Psyllid ID: psy11539

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530
MDTSNINMAAPNLETDTMVNANPDNTRMVNPNFVDWEKELFNTNYTNNFLNVDLKKLRPQSQNEKENRMPVSTQAPAVTTYRPMAPSGPSQPMRPAMGQKNNNQPPNTKSNAGPARPSTDQTKSFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEEEKENTCTFLVNKYVT
cccccccccccccccccccccccccccccccccccHHHHHcccccccccEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHccccccccccccccEEEEcccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEEEccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccEEEEEcEEEEEcccccEEEEccccccccccccccccccccccccccccccEEccccccEEEEEEcccccEEEEEcHHHcccccccccccccccEEEEccccccccccEEEEcccccEEEEcccccEEEEEEcccccccccccEEEEEcccEEEEcccccEEcccccEEEEEEEcccc
cccccHccccccccccccEccccccccccccccccHHHHHHccccccccccccHHHcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEcccccccccccccccccHccccccccEEEEEEEEEcccccEEEEEcccEccccccccccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEccccccEEEEcHHHHcccccccccccccccEEEEccccccccccEEEEccccEEEEEEcccccEEEEcccccccccccccEEEEcccEEEEccccEEccccccEEEEEEccccc
mdtsninmaapnletdtmvnanpdntrmvnpnfvDWEKELFntnytnnflnvdlkklrpqsqnekenrmpvstqapavttyrpmapsgpsqpmrpamgqknnnqppntksnagparpstdqtksfypsvpsnghpsvpsnaypssshfQVVFRWKIMDFVFrdnkqkvnlirsnkfipennlplgigiwrstiflsfpkwkagipftlasfnmndpsespillpypnwsyfddsncnsLISVFRMSvdkcdrlwiMDTGVTNILSSIQqlcppkimvfdlKTNTLIRKYIlptaqvfegslfSNIVTEVVEDCDHVFAYVNDVFRYGLIVYdffkntsyrlthpymypeptqstyildnlkfrwvdgifgmaispelsgykykrhpyeyyhynvhhyngtnvdktirddqrymyfhsmssnrhyyVSTTdlrnssryvnssdiDEYFHYLGsrfkntqasasainsnGVMFYNLVTKhsvgcwntktkvylpqtqdIVQTSRDILNFreegeeeeekenTCTFLVNKYVT
mdtsninmaapnletdtmvnanpdNTRMVNPNFVDWEKELFNTNYTNNFLNVDLKKLRpqsqnekenrmpvstqapavtTYRPMAPSGPSQPMRPAMGQKNNNQPPNTKSNAGPARPSTDQTKSFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVnlirsnkfipennlplGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTkvylpqtqdivQTSRDILNFReegeeeeekentctflvnkyvt
MDTSNINMAAPNLETDTMVNANPDNTRMVNPNFVDWEKElfntnytnnflnVDLKKLRPQSQNEKENRMPVSTQAPAVTTYRPMAPSGPSQPMRPAMGQKNNNQPPNTKSNAGPARPSTDQTKSFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRhpyeyyhynvhhyNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFReegeeeeekeNTCTFLVNKYVT
***************************MVNPNFVDWEKELFNTNYTNNFLNVDL********************************************************************************************HFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQT******************************
********AAPNLETDTMVNANPDNTRMVNPNFVDWEKELFNTNYTNNFLNVD*********************APAVTT***************************************DQTKSFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDP******LPY*NWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEEEKENTCTFLVNKYV*
MDTSNINMAAPNLETDTMVNANPDNTRMVNPNFVDWEKELFNTNYTNNFLNVDLKKLRP**************QAPAVTTYRPMAPSGPSQPMRPAMGQK***********************SFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFR***********TCTFLVNKYVT
***********N**TDTMVNANPDNTRMVNPNFVDWEKELFNTNYTNNFLNVDLKKLRP****************P****Y****************************************************************SHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEEEKENTCTFLVNK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTSNINMAAPNLETDTMVNANPDNTRMVNPNFVDWEKELFNTNYTNNFLNVDLKKLRPQSQNEKENRMPVSTQAPAVTTYRPMAPSGPSQPMRPAMGQKNNNQPPNTKSNAGPARPSTDQTKSFYPSVPSNGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEEEKENTCTFLVNKYVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query530 2.2.26 [Sep-21-2011]
Q9GP71 568 Protein yellow OS=Drosoph N/A N/A 0.635 0.593 0.326 2e-56
Q9GP81 568 Protein yellow OS=Drosoph N/A N/A 0.635 0.593 0.326 1e-55
O02437 568 Protein yellow OS=Drosoph N/A N/A 0.635 0.593 0.323 1e-55
Q9BI18 560 Protein yellow OS=Drosoph no N/A 0.630 0.596 0.320 2e-55
Q9BI23 541 Protein yellow OS=Drosoph N/A N/A 0.635 0.622 0.312 5e-55
Q9BI17 541 Protein yellow OS=Drosoph N/A N/A 0.635 0.622 0.315 8e-55
P09957 541 Protein yellow OS=Drosoph no N/A 0.635 0.622 0.318 1e-54
P62407 541 Protein yellow OS=Drosoph N/A N/A 0.635 0.622 0.318 2e-54
P62408 541 Protein yellow OS=Drosoph N/A N/A 0.635 0.622 0.318 2e-54
O18330432 Major royal jelly protein no N/A 0.547 0.671 0.281 2e-36
>sp|Q9GP71|YELL_DROMD Protein yellow OS=Drosophila madeirensis GN=y PE=3 SV=1 Back     alignment and function desciption
 Score =  220 bits (560), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 122/374 (32%), Positives = 197/374 (52%), Gaps = 37/374 (9%)

Query: 148 FQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFT 207
            Q  + W  +DF F + + K   + S  +IP N LP+G+  + + +F++ P+W+ GIP T
Sbjct: 32  LQERYSWNQLDFAFPNARLKEQALASGDYIPTNALPVGVEHFGNRLFVTVPRWRDGIPAT 91

Query: 208 LASFNMNDP-SESPILLPYPNWSYFDDSNC-NSLISVFRMSVDKCDRLWIMDTGVTNILS 265
           L   NM+   + SP L+PYP+W      +C NS+ + +R+ VD+C RLW++DTG   I +
Sbjct: 92  LTYINMDHSVTGSPELIPYPDWRANTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGN 151

Query: 266 SIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFR 325
           +    CP  I +FDL TNT IR+Y LP A     +  +NI  ++ ++CD  FAY  D   
Sbjct: 152 TTTNPCPYAINIFDLTTNTRIRRYELPAADTNPNTFIANIAVDIGKNCDDAFAYFADELG 211

Query: 326 YGLIVYDFFKNTSYRLT-HPYMYPEPTQSTYILDNLKFRWV-DGIFGMAISPELSGYKYK 383
           YGLI Y +  N S+R + H Y +P+P +  + +  + F+W  +GIFGM+++P  S     
Sbjct: 212 YGLISYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLTPIRS----- 266

Query: 384 RHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDI 443
                                   D  R +YF  ++S+R + VST  LR+ +R   + D 
Sbjct: 267 ------------------------DGYRTLYFSPLASHRQFAVSTRILRDETR---TEDS 299

Query: 444 DEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRD 503
              F  L  R  N   ++  ++ +GV  +NL+ +++VGCW++    Y PQ+  IV     
Sbjct: 300 YHDFVALDERGPNAHTTSRVMSDDGVELFNLIDQNAVGCWHSSMP-YSPQSHGIVDRDDV 358

Query: 504 ILNFREEGEEEEEK 517
            L F  + + +E K
Sbjct: 359 GLVFPADVKIDENK 372
Controls the pigmentation pattern of the adult cuticle and larval mouth parts.
Drosophila madeirensis (taxid: 30013)
>sp|Q9GP81|YELL_DROGU Protein yellow OS=Drosophila guanche GN=y PE=3 SV=1 Back     alignment and function description
>sp|O02437|YELL_DROSU Protein yellow OS=Drosophila subobscura GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI18|YELL_DROPS Protein yellow OS=Drosophila pseudoobscura pseudoobscura GN=y PE=3 SV=2 Back     alignment and function description
>sp|Q9BI23|YELL_DROER Protein yellow OS=Drosophila erecta GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI17|YELL_DROYA Protein yellow OS=Drosophila yakuba GN=y PE=3 SV=1 Back     alignment and function description
>sp|P09957|YELL_DROME Protein yellow OS=Drosophila melanogaster GN=y PE=1 SV=1 Back     alignment and function description
>sp|P62407|YELL_DROSI Protein yellow OS=Drosophila simulans GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62408|YELL_DROMA Protein yellow OS=Drosophila mauritiana GN=y PE=3 SV=1 Back     alignment and function description
>sp|O18330|MRJP1_APIME Major royal jelly protein 1 OS=Apis mellifera GN=MRJP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query530
148277604552 yellow-h precursor [Apis mellifera] gi|8 0.652 0.626 0.424 3e-82
383866095553 PREDICTED: protein yellow-like [Megachil 0.654 0.627 0.417 6e-82
380022677622 PREDICTED: protein yellow-like [Apis flo 0.654 0.557 0.415 6e-82
350424571550 PREDICTED: protein yellow-like [Bombus i 0.654 0.630 0.409 1e-80
340716436551 PREDICTED: protein yellow-like [Bombus t 0.654 0.629 0.409 2e-80
328702791469 PREDICTED: protein yellow-like [Acyrthos 0.654 0.739 0.396 2e-80
307168907602 Protein yellow [Camponotus floridanus] 0.656 0.578 0.403 3e-79
242017765428 major royal jelly protein 4 precursor, p 0.645 0.799 0.416 3e-79
307201057544 Protein yellow [Harpegnathos saltator] 0.647 0.630 0.402 4e-79
332022021 646 Protein yellow [Acromyrmex echinatior] 0.656 0.538 0.392 1e-78
>gi|148277604|ref|NP_001091687.1| yellow-h precursor [Apis mellifera] gi|82527239|gb|ABB81847.1| yellow-h [Apis mellifera] Back     alignment and taxonomy information
 Score =  312 bits (799), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 231/382 (60%), Gaps = 36/382 (9%)

Query: 149 QVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTL 208
           ++V+ W  +D+ +   + + + I    FI ENNLPLG+ +WR  +F++ PKWK GIP TL
Sbjct: 155 ELVYAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGLEVWRDKVFITLPKWKDGIPVTL 214

Query: 209 ASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQ 268
            +   +  ++SP L PYPNW +    NC+ L SVFR+ VD+CDRLWI+D+G  +I    +
Sbjct: 215 TTVPKHSKTKSPKLRPYPNWEWHTVGNCDGLTSVFRIQVDECDRLWILDSGKVDIAKGGK 274

Query: 269 QLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVV-EDCDHVFAYVNDVFRYG 327
             CPP I +FDL T+TLIRKYI+P  QV E SL++NIV ++  EDC    AYV+DVFRYG
Sbjct: 275 LACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAYVSDVFRYG 334

Query: 328 LIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPY 387
           L++YDFFK++S+R+ H + YP+P  S Y L  LKF+W DGIFGMA+SP            
Sbjct: 335 LLIYDFFKDSSFRIQHHFFYPDPLASKYELHGLKFQWTDGIFGMALSP------------ 382

Query: 388 EYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYF 447
                ++H             D R ++FH MSS R + VST+ L +      ++D   YF
Sbjct: 383 ----VDIH-------------DDRTLFFHPMSSFREFAVSTSILGDKKTAEENTD---YF 422

Query: 448 HYLGS-RFKN-TQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDIL 505
             +G  R K+   +S S I+ NGVMF+N+VT+ SV CW+T+ K Y+PQ   ++ TS   L
Sbjct: 423 MPIGRPRAKDYGHSSGSVIDRNGVMFFNMVTRDSVWCWDTR-KEYIPQNLGVIGTSNLSL 481

Query: 506 NFREEGEEEEEKENTCTFLVNK 527
            F  + + + E +     L NK
Sbjct: 482 VFPNDIKVDHEYDQNVWVLSNK 503

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383866095|ref|XP_003708507.1| PREDICTED: protein yellow-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380022677|ref|XP_003695165.1| PREDICTED: protein yellow-like [Apis florea] Back     alignment and taxonomy information
>gi|350424571|ref|XP_003493840.1| PREDICTED: protein yellow-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716436|ref|XP_003396704.1| PREDICTED: protein yellow-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328702791|ref|XP_001945925.2| PREDICTED: protein yellow-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307168907|gb|EFN61807.1| Protein yellow [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242017765|ref|XP_002429357.1| major royal jelly protein 4 precursor, putative [Pediculus humanus corporis] gi|212514266|gb|EEB16619.1| major royal jelly protein 4 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307201057|gb|EFN80989.1| Protein yellow [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332022021|gb|EGI62347.1| Protein yellow [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query530
FB|FBgn0039896463 yellow-h "yellow-h" [Drosophil 0.433 0.496 0.424 2.6e-69
FB|FBgn0004034 541 y "yellow" [Drosophila melanog 0.433 0.425 0.370 1.3e-55
FB|FBgn0032601453 yellow-b "yellow-b" [Drosophil 0.445 0.520 0.316 6.9e-55
FB|FBgn0041713438 yellow-c "yellow-c" [Drosophil 0.437 0.529 0.331 3.7e-48
UNIPROTKB|Q8MZM5462 dce "Dopachrome conversion enz 0.430 0.493 0.307 1.1e-44
UNIPROTKB|O18330432 MRJP1 "Major royal jelly prote 0.428 0.525 0.302 1.7e-40
FB|FBgn0041712432 yellow-d "yellow-d" [Drosophil 0.409 0.502 0.298 8.9e-37
FB|FBgn0038105452 yellow-f2 "yellow-f2" [Drosoph 0.384 0.451 0.320 5.8e-36
FB|FBgn0041711 530 yellow-e "yellow-e" [Drosophil 0.432 0.432 0.337 7.2e-36
FB|FBgn0041710447 yellow-f "yellow-f" [Drosophil 0.416 0.494 0.324 8.3e-34
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 570 (205.7 bits), Expect = 2.6e-69, Sum P(2) = 2.6e-69
 Identities = 99/233 (42%), Positives = 156/233 (66%)

Query:   144 SSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAG 203
             S S  ++V+ WK +DF++    Q+   I +  F+P+NNLPLGI +  + +F++ P+WK G
Sbjct:    49 SESQLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNG 108

Query:   204 IPFTLASFNMNDPSESPILLPYPNWSYFDDSN---CNSLISVFRMSVDKCDRLWIMDTGV 260
             +P +L +        SP + PYPNW    + N   C+ L+SV+R +VD+CDR+W++D+G+
Sbjct:   109 VPASLGTLPFPPKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLIDSGI 168

Query:   261 TNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYV 320
              N   ++ Q+CPPKI+V+DLK++ LI +Y L  + V + SL SNIV ++ EDCD   A V
Sbjct:   169 VNATINLNQICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIGEDCDDAHAIV 228

Query:   321 NDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAI 373
             +DV+R+GL+VY   KN S+R+T+   YP+P  S + +  L F+W+DG+FGM+I
Sbjct:   229 SDVWRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSI 281
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0048067 "cuticle pigmentation" evidence=IBA
GO:0016853 "isomerase activity" evidence=IBA
GO:0042438 "melanin biosynthetic process" evidence=IBA
GO:0005576 "extracellular region" evidence=IBA
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0041712 yellow-d "yellow-d" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041711 yellow-e "yellow-e" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
pfam03022285 pfam03022, MRJP, Major royal jelly protein 6e-68
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information 
 Score =  220 bits (562), Expect = 6e-68
 Identities = 98/269 (36%), Positives = 150/269 (55%), Gaps = 35/269 (13%)

Query: 240 ISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEG 299
           +SV+R++VD+CDRLW++D+G+ N L   +Q+CPPK++VFDL T+ L++++ LP       
Sbjct: 1   VSVYRIAVDECDRLWVLDSGIVNTLQPPKQICPPKLLVFDLATDKLLKRFELPADVAKGN 60

Query: 300 SLFSNIVTEVVED-CDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILD 358
           S   N+V +V +D CD  F Y+ D    GLIVYD   + S+R+ H   YP+P    + + 
Sbjct: 61  SRLVNLVVDVGDDTCDDTFVYIADAKGRGLIVYDLADDKSWRVEHNTFYPDPDFGKFTIA 120

Query: 359 NLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSM 418
              F+  DGIFG+A+SP                                 D R +YFH +
Sbjct: 121 GESFQLDDGIFGLALSP------------------------------RTPDGRTLYFHPL 150

Query: 419 SSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKH 478
           +S R Y V T  LRN + + N++  ++ F  LG R  NTQ++A A++ NGV+F+ LV ++
Sbjct: 151 ASTRLYSVPTEVLRNETNWGNNAQYED-FKDLGDR--NTQSTALAVDPNGVLFFGLVGQN 207

Query: 479 SVGCWNTKTKVYLPQTQDIVQTSRDILNF 507
           +VGCWNT +  Y      +V  + D L F
Sbjct: 208 AVGCWNT-STPYSRANLGVVARNSDTLQF 235

Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 530
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 100.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.47
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.25
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.13
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.02
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.99
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.44
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.11
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.05
PRK11028330 6-phosphogluconolactonase; Provisional 98.03
PRK11028330 6-phosphogluconolactonase; Provisional 97.95
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.93
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.82
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.82
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.75
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.73
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 97.52
COG3391 381 Uncharacterized conserved protein [Function unknow 97.26
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.23
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.21
KOG1520|consensus376 97.15
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.02
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.89
COG3391381 Uncharacterized conserved protein [Function unknow 96.63
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.53
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.3
KOG4659|consensus 1899 96.24
KOG1214|consensus 1289 95.95
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.94
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 95.9
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.88
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.77
PRK02888 635 nitrous-oxide reductase; Validated 95.71
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 95.57
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 95.54
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 95.06
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 94.86
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.74
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.2
KOG4499|consensus310 94.14
KOG4659|consensus 1899 94.11
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 93.92
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.77
KOG1539|consensus 910 93.75
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.22
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 93.15
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 92.48
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.41
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.17
KOG1520|consensus 376 92.17
KOG4499|consensus310 91.83
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 91.77
PF13449326 Phytase-like: Esterase-like activity of phytase 91.66
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 91.41
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.93
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 90.87
KOG1214|consensus1289 90.69
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 90.41
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 90.38
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.35
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.09
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 87.63
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 87.37
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 85.16
COG4946668 Uncharacterized protein related to the periplasmic 84.94
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 84.44
PF13449326 Phytase-like: Esterase-like activity of phytase 82.9
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 81.59
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 80.3
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information 
Probab=100.00  E-value=1.1e-64  Score=513.39  Aligned_cols=253  Identities=35%  Similarity=0.686  Sum_probs=213.3

Q ss_pred             eEEEEEEEeCCCcEEEEeCCCCCcccCccccCCCEEEEEECCCCcEEEEEECCCcccccCccccceEEEeec-CCCCeEE
Q psy11539        240 ISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVE-DCDHVFA  318 (530)
Q Consensus       240 vSV~rv~ID~cgRLWVLDtG~~~~~~~~~~~c~PKLvvfDL~Td~li~~y~~P~~v~~~~S~lndIvVDv~~-~c~~~~A  318 (530)
                      +||++++||+||||||||+|.++..+.+.+.|+|||++|||+||+++++|.||++++++.|+|++|+||.++ +|+++||
T Consensus         1 ~sV~~v~iD~~~rLWVlD~G~~~~~~~~~~~~~pKLv~~Dl~t~~li~~~~~p~~~~~~~s~lndl~VD~~~~~~~~~~a   80 (287)
T PF03022_consen    1 VSVQRVQIDECGRLWVLDSGRPNGLQPPKQVCPPKLVAFDLKTNQLIRRYPFPPDIAPPDSFLNDLVVDVRDGNCDDGFA   80 (287)
T ss_dssp             S-EEEEEE-TTSEEEEEE-CCHSSSSTTGHTS--EEEEEETTTTCEEEEEE--CCCS-TCGGEEEEEEECTTTTS-SEEE
T ss_pred             CcccEEEEcCCCCEEEEeCCCcCCCCCCCCCCCcEEEEEECCCCcEEEEEECChHHcccccccceEEEEccCCCCcceEE
Confidence            699999999999999999999998877788999999999999999999999999999999999999999976 6999999


Q ss_pred             EEecCCCCeEEEEEccCCeEEEEcCCCCCcCCCcceeeecCeEeeecCCccceecCCCcccccccCCCcccccccccccC
Q psy11539        319 YVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGYKYKRHPYEYYHYNVHHYN  398 (530)
Q Consensus       319 YItDsg~~gLIVyDl~~g~swRv~h~sf~pdP~~~~f~I~G~~f~~~dGi~GIALsp~~~~~~~~~~~~~~y~~~~~~~~  398 (530)
                      ||||++.+||||||+++|++|||+|++|+++|.+..|.++|+.|+|.+|++||||+|..                     
T Consensus        81 YItD~~~~glIV~dl~~~~s~Rv~~~~~~~~p~~~~~~i~g~~~~~~dg~~gial~~~~---------------------  139 (287)
T PF03022_consen   81 YITDSGGPGLIVYDLATGKSWRVLHNSFSPDPDAGPFTIGGESFQWPDGIFGIALSPIS---------------------  139 (287)
T ss_dssp             EEEETTTCEEEEEETTTTEEEEEETCGCTTS-SSEEEEETTEEEEETTSEEEEEE-TTS---------------------
T ss_pred             EEeCCCcCcEEEEEccCCcEEEEecCCcceeccccceeccCceEecCCCccccccCCCC---------------------
Confidence            99999999999999999999999999999999999999999999999999999999964                     


Q ss_pred             CccccccccCCCceEEEEeCCCCeeEEEecchhcCccccCCccccccceEEeccccCCCCCcceEEcCCCcEEEEccCCC
Q psy11539        399 GTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAINSNGVMFYNLVTKH  478 (530)
Q Consensus       399 ~~~~~~~~~~~~r~LYf~plsS~~lY~V~T~~Lrn~s~~~~~~~~~~~v~~lG~rG~~sqs~G~aiD~~G~LYft~~~~~  478 (530)
                               .++|+||||||+|+++|+|+|++|++++.+. ...+...|+.+|+||  +|++|+++|++|+|||++++++
T Consensus       140 ---------~d~r~LYf~~lss~~ly~v~T~~L~~~~~~~-~~~~~~~v~~lG~k~--~~s~g~~~D~~G~ly~~~~~~~  207 (287)
T PF03022_consen  140 ---------PDGRWLYFHPLSSRKLYRVPTSVLRDPSLSD-AQALASQVQDLGDKG--SQSDGMAIDPNGNLYFTDVEQN  207 (287)
T ss_dssp             ---------TTS-EEEEEETT-SEEEEEEHHHHCSTT--H-HH-HHHT-EEEEE-----SECEEEEETTTEEEEEECCCT
T ss_pred             ---------CCccEEEEEeCCCCcEEEEEHHHhhCccccc-cccccccceeccccC--CCCceEEECCCCcEEEecCCCC
Confidence                     3459999999999999999999999999853 222577899999987  7999999999999999999999


Q ss_pred             eEEEEeCCCCccccCceeEEeecCCceeecceeEEec--CCcEEEEEeecee
Q psy11539        479 SVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEE--EKENTCTFLVNKY  528 (530)
Q Consensus       479 aI~cWnt~~~~~~~~n~~lV~~d~~~L~~Pd~l~Id~--dG~lYv~~~snr~  528 (530)
                      +|+|||++ ++|.++|+++|++|++.|+||++++|+.  +|+|||  ++||+
T Consensus       208 aI~~w~~~-~~~~~~~~~~l~~d~~~l~~pd~~~i~~~~~g~L~v--~snrl  256 (287)
T PF03022_consen  208 AIGCWDPD-GPYTPENFEILAQDPRTLQWPDGLKIDPEGDGYLWV--LSNRL  256 (287)
T ss_dssp             EEEEEETT-TSB-GCCEEEEEE-CC-GSSEEEEEE-T--TS-EEE--EE-S-
T ss_pred             eEEEEeCC-CCcCccchheeEEcCceeeccceeeeccccCceEEE--EECcc
Confidence            99999999 9999999999999887799999999999  887776  88886

5% of the mass, and 82-90% of the protein content [], of honeybee (Apis mellifera) royal jelly. Royal jelly is a substance secreted by the cephalic glands of nurse bees [] and it is used to trigger development of a queen bee from a bee larva. The biological function of the MRJPs is unknown, but they are believed to play a major role in nutrition due to their high essential amino acid content []. Two royal jelly proteins, MRJP3 and MRJP5, contain a tandem repeat that results from a high genetic variablility. This polymorphism may be useful for genotyping individual bees [].; PDB: 3Q6P_B 3Q6K_A 3Q6T_A 2QE8_B.
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
3q6p_A381 Salivary Protein From Lutzomyia Longipalpis. Seleno 2e-18
3q6k_A381 Salivary Protein From Lutzomyia Longipalpis Length 5e-18
>pdb|3Q6P|A Chain A, Salivary Protein From Lutzomyia Longipalpis. Selenomethionine Derivative Length = 381 Back     alignment and structure 
Iteration: 1

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 130/324 (40%), Gaps = 58/324 (17%)
Query: 193 IFLSFPKWKAGIPFTLASFNMNDP-----SESPILLPYPNWSYFDDSNCNSLISVFRMSV 247
           +FL+ P+    +P+TLA  +  +        SP+L  +             L S+++  +
Sbjct: 40  LFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSPLLNKFSG-----HKTGKELTSIYQPVI 94
Query: 248 DKCDRLWIMDTGVTNILSSIQQLCP---PKIMVFDLKTNTL--IRKYILPTAQVFEGSLF 302
           D C RLW++D G     S   +  P   P I+ +DLK      + +Y  PT  V + + F
Sbjct: 95  DDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYF 154
Query: 303 SNIVTEVVE---DCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPE-PTQSTYILD 358
                +V     DC   F Y+ +  R  L +YD  K  S+ +THP    E PT+  Y   
Sbjct: 155 GGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAERPTKFDYGGK 214
Query: 359 NLKFRWVDGIFGMAISPELSGYKYKRXXXXXXXXXXXXXNGTNVDKTIRDDQRYMYFHSM 418
             +F+   GIFG+ +    S                             +  R  Y+ + 
Sbjct: 215 EYEFK--AGIFGITLGDRDS-----------------------------EGNRPAYYLAG 243
Query: 419 SSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFKNTQASASAIN-SNGVMFYNLVTK 477
           S+ + Y V+T +L+     +N          LG+R K   A A A +    V+F+     
Sbjct: 244 SAIKVYSVNTKELKQKGGKLNP-------ELLGNRGKYNDAIALAYDPKTKVIFFAEANT 296
Query: 478 HSVGCWNTKTKVYLPQTQDIVQTS 501
             V CWNT+      +  D+V TS
Sbjct: 297 KQVSCWNTQKXPLRXKNTDVVYTS 320
>pdb|3Q6K|A Chain A, Salivary Protein From Lutzomyia Longipalpis Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query530
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 4e-81
2qe8_A343 Uncharacterized protein; structural genomics, join 2e-42
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score =  257 bits (657), Expect = 4e-81
 Identities = 81/371 (21%), Positives = 141/371 (38%), Gaps = 67/371 (18%)

Query: 151 VFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGI--WRSTIFLSFPKWKAGIPFTL 208
            ++WK + +           +    + P+N +            +FL+ P+    +P+TL
Sbjct: 5   GYKWKQLLYNN---------VTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTL 55

Query: 209 ASFNMND-----PSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNI 263
           A  +  +        SP+L  +             L S+++  +D C RLW++D G    
Sbjct: 56  AEVDTKNSLGVKGKHSPLLNKFSGHK-----TGKELTSIYQPVIDDCRRLWVVDIGSVEY 110

Query: 264 LSSIQQLCP---PKIMVFDLKTNTL--IRKYILPTAQVFEGSLFSNIVTEVV---EDCDH 315
            S   +  P   P I+ +DLK      + +Y  PT  V + + F     +V     DC  
Sbjct: 111 RSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYFGGFAVDVANPKGDCSE 170

Query: 316 VFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISP 375
            F Y+ +  R  L +YD  K  S+ +THP    E   + +     ++ +  GIFG+ +  
Sbjct: 171 TFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAERP-TKFDYGGKEYEFKAGIFGITLGD 229

Query: 376 ELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSS 435
             S                             +  R  Y+ + S+ + Y V+T +L+   
Sbjct: 230 RDS-----------------------------EGNRPAYYLAGSAIKVYSVNTKELKQKG 260

Query: 436 RYVNSSDIDEYFHYLGSRFKNTQASASAINS-NGVMFYNLVTKHSVGCWNTKTKVYLPQT 494
             +N          LG+R K   A A A +    V+F+       V CWNT+      + 
Sbjct: 261 GKLN-------PELLGNRGKYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQKMPLRMKN 313

Query: 495 QDIVQTSRDIL 505
            D+V TS   +
Sbjct: 314 TDVVYTSSRFV 324
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query530
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.51
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.49
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.48
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.44
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.43
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.41
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.39
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.39
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.38
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.36
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.34
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.33
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.29
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.28
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.28
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.27
3v65_B386 Low-density lipoprotein receptor-related protein; 99.26
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.25
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.25
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.23
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.21
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.19
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.17
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.16
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.16
3kya_A496 Putative phosphatase; structural genomics, joint c 99.15
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.14
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.14
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.12
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.1
3kya_A496 Putative phosphatase; structural genomics, joint c 99.1
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.08
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.06
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.06
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.02
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.01
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.99
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.99
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.98
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.98
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.97
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.93
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.93
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.92
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.92
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.89
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.89
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.89
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.87
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.85
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.85
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.84
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.83
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.8
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.79
2qe8_A343 Uncharacterized protein; structural genomics, join 98.79
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.79
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.76
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.75
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.55
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.55
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.52
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.48
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.47
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.45
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.43
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.42
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.41
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.35
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.32
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.31
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.31
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.28
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.26
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.26
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.26
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.25
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.24
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.24
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.14
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.14
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.14
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.12
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.05
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.98
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.96
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.95
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.95
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.91
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.88
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.86
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.84
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.77
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.74
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.73
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.72
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.71
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.71
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.71
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.71
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.67
2ece_A462 462AA long hypothetical selenium-binding protein; 97.55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.54
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.47
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.37
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.36
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.24
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.23
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.22
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.16
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.16
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.13
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.11
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.04
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.0
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.95
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.94
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.94
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.93
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.9
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.88
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.85
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.7
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.67
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.66
2ece_A462 462AA long hypothetical selenium-binding protein; 96.32
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.13
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.12
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.91
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.91
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 95.87
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.76
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.63
3ott_A 758 Two-component system sensor histidine kinase; beta 95.63
3ott_A758 Two-component system sensor histidine kinase; beta 95.45
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.45
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.39
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.32
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.32
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.28
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.28
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.24
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.11
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.1
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.07
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.07
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.95
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.85
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.79
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.67
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.58
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.52
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.5
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.41
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.23
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.01
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 93.8
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.79
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.68
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 93.64
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.51
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.34
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.26
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.17
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 93.16
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.08
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.96
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.82
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.64
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.44
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 92.35
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 92.29
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.21
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.18
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 92.1
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 92.07
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.04
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 92.02
1k32_A 1045 Tricorn protease; protein degradation, substrate g 91.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 91.64
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 91.47
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 91.37
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 91.34
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 91.29
3jrp_A379 Fusion protein of protein transport protein SEC13 91.26
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 91.25
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.19
3jrp_A379 Fusion protein of protein transport protein SEC13 90.8
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 90.75
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 90.61
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 89.76
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.69
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 89.54
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 89.33
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 89.21
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 88.99
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 88.88
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 88.81
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 88.64
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 88.44
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 88.35
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 88.17
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 87.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 87.76
4e54_B435 DNA damage-binding protein 2; beta barrel, double 87.72
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 87.61
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.6
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 87.36
4g56_B357 MGC81050 protein; protein arginine methyltransfera 86.83
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 86.77
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 86.75
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 86.35
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 86.26
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 86.26
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 86.25
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 86.15
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 86.02
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 85.56
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 85.44
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 85.37
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 84.55
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 84.4
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.24
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 84.1
4e54_B435 DNA damage-binding protein 2; beta barrel, double 84.1
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 83.78
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 83.59
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.19
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 82.9
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 82.82
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 82.29
3jro_A 753 Fusion protein of protein transport protein SEC13 82.29
3jro_A 753 Fusion protein of protein transport protein SEC13 82.23
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 81.71
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 80.98
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 80.86
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 80.83
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 80.78
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 80.34
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-87  Score=702.08  Aligned_cols=326  Identities=24%  Similarity=0.458  Sum_probs=304.3

Q ss_pred             ceEEEEEeeeeeecCChHHHHhhhcCCCcccCCCceeeeEE--eCCeEEEEccCCCCCCCcEEEEEECCCCC----CCCc
Q psy11539        148 FQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGI--WRSTIFLSFPKWKAGIPFTLASFNMNDPS----ESPI  221 (530)
Q Consensus       148 l~~vy~Wk~ldf~~p~~~~r~~ai~sg~Yip~n~iP~GV~v--~~gRlFVTiPR~~~GvP~TLa~V~~~~~~----~sP~  221 (530)
                      ++++||||+|||+         ||.+|+|+|+|++|+||++  ++||+|||+|||+.|+|+||++|.....+    .+|+
T Consensus         2 ~~~~~~Wk~ld~~---------ai~~g~y~p~n~~P~gv~vd~~~gRiFvt~PR~~~gvp~TL~~v~~~~~~~~~~~~p~   72 (381)
T 3q6k_A            2 DTQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSP   72 (381)
T ss_dssp             CCEEEEESSCCBT---------TSCTTSSCGGGCCCCEEEEETTTTEEEEECCTTSTTCSCSEEEEEHHHHTTCTTCSSC
T ss_pred             cceEEEEEeeccc---------cccCCCcccCccceeeeeeecCCCcEEEEeCCCCCCCCcEEEEEeCCCCcccccCCcc
Confidence            6899999999997         9999999999999999999  79999999999999999999999864322    3788


Q ss_pred             c-CCCCCCCcCCCCCCCCceEEEEEEEeCCCcEEEEeCCCCCcccCccc---cCCCEEEEEECCCC--cEEEEEECCCcc
Q psy11539        222 L-LPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQ---LCPPKIMVFDLKTN--TLIRKYILPTAQ  295 (530)
Q Consensus       222 L-~PYPsw~wn~~~nc~~LvSV~rv~ID~cgRLWVLDtG~~~~~~~~~~---~c~PKLvvfDL~Td--~li~~y~~P~~v  295 (530)
                      | +|||+|     ++|++|+||++++||+||||||||+|.++..+.+.+   .|+|||++|||+||  +++++|.||+++
T Consensus        73 ll~PYP~w-----~~~~~lvsV~~v~iD~~~rLWVLDtG~~~~~~~~~~~~~~~~pkLv~~DL~t~~~~li~~y~~p~~~  147 (381)
T 3q6k_A           73 LLNKFSGH-----KTGKELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRL  147 (381)
T ss_dssp             CBEECTTC-----SSSCSSSCEEEEEECTTCEEEEEECSSCSSCSTTGGGSCCCCCEEEEEESSSTTCCEEEEEECCGGG
T ss_pred             cccCCCCC-----ccccceEEeeEEEEcCCCcEEEEeCCCcCcCCCccccCCCCCceEEEEECCCCCceeEEEEECCHHh
Confidence            8 999998     489999999999999999999999999998887778   99999999999999  999999999999


Q ss_pred             cccCccccceEEEeec---CCCCeEEEEecCCCCeEEEEEccCCeEEEEcCCCCCcCCCcceeeecCeEeeecCCcccee
Q psy11539        296 VFEGSLFSNIVTEVVE---DCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMA  372 (530)
Q Consensus       296 ~~~~S~lndIvVDv~~---~c~~~~AYItDsg~~gLIVyDl~~g~swRv~h~sf~pdP~~~~f~I~G~~f~~~dGi~GIA  372 (530)
                      ++++|+|+||+||+..   +|+++||||||++.+||||||+++|++|||+|++|+|| .++.|+|+|++|+|.+|++|||
T Consensus       148 ~~~~S~l~di~VD~~~~~~~c~~~~aYItD~~~~gLIVydl~~~~swRv~~~~~~pd-~~~~~~i~G~~~~~~~Gi~gIa  226 (381)
T 3q6k_A          148 VEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAE-RPTKFDYGGKEYEFKAGIFGIT  226 (381)
T ss_dssp             CCCGGGEEEEEEEESCTTTTSCSEEEEEEETTTTEEEEEETTTTEEEEEECGGGSCC-SCEEEEETTEEEEECCCEEEEE
T ss_pred             cccCCccceEEEecccCCCCCCccEEEEEcCCCCcEEEEECCCCcEEEEccCCCccc-cCcceEECCEEeEeccCceEEE
Confidence            9999999999999653   79999999999999999999999999999999999999 6789999999999999999999


Q ss_pred             cCCCcccccccCCCcccccccccccCCccccccccCCCceEEEEeCCCCeeEEEecchhcCccccCCccccccceEEecc
Q psy11539        373 ISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGS  452 (530)
Q Consensus       373 Lsp~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~r~LYf~plsS~~lY~V~T~~Lrn~s~~~~~~~~~~~v~~lG~  452 (530)
                      |||++                             .+++|+||||||+|++||+|+|++|+++++       ..+|+.+|+
T Consensus       227 Lsp~~-----------------------------~~~~~~LYf~plss~~ly~V~T~~L~~~~~-------~~~v~~~G~  270 (381)
T 3q6k_A          227 LGDRD-----------------------------SEGNRPAYYLAGSAIKVYSVNTKELKQKGG-------KLNPELLGN  270 (381)
T ss_dssp             ECCCC-----------------------------TTSCCEEEEEESSCSEEEEEEHHHHSSTTC-------CCCCEEEEE
T ss_pred             ecCCc-----------------------------CCCCeEEEEEECCCCcEEEEEHHHhhCcch-------hhceEEeee
Confidence            99985                             456799999999999999999999999875       458999999


Q ss_pred             ccCCCCCcceEEc-CCCcEEEEccCCCeEEEEeCCCC-ccccCceeEEeecCCceeecceeEEecCCcEEEEEeecee
Q psy11539        453 RFKNTQASASAIN-SNGVMFYNLVTKHSVGCWNTKTK-VYLPQTQDIVQTSRDILNFREEGEEEEEKENTCTFLVNKY  528 (530)
Q Consensus       453 rG~~sqs~G~aiD-~~G~LYft~~~~~aI~cWnt~~~-~~~~~n~~lV~~d~~~L~~Pd~l~Id~dG~lYv~~~snr~  528 (530)
                      ||.++|+.|+++| ++|+|||+++++++|+|||++ + +|+++|+++|++++ +|+||++++|+.+|+|||  ++||+
T Consensus       271 kg~~s~~~~~~~D~~~G~ly~~~~~~~aI~~w~~~-~~~~~~~n~~~l~~d~-~l~~pd~~~i~~~g~Lwv--~sn~l  344 (381)
T 3q6k_A          271 RGKYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQ-KMPLRMKNTDVVYTSS-RFVFGTDISVDSKGGLWF--MSNGF  344 (381)
T ss_dssp             CCTTCCEEEEEECTTTCEEEEEESSSSEEEEEETT-SCSBCGGGEEEEEECT-TCCSEEEEEECTTSCEEE--EECSC
T ss_pred             cCCCCCcceEEEeCCCCeEEEEeccCCeEEEEeCC-CCccccCceEEEEECC-CccccCeEEECCCCeEEE--EECcc
Confidence            9878899999998 999999999999999999999 8 99999999999977 999999999999997766  78875
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query530
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.5
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.44
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.4
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.32
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.3
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.23
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.21
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.05
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.04
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.79
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.75
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.67
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.59
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.48
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.41
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.32
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.08
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.93
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.76
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.69
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.66
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.58
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.43
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.25
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.23
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.22
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.87
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.61
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.45
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.34
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.16
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.14
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.08
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.02
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 95.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.94
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.5
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.4
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 94.85
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.06
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.87
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 92.67
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.42
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.94
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.84
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.77
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 91.45
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.28
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.11
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.42
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.57
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 86.81
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 86.45
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 85.85
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.43
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 81.5
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]

Probab=99.50  E-value=1.5e-11  Score=118.45  Aligned_cols=263  Identities=11%  Similarity=0.054  Sum_probs=173.9

Q ss_pred             CCCCCCCcccCCCCCCceEEEEEeeeeeecCChHHHHhhhcCCCcccCCCceeeeEEe-CCeEEEEccCCCCCCCcEEEE
Q psy11539        132 NGHPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKVNLIRSNKFIPENNLPLGIGIW-RSTIFLSFPKWKAGIPFTLAS  210 (530)
Q Consensus       132 ~~~~~~~~~~~~~~~~l~~vy~Wk~ldf~~p~~~~r~~ai~sg~Yip~n~iP~GV~v~-~gRlFVTiPR~~~GvP~TLa~  210 (530)
                      .|-|-|.+....+-...+++.+|-                       .+..|.|+++. +|+||+|-..  .   .+|.+
T Consensus         2 ~~~~~~~~~~~~~~~~~~v~~~~p-----------------------~~~~~e~iAv~pdG~l~vt~~~--~---~~I~~   53 (302)
T d2p4oa1           2 AGLPPIYADKPIELAPAKIITSFP-----------------------VNTFLENLASAPDGTIFVTNHE--V---GEIVS   53 (302)
T ss_dssp             TTSCCTTTTSCBCCCCEEEEEEEC-----------------------TTCCEEEEEECTTSCEEEEETT--T---TEEEE
T ss_pred             CccCcccccCcccCCcccEEEECC-----------------------CCCCcCCEEECCCCCEEEEeCC--C---CEEEE
Confidence            456666666666666677776652                       24467899997 8999999654  2   37888


Q ss_pred             EECCCCCCCCccCCCCCCCcCCCCCCCCceEEEEEEEeCCCcEEEEeCCCCCcccCccccCCCEEEEEECC--CCcEEEE
Q psy11539        211 FNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLK--TNTLIRK  288 (530)
Q Consensus       211 V~~~~~~~sP~L~PYPsw~wn~~~nc~~LvSV~rv~ID~cgRLWVLDtG~~~~~~~~~~~c~PKLvvfDL~--Td~li~~  288 (530)
                      ++..  +   ..+.+..          .--.+.++.+|.+|+|||++.+.-.            |.++++.  .++....
T Consensus        54 i~p~--g---~~~~~~~----------~~~~~~gla~~~dG~l~v~~~~~~~------------~~~~~~~~~~~~~~~~  106 (302)
T d2p4oa1          54 ITPD--G---NQQIHAT----------VEGKVSGLAFTSNGDLVATGWNADS------------IPVVSLVKSDGTVETL  106 (302)
T ss_dssp             ECTT--C---CEEEEEE----------CSSEEEEEEECTTSCEEEEEECTTS------------CEEEEEECTTSCEEEE
T ss_pred             EeCC--C---CEEEEEc----------CCCCcceEEEcCCCCeEEEecCCce------------EEEEEecccccceeec
Confidence            8743  2   1222211          1135788999999999999876532            4444443  4455555


Q ss_pred             EECCCcccccCccccceEEEeecCCCCeEEEEecCCCCeEEEEEccCCeEEEEcCC-CCCcCCCcceeeecCeEeeecCC
Q psy11539        289 YILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHP-YMYPEPTQSTYILDNLKFRWVDG  367 (530)
Q Consensus       289 y~~P~~v~~~~S~lndIvVDv~~~c~~~~AYItDsg~~gLIVyDl~~g~swRv~h~-sf~pdP~~~~f~I~G~~f~~~dG  367 (530)
                      ...+.     ...++++++|     .++.+|++|+....+..+|..++..+.+... ...+.....          ....
T Consensus       107 ~~~~~-----~~~~n~i~~~-----~~g~~~v~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~  166 (302)
T d2p4oa1         107 LTLPD-----AIFLNGITPL-----SDTQYLTADSYRGAIWLIDVVQPSGSIWLEHPMLARSNSES----------VFPA  166 (302)
T ss_dssp             EECTT-----CSCEEEEEES-----SSSEEEEEETTTTEEEEEETTTTEEEEEEECGGGSCSSTTC----------CSCS
T ss_pred             cccCC-----ccccceeEEc-----cCCCEEeeccccccceeeeccCCcceeEecCCccceeeccC----------cccc
Confidence            55543     4678999998     6789999999999999999999987776543 111111000          0012


Q ss_pred             ccceecCCCcccccccCCCcccccccccccCCccccccccCCCceEEEEeCCCCeeEEEecchhcCccccCCccccccce
Q psy11539        368 IFGMAISPELSGYKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSMSSNRHYYVSTTDLRNSSRYVNSSDIDEYF  447 (530)
Q Consensus       368 i~GIALsp~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~r~LYf~plsS~~lY~V~T~~Lrn~s~~~~~~~~~~~v  447 (530)
                      .+||+.+                                   +..||+......++|+++.....  ..        ...
T Consensus       167 ~ngi~~~-----------------------------------~~~l~~~~~~~~~i~~~~~~~~~--~~--------~~~  201 (302)
T d2p4oa1         167 ANGLKRF-----------------------------------GNFLYVSNTEKMLLLRIPVDSTD--KP--------GEP  201 (302)
T ss_dssp             EEEEEEE-----------------------------------TTEEEEEETTTTEEEEEEBCTTS--CB--------CCC
T ss_pred             ccccccc-----------------------------------CCceeeecCCCCeEEeccccccc--cc--------ccc
Confidence            2344332                                   26899999999999999754321  11        011


Q ss_pred             EEeccccCCCCCcceEEcCCCcEEEEccCCCeEEEEeCCCCccccCceeEEeecCCceeecceeEEec---C-CcEEEEE
Q psy11539        448 HYLGSRFKNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFREEGEEEE---E-KENTCTF  523 (530)
Q Consensus       448 ~~lG~rG~~sqs~G~aiD~~G~LYft~~~~~aI~cWnt~~~~~~~~n~~lV~~d~~~L~~Pd~l~Id~---d-G~lYv~~  523 (530)
                      ....+.   ..++|+++|.+|+||++....++|.+++++ +.     ...++.-...+.+|+.++++.   | +.|||+.
T Consensus       202 ~~~~~~---~~pdgia~d~dG~l~va~~~~~~V~~i~p~-G~-----~~~~~~~~~~~~~pt~vafg~~~~D~~~Lyvtt  272 (302)
T d2p4oa1         202 EIFVEQ---TNIDDFAFDVEGNLYGATHIYNSVVRIAPD-RS-----TTIIAQAEQGVIGSTAVAFGQTEGDCTAIYVVT  272 (302)
T ss_dssp             EEEEES---CCCSSEEEBTTCCEEEECBTTCCEEEECTT-CC-----EEEEECGGGTCTTEEEEEECCSTTTTTEEEEEE
T ss_pred             ccccCC---CCCcceEECCCCCEEEEEcCCCcEEEECCC-CC-----EEEEEecCCCCCCceEEEEcCCCCCCCEEEEEC
Confidence            111111   258999999999999999999999999998 63     334554455688999999963   3 3589853
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure