  E-value=7.1e-14  Score=115.87  Aligned_cols=92  Identities=12%  Similarity=0.075  Sum_probs=72.2

Q ss_pred             CCCCCEEEEEEcCCCCcHHHHHHHHHHhhhc--CCCCceeecCCCCCCCCCc-ccCCCCcccccCCCCChH---HHHHHH
Q psy11490         22 FKSKPICLIVLGMAGSGKTSFVKKFSSYLYD--KQDNPYVINLDPACRDVPY-LVNVDPACRDVPYLVNVG---ELSMLL   95 (147)
Q Consensus        22 ~~~~~~~I~I~G~SGSGKTTl~~~L~~~l~~--~g~~v~vv~lD~~~~~l~~-~~~~d~~n~d~p~a~d~~---~~l~~L   95 (147)
                      ..++|++|+|+|+|||||||+++.|..++..  .++.+.++++|.++..... ....-...+++|+++|.+   +++..|
T Consensus        88 ~~~~p~iigI~GpsGSGKSTl~~~L~~ll~~~~~~~~v~~i~~D~f~~~~~~l~~~~~~~~~g~P~~~D~~~l~~~L~~L  167 (321)
T 3tqc_A           88 EPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAI  167 (321)
T ss_dssp             CCCCCEEEEEECCTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHTTCGGGTTSGGGBCHHHHHHHHHHH
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHhcccCCCCeEEEEeecccccchhhhhhHHHHhhccCcccccHHHHHHHHHhh
Confidence            3567899999999999999999999999874  3567999999999854221 112213456789999987   678889


Q ss_pred             hCCC-eeeEeccchhhhhh
Q psy11490         96 LNGN-KLEHQILNFQKLAT  113 (147)
Q Consensus        96 ~~g~-~i~~p~ydf~~~~~  113 (147)
                      ++|+ .+..|.|||.....
T Consensus       168 ~~g~~~v~~P~yd~~~~~r  186 (321)
T 3tqc_A          168 KSGQRNVRIPVYSHHYYDI  186 (321)
T ss_dssp             HTTCSSEEEEEEETTTTEE
T ss_pred             hccccccccchhhhhcccc
Confidence            9998 89999999986653



>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1yrba1 244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 1e-08
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 0.001
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.002
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.002
d2vp4a1197 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr 0.003
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 0.003
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.004
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]
 Score = 49.6 bits (117), Expect = 1e-08
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 27 ICLIVLGMAGSGKTSFVKKFSSYLYDKQDNPYVINLDPACRDVPYLVNVD 76
          + ++ +G AGSGKT+   +F  YL D       +NLD   +++PY  ++D
Sbjct: 1  MIVVFVGTAGSGKTTLTGEFGRYLEDNYK-VAYVNLDTGVKELPYEPSID 49


>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.61
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.59
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.53
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.42
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.1
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.77
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.73
d1okkd2207 GTPase domain of the signal recognition particle r 98.69
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.64
d2qy9a2211 GTPase domain of the signal recognition particle r 98.62
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.62
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.61
d1vmaa2213 GTPase domain of the signal recognition particle r 98.61
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.6
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.58
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.54
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.49
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.45
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.38
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 98.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.35
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.33
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.33
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 98.3
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.3
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.29
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.27
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.26
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.26
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.23
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.19
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.18
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.18
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.16
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.15
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.14
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.12
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.11
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.1
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.1
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.09
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.07
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.06
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.05
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.05
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.05
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.04
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.03
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.02
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.02
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 98.01
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 98.0
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.98
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.97
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 97.97
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.96
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.95
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.94
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.93
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.93
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.91
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.91
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.9
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.9
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.9
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.89
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 97.89
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.88
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.84
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 97.82
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.82
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.81
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.8
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.79
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.77
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.75
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.74
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.69
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.69
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 97.68
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.66
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.65
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.64
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.63
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 97.58
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.55
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.53
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.51
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 97.48
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 97.48
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 97.44
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.44
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.43
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 97.4
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.36
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.36
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.33
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.32
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 97.32
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.32
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.31
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 97.3
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.27
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.27
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.25
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.24
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.21
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.2
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.19
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.14
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.13
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.12
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.09
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.06
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.06
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.06
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.06
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.04
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.04
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.04
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.04
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.02
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.97
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.97
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.97
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.95
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.94
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.94
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.92
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.89
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.87
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.86
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.86
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.85
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.84
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.83
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.82
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.81
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.8
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.75
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.75
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.74
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.74
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.72
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.7
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.69
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.68
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.68
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.68
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 96.67
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.64
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.64
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.63
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.62
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.61
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.59
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.59
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.58
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.57
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.56
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 96.56
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.56
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.54
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.53
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.53
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.52
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.51
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.48
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.46
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 96.45
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.45
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.43
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.43
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.41
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.41
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.39
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.36
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 96.35
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.35
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.34
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.34
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.32
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.31
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.31
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 96.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.3
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.29
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.27
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.26
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.25
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.23
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 96.2
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.2
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.18
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.16
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.14
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.14
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.11
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.07
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.07
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.01
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 95.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.92
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.89
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.78
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.77
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.77
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.74
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.73
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.72
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.68
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.64
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.61
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.55
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.55
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 95.48
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.41
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.33
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 95.27
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.2
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 95.07
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 95.07
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.05
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.05
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 94.99
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.91
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 94.86
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 94.85
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 94.83
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.82
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.77
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.76
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 94.75
d1xpua3 289 Transcription termination factor Rho, ATPase domai 94.74
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 94.62
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 94.49
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.44
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 94.38
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.29
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 94.16
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 94.13
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.11
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 94.05
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 93.94
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 93.89
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 93.81
d1e8ca3 234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 93.81
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.67
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.59
d1s1ma2 266 CTP synthase PyrG, N-terminal domain {Escherichia 93.49
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 93.39
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.36
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 93.01
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 92.62
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.52
d1vcoa2 272 CTP synthase PyrG, N-terminal domain {Thermus ther 92.49
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 92.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.99
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 91.86
d2vo1a1 273 CTP synthase PyrG, N-terminal domain {Human (Homo 91.71
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 91.17
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 90.47
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 90.27
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 89.81
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 89.65
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.24
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 89.24
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 89.23
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 88.99
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.69
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 88.45
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 86.99
d2gc6a2 296 Folylpolyglutamate synthetase {Lactobacillus casei 84.9
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 84.81
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 84.62
d1o5za2 296 Folylpolyglutamate synthetase {Thermotoga maritima 84.29
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 82.5
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]
Probab=99.61  E-value=3e-16  Score=127.72  Aligned_cols=107  Identities=9%  Similarity=0.050  Sum_probs=80.7

Q ss_pred             CCCCCCCEEEEEEcCCCCcHHHHHHHHHHhhhc--CCCCceeecCCCCCCCCCc-ccCCCCcccccCCCCChH---HHHH
Q psy11490         20 PEFKSKPICLIVLGMAGSGKTSFVKKFSSYLYD--KQDNPYVINLDPACRDVPY-LVNVDPACRDVPYLVNVG---ELSM   93 (147)
Q Consensus        20 ~~~~~~~~~I~I~G~SGSGKTTl~~~L~~~l~~--~g~~v~vv~lD~~~~~l~~-~~~~d~~n~d~p~a~d~~---~~l~   93 (147)
                      ...++.|++|||+|++||||||||+.|...|..  .+.+|.+|++|.||..-.. .......++++|+++|++   +++.
T Consensus        74 ~~~~k~P~iIGIaG~sgSGKSTla~~L~~lL~~~~~~~~v~~Is~D~F~~~~~~l~~~~~~~~~g~Pes~D~~~L~~~L~  153 (308)
T d1sq5a_          74 TNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVS  153 (308)
T ss_dssp             CC-CCCCEEEEEEECTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHHTCTTCTTSGGGBCHHHHHHHHH
T ss_pred             ccCCCCCEEEEEeCCCCCCCcHHHHHHHHHHhhhcCCCceEEEeeeeeECCchHHHHhcCCccCCchHhhhHHHHHHHHH
Confidence            345678999999999999999999999999974  3567999999999965211 112225678899999988   6788


Q ss_pred             HHhCCC-eeeEeccchhhhhh-------hhcceeEEeeccc
Q psy11490         94 LLLNGN-KLEHQILNFQKLAT-------WMAFGFAFMRSSC  126 (147)
Q Consensus        94 ~L~~g~-~i~~p~ydf~~~~~-------~~~~g~iive~~~  126 (147)
                      .+++|+ .|..|.|||.....       .....++|+|+-+
T Consensus       154 ~lk~g~~~v~~P~yd~~~~d~~~~~~~~~~~~dIlIvEGi~  194 (308)
T d1sq5a_         154 DLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLN  194 (308)
T ss_dssp             HHTTTCSCEEECCEETTTTEECTTCCEEEC-CCEEEEECTT
T ss_pred             HHHcCCCcceeeccchhhcccCCCCceEeCCCCEEEEcchh
Confidence            888884 69999999975432       1223578888854



>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure