Psyllid ID: psy11559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYRPEMQEKQERVSP
cHHHHHHcccccccEEEccccccHHHHHHHHHHcccEEEEcccccccEEEEEcccccccccccccccEEEEEccccccccccccHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccc
ccHHHHccccccEEEEEccHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccHHHHHHHHHccccEEEEccccccccccccHHHHcccccccHHHHHccccc
msfleasetqrpltirtNTLKTRRRDLAQALVNrgvnldpigkwsKVGLVIYNstvpigatpeylgghyilqgaskywicAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVtcldgrqygkpeeneAVVNYALRkrdvklvptgldfgtegfvnyrqnksyrpemqekqervsp
msfleasetqrpltirtntlktrrRDLAQAlvnrgvnldpigkwsKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIvgnfhrlgvinSVVTCLDgrqygkpeeneavvnyalrkrdvklvptgldfgtegfvnyrqnksyrpemqekqervsp
MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRaaklaaalmkNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYRPEMQEKQERVSP
***********************RRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYR******************
MSFLEA*ETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYRPEMQEKQERVSP
**********RPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYR************
MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYRPEMQEKQERVSP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWICAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNKSYRPEMQEKQERVSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
P46087 812 Putative ribosomal RNA me yes N/A 0.719 0.167 0.598 9e-49
Q922K7 793 Putative ribosomal RNA me yes N/A 0.719 0.171 0.585 1e-47
P40991 618 Putative ribosomal RNA me yes N/A 0.719 0.220 0.572 7e-44
O94268 608 Putative ribosomal RNA me yes N/A 0.708 0.220 0.566 3e-43
Q87PA5 478 Ribosomal RNA small subun yes N/A 0.724 0.286 0.345 2e-14
B7USL2 479 Ribosomal RNA small subun yes N/A 0.740 0.292 0.345 5e-13
Q1RAV2 479 Ribosomal RNA small subun yes N/A 0.740 0.292 0.345 6e-13
A1AC00 479 Ribosomal RNA small subun yes N/A 0.740 0.292 0.345 6e-13
B7MBP2 479 Ribosomal RNA small subun yes N/A 0.740 0.292 0.345 6e-13
Q8FGS9 479 Ribosomal RNA small subun yes N/A 0.740 0.292 0.345 7e-13
>sp|P46087|NOP2_HUMAN Putative ribosomal RNA methyltransferase NOP2 OS=Homo sapiens GN=NOP2 PE=1 SV=2 Back     alignment and function desciption
 Score =  192 bits (489), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 91/152 (59%), Positives = 110/152 (72%), Gaps = 16/152 (10%)

Query: 1   MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGA 60
           + FLEA+E  RP+T+RTNTLKTRRRDLAQAL+NRGVNLDP+GKWSK GLV+Y+S+VPIGA
Sbjct: 298 VEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGA 357

Query: 61  TPEYLGGHYILQGASKY----------------WICAPHRAAKLAAALMKNTGVLFANDV 104
           TPEYL GHY+LQGAS                    CAP       A LMKNTGV+ AND 
Sbjct: 358 TPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDA 417

Query: 105 SKERSKAIVGNFHRLGVINSVVTCLDGRQYGK 136
           + ER K++VGN HRLGV N++++  DGRQ+ K
Sbjct: 418 NAERLKSVVGNLHRLGVTNTIISHYDGRQFPK 449
May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation. May act as ribosomal RNA methyltransferase.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q922K7|NOP2_MOUSE Putative ribosomal RNA methyltransferase NOP2 OS=Mus musculus GN=Nop2 PE=2 SV=1 Back     alignment and function description
>sp|P40991|NOP2_YEAST Putative ribosomal RNA methyltransferase Nop2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP2 PE=1 SV=1 Back     alignment and function description
>sp|O94268|NOP2_SCHPO Putative ribosomal RNA methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.20c PE=1 SV=1 Back     alignment and function description
>sp|Q87PA5|RSMF_VIBPA Ribosomal RNA small subunit methyltransferase F OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rsmF PE=3 SV=1 Back     alignment and function description
>sp|B7USL2|RSMF_ECO27 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rsmF PE=3 SV=1 Back     alignment and function description
>sp|Q1RAV2|RSMF_ECOUT Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmF PE=3 SV=2 Back     alignment and function description
>sp|A1AC00|RSMF_ECOK1 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O1:K1 / APEC GN=rsmF PE=3 SV=2 Back     alignment and function description
>sp|B7MBP2|RSMF_ECO45 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmF PE=3 SV=1 Back     alignment and function description
>sp|Q8FGS9|RSMF_ECOL6 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rsmF PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
91090670 731 PREDICTED: similar to CG8545 CG8545-PA [ 0.719 0.186 0.690 2e-54
357609454 666 hypothetical protein KGM_08224 [Danaus p 0.708 0.201 0.666 2e-51
383851252 596 PREDICTED: putative ribosomal RNA methyl 0.703 0.223 0.664 6e-51
193638967 657 PREDICTED: putative ribosomal RNA methyl 0.703 0.202 0.664 2e-50
328784827 657 PREDICTED: putative ribosomal RNA methyl 0.703 0.202 0.657 3e-50
340726578 602 PREDICTED: putative ribosomal RNA methyl 0.703 0.220 0.657 5e-50
157128943 812 ribosomal RNA small subunit methyltransf 0.708 0.165 0.646 9e-50
345481794 786 PREDICTED: putative ribosomal RNA methyl 0.703 0.169 0.637 9e-50
332018753 677 Putative ribosomal RNA methyltransferase 0.708 0.197 0.62 1e-49
307110087 399 hypothetical protein CHLNCDRAFT_30164, p 0.957 0.453 0.44 1e-49
>gi|91090670|ref|XP_974410.1| PREDICTED: similar to CG8545 CG8545-PA [Tribolium castaneum] gi|270013309|gb|EFA09757.1| hypothetical protein TcasGA2_TC011896 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 118/152 (77%), Gaps = 16/152 (10%)

Query: 1   MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGA 60
           + FLEASE QRPLTIRTN+LKTRRRDLAQAL+NRGVNLDP+GKWSKVGLV+Y+S VPIGA
Sbjct: 254 LEFLEASEVQRPLTIRTNSLKTRRRDLAQALINRGVNLDPVGKWSKVGLVVYSSQVPIGA 313

Query: 61  TPEYLGGHYILQGASKY----------------WICAPHRAAKLAAALMKNTGVLFANDV 104
           TPEYL GHYI+QGAS                     AP   A   AALMKNTGVLFANDV
Sbjct: 314 TPEYLAGHYIIQGASSLLPVMALAPQENERILDMAAAPGGKASHIAALMKNTGVLFANDV 373

Query: 105 SKERSKAIVGNFHRLGVINSVVTCLDGRQYGK 136
           + ER KAIVGNFHRLGV+NSV+TC+DGR++ K
Sbjct: 374 NSERIKAIVGNFHRLGVVNSVITCVDGRKFPK 405

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357609454|gb|EHJ66457.1| hypothetical protein KGM_08224 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383851252|ref|XP_003701148.1| PREDICTED: putative ribosomal RNA methyltransferase nop2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193638967|ref|XP_001943714.1| PREDICTED: putative ribosomal RNA methyltransferase NOP2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328784827|ref|XP_001121968.2| PREDICTED: putative ribosomal RNA methyltransferase NOP2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340726578|ref|XP_003401633.1| PREDICTED: putative ribosomal RNA methyltransferase NOP2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|157128943|ref|XP_001661560.1| ribosomal RNA small subunit methyltransferase b (sun) [Aedes aegypti] gi|108872435|gb|EAT36660.1| AAEL011282-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|345481794|ref|XP_001604770.2| PREDICTED: putative ribosomal RNA methyltransferase NOP2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332018753|gb|EGI59318.1| Putative ribosomal RNA methyltransferase NOP2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307110087|gb|EFN58324.1| hypothetical protein CHLNCDRAFT_30164, partial [Chlorella variabilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn0033741 891 CG8545 [Drosophila melanogaste 0.708 0.150 0.593 1.3e-53
UNIPROTKB|F1NH85549 Gga.5513 "Uncharacterized prot 0.719 0.247 0.585 2.9e-52
RGD|1304616 772 Nop2 "NOP2 nucleolar protein" 0.719 0.176 0.578 3e-52
UNIPROTKB|P46087 812 NOP2 "Putative ribosomal RNA m 0.719 0.167 0.572 3.4e-52
UNIPROTKB|F1N3G2 820 NOP2 "Uncharacterized protein" 0.719 0.165 0.572 3.6e-52
UNIPROTKB|F1SLR6 821 NOP2 "Uncharacterized protein" 0.719 0.165 0.572 3.7e-52
ZFIN|ZDB-GENE-050309-7 739 nop2 "NOP2 nucleolar protein h 0.719 0.184 0.578 5.9e-52
UNIPROTKB|E2RCH6 826 NOP2 "Uncharacterized protein" 0.719 0.164 0.565 1.7e-51
UNIPROTKB|F1NK16 722 Gga.5513 "Uncharacterized prot 0.719 0.188 0.585 4.9e-51
MGI|MGI:107891 793 Nop2 "NOP2 nucleolar protein" 0.719 0.171 0.559 1.2e-50
FB|FBgn0033741 CG8545 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 1.3e-53, Sum P(2) = 1.3e-53
 Identities = 89/150 (59%), Positives = 108/150 (72%)

Query:     1 MSFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGA 60
             M +LEASE  RPLTIRTNTLKTRRRDLA AL+NRGVNLDP+GKW+KVGLV++NS VP+GA
Sbjct:   349 MEYLEASEIARPLTIRTNTLKTRRRDLAGALINRGVNLDPLGKWTKVGLVVFNSQVPLGA 408

Query:    61 TPEYLGGHYILQGASKYW---------------IC-APHRXXXXXXXXXXNTGVLFANDV 104
             TPEYL GHY++QGAS                  +C AP            NTGVLFAND 
Sbjct:   409 TPEYLAGHYMIQGASSLLPVMALAPQENERILDMCSAPGGKGSHIASIMKNTGVLFANDS 468

Query:   105 SKERSKAIVGNFHRLGVINSVVTCLDGRQY 134
             +++R KAIV NFHRLG++N+VV+C DG ++
Sbjct:   469 NRDRIKAIVANFHRLGIVNAVVSCEDGTKF 498
GO:0005730 "nucleolus" evidence=ISS
GO:0006364 "rRNA processing" evidence=ISS
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
UNIPROTKB|F1NH85 Gga.5513 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1304616 Nop2 "NOP2 nucleolar protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46087 NOP2 "Putative ribosomal RNA methyltransferase NOP2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3G2 NOP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLR6 NOP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050309-7 nop2 "NOP2 nucleolar protein homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCH6 NOP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK16 Gga.5513 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:107891 Nop2 "NOP2 nucleolar protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q922K7NOP2_MOUSE2, ., 1, ., 1, ., -0.58550.71950.1715yesN/A
P46087NOP2_HUMAN2, ., 1, ., 1, ., -0.59860.71950.1674yesN/A
O94268NOP2_SCHPO2, ., 1, ., 1, ., -0.56660.70890.2203yesN/A
P40991NOP2_YEAST2, ., 1, ., 1, ., -0.57230.71950.2200yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 2e-34
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 4e-34
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 6e-20
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 2e-15
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 5e-09
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 5e-08
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 2e-06
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 3e-04
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information 
 Score =  121 bits (306), Expect = 2e-34
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 18/138 (13%)

Query: 15  IRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGA 74
           IR NTLK    DL + L NRGV L+P  +       +  S   IG+TPEYL G+Y  Q A
Sbjct: 1   IRVNTLKINVEDLLERLENRGVVLEPTCEEYFFE--VKESPFSIGSTPEYLFGYYYPQEA 58

Query: 75  SKYW---------------ICA-PHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHR 118
           S                  + A P       + LMKN G + AN++SK R+KA++ N +R
Sbjct: 59  SSMIPPIALEPREDERVLDMAAAPGGKTTQISQLMKNKGCIVANEISKSRTKALISNINR 118

Query: 119 LGVINSVVTCLDGRQYGK 136
           +GV+N++V   DGR++G 
Sbjct: 119 MGVLNTIVINADGRKFGA 136

[Protein synthesis, tRNA and rRNA base modification]. Length = 264
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 100.0
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 100.0
KOG1122|consensus460 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 100.0
PRK14903431 16S rRNA methyltransferase B; Provisional 100.0
PRK14901434 16S rRNA methyltransferase B; Provisional 99.97
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.96
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.96
PRK14902444 16S rRNA methyltransferase B; Provisional 99.96
PRK10901427 16S rRNA methyltransferase B; Provisional 99.95
PRK14904445 16S rRNA methyltransferase B; Provisional 99.94
KOG2360|consensus413 99.87
KOG2198|consensus375 99.73
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.22
PTZ00146293 fibrillarin; Provisional 97.39
COG4076252 Predicted RNA methylase [General function predicti 97.34
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.28
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.25
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.17
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.11
PRK04266226 fibrillarin; Provisional 96.93
PRK07402196 precorrin-6B methylase; Provisional 96.89
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.89
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.88
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 96.88
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.64
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.61
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.59
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 96.57
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 96.56
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 96.54
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.5
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 96.47
PLN02476278 O-methyltransferase 96.38
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 96.28
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 96.23
COG4122219 Predicted O-methyltransferase [General function pr 96.2
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.15
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 96.12
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.07
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.04
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 95.95
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 95.9
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 95.87
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 95.79
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 95.49
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 95.45
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 95.35
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 95.35
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.31
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 94.87
PLN02589247 caffeoyl-CoA O-methyltransferase 94.87
PRK14967223 putative methyltransferase; Provisional 94.86
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 94.82
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 94.78
KOG2730|consensus263 94.77
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 94.73
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 94.73
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 94.68
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 94.48
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 94.28
TIGR00438188 rrmJ cell division protein FtsJ. 94.11
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 94.05
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.99
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 93.88
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 93.87
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 93.85
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 93.78
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 93.74
PLN02233261 ubiquinone biosynthesis methyltransferase 93.73
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 93.55
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 93.23
TIGR00740239 methyltransferase, putative. A simple BLAST search 93.22
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 93.14
smart00650169 rADc Ribosomal RNA adenine dimethylases. 93.11
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 93.08
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 93.04
TIGR00536284 hemK_fam HemK family putative methylases. The gene 92.91
PRK08317 241 hypothetical protein; Provisional 92.65
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 92.62
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 92.6
PRK14968188 putative methyltransferase; Provisional 92.42
KOG2904|consensus328 92.34
COG2263198 Predicted RNA methylase [Translation, ribosomal st 92.31
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 92.27
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 92.16
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 92.08
PLN02244 340 tocopherol O-methyltransferase 92.07
PRK11207197 tellurite resistance protein TehB; Provisional 91.96
PLN03075296 nicotianamine synthase; Provisional 91.85
KOG2915|consensus314 91.84
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 91.74
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 91.47
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 91.16
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 91.15
COG2520341 Predicted methyltransferase [General function pred 90.94
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 90.92
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 90.78
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 90.65
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 90.62
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 90.56
TIGR03438 301 probable methyltransferase. This model represents 90.54
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 90.42
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 89.67
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 89.64
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 89.62
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 89.56
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 89.28
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 88.73
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 88.71
PRK12335287 tellurite resistance protein TehB; Provisional 88.47
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 88.28
KOG1540|consensus296 88.06
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 87.91
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 87.63
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 87.47
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 86.94
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 86.31
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 86.14
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 85.92
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 85.48
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 85.17
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 84.95
COG2265432 TrmA SAM-dependent methyltransferases related to t 84.65
COG1568354 Predicted methyltransferases [General function pre 84.31
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 83.97
COG1092393 Predicted SAM-dependent methyltransferases [Genera 83.81
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 83.54
COG2890280 HemK Methylase of polypeptide chain release factor 82.96
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 82.84
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 82.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 81.92
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 81.55
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 81.53
KOG1596|consensus317 81.12
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 80.99
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information 
Probab=100.00  E-value=1.5e-39  Score=272.10  Aligned_cols=181  Identities=36%  Similarity=0.528  Sum_probs=156.9

Q ss_pred             hHHHhCCCCCeEEEEcCCCCCHHHHHHHHHHCCCeeeecCCCCCceEEE-EccCCCCCCChhhccCceeeeCccchhh--
Q psy11559          3 FLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVI-YNSTVPIGATPEYLGGHYILQGASKYWI--   79 (189)
Q Consensus         3 ~l~~~~~~~p~~lRvN~~k~~~~~~~~~L~~~g~~~~~~~~~~p~~~~~-~~~~~~~~~~~~~~~G~~~vQD~sS~l~--   79 (189)
                      ||+++|.++|+++|||++|++++++.+.|++.|+.++++ ++.++.+.+ .....++..++.|++|+|++||.|||++  
T Consensus         1 il~~~n~~~~~~iRvN~~k~~~~~~~~~L~~~g~~~~~~-~~~~~~~~~~~~~~~~i~~l~~~~~G~~~vQd~sS~l~~~   79 (283)
T PF01189_consen    1 ILEANNCPPPVTIRVNTLKISREELLEELEEEGIQLEPI-PRSPDALRVIGKSPYSICSLPEFKNGLFYVQDESSQLVAL   79 (283)
T ss_dssp             HHHHCTS--GEEEEE-TTTSSHHHHHHHHHHTTHEEEEE-TSTTCEEEEEEECSSCGGGSHHHHTTSEEEHHHHHHHHHH
T ss_pred             CccccCCCCCeEEEECcCcCCHHHHHHHHhhcccceEEc-ccccchhccccccccchhhchhhhCCcEEecccccccccc
Confidence            689999999999999999999999999999999999986 788888432 2234678899999999999999999998  


Q ss_pred             --------------cCCchHHHHHHHhcCCCcEEEEEcCChHHHHHHHHHHHHhCCCeEEEEcCCCCCCCC---------
Q psy11559         80 --------------CAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGK---------  136 (189)
Q Consensus        80 --------------AAPGgKT~~la~~~~~~g~v~A~D~~~~Rl~~l~~~l~r~g~~nv~~~~~Da~~~~~---------  136 (189)
                                    |||||||+|||++|.++|.|+|+|++.+|++.|++|++|+|+.++.++..|++.+..         
T Consensus        80 ~L~~~~~~~VLD~CAapGgKt~~la~~~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~v~~~~~D~~~~~~~~~~~~fd~  159 (283)
T PF01189_consen   80 ALDPQPGERVLDMCAAPGGKTTHLAELMGNKGEIVANDISPKRLKRLKENLKRLGVFNVIVINADARKLDPKKPESKFDR  159 (283)
T ss_dssp             HHTTTTTSEEEESSCTTSHHHHHHHHHTTTTSEEEEEESSHHHHHHHHHHHHHTT-SSEEEEESHHHHHHHHHHTTTEEE
T ss_pred             cccccccccccccccCCCCceeeeeecccchhHHHHhccCHHHHHHHHHHHHhcCCceEEEEeeccccccccccccccch
Confidence                          999999999999999999999999999999999999999999999999888876521         


Q ss_pred             ----------------------------------------------------------------CCCcHHHHHHHHhhC-
Q psy11559        137 ----------------------------------------------------------------PEENEAVVNYALRKR-  151 (189)
Q Consensus       137 ----------------------------------------------------------------~eENE~vV~~~L~~~-  151 (189)
                                                                                      |+|||+||++||++| 
T Consensus       160 VlvDaPCSg~G~i~r~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~~~~~~k~gG~lvYsTCS~~~eENE~vV~~fl~~~~  239 (283)
T PF01189_consen  160 VLVDAPCSGLGTIRRNPDIKWRRSPEDIEKLAELQREILDNAAKLLNIDFKPGGRLVYSTCSLSPEENEEVVEKFLKRHP  239 (283)
T ss_dssp             EEEECSCCCGGGTTTCTTHHHHE-TTHHHHHHHHHHHHHHHHHHCEHHHBEEEEEEEEEESHHHGGGTHHHHHHHHHHST
T ss_pred             hhcCCCccchhhhhhccchhhcccccccchHHHHHHHHHHHHHHhhcccccCCCeEEEEeccHHHHHHHHHHHHHHHhCC
Confidence                                                                            999999999999999 


Q ss_pred             CcEEEecCCCCCCCCccCC---CcceeeCccccccc
Q psy11559        152 DVKLVPTGLDFGTEGFVNY---RQNKSYRPEMQEKQ  184 (189)
Q Consensus       152 ~~~l~~~~~~~~~~g~~~~---~~~~~~~p~~~~~~  184 (189)
                      +++++++....+.+|+..|   .+++|++||...+-
T Consensus       240 ~~~l~~~~~~~~~~~~~~~~~~~~~~r~~P~~~~~d  275 (283)
T PF01189_consen  240 DFELVPIPLPEPPPGFKSYPIGEGCLRILPHRHGTD  275 (283)
T ss_dssp             SEEEECCESSTCEEESSGGCTGGGSEEESTTTSSSS
T ss_pred             CcEEEeccccccccccccccCCCCEEEeCCCCCCCC
Confidence            9999998877666666544   46789999987654

In the archaea and bacteria, they are annotated as putative nucleolar protein, Sun (Fmu) family protein or tRNA/rRNA cytosine-C5-methylase. The majority have the S-adenosyl methionine (SAM) binding domain and are related to Escherichia coli Fmu (Sun) protein (16S rRNA m5C 967 methyltransferase) whose structure has been determined []. In the eukaryota, the majority are annotated as being 'hypothetical protein', nucleolar protein or the Nop2/Sun (Fmu) family. Unlike their bacterial homologues, few of the eukaryotic members in this family have a the SAM binding signature. Despite this, Saccharomyces cerevisiae (Baker's yeast) Nop2p is a probable RNA m5C methyltransferase []. It is essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis []; localized to the nucleolus and is essential for viability []. Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing []. There is substantial identity between Nop2p and Homo sapiens (Human) p120 (NOL1), which is also called the proliferation-associated nucleolar antigen [, ].; PDB: 3M4X_A 2FRX_B 2YXL_A 1IXK_A 1SQG_A 1SQF_A 3M6U_B 3M6V_B 3M6W_A 3M6X_A ....
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2frx_A 479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 3e-11
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 5e-11
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 7e-09
>pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 70/167 (41%), Gaps = 28/167 (16%)
Query: 3   FLEASETQRPL--TIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIY---NSTVP 57
           FL A   QRPL  +IR NTLK    D  Q     G  L PI  W + G  I       +P
Sbjct: 29  FLAA--CQRPLRRSIRVNTLKISVADFLQLTAPYGWTLTPI-PWCEEGFWIERDNEDALP 85
Query: 58  IGATPEYLGGHYILQGASKYW------------------ICAPHRXXXXXXXXXXNTGVL 99
           +G+T E+L G + +Q AS                       AP            N G +
Sbjct: 86  LGSTAEHLSGLFYIQEASSXLPVAALFADGNAPQRVXDVAAAPGSKTTQISARXNNEGAI 145
Query: 100 FANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGK--PEENEAVV 144
            AN+ S  R K +  N  R G+ N  +T  DGR +G   PE  +A++
Sbjct: 146 LANEFSASRVKVLHANISRCGISNVALTHFDGRVFGAAVPEXFDAIL 192
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 5e-50
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 3e-08
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 1e-47
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 7e-05
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 4e-46
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 2e-05
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 7e-41
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 8e-07
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 2e-40
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 5e-06
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 4e-40
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 5e-07
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 2e-16
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 5e-12
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
 Score =  163 bits (414), Expect = 5e-50
 Identities = 45/150 (30%), Positives = 65/150 (43%), Gaps = 17/150 (11%)

Query: 3   FLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATP 62
             EA E   P   R NTLK   +DL + L  +G     +  W+K G  +      I +TP
Sbjct: 35  IAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRV-PWAKEGFCLTREPFSITSTP 93

Query: 63  EYLGGHYILQGASKYWIC---APHRAAK---LAAA----------LMKNTGVLFANDVSK 106
           E+L G   +Q AS  +      P        +AAA          LM+N GV++A DV +
Sbjct: 94  EFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDE 153

Query: 107 ERSKAIVGNFHRLGVINSVVTCLDGRQYGK 136
            R +    N  RLGV+N ++        G+
Sbjct: 154 NRLRETRLNLSRLGVLNVILFHSSSLHIGE 183
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 100.0
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 100.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.97
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.97
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.97
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.97
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.96
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.95
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 99.93
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.74
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.22
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.16
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.39
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.36
3k6r_A278 Putative transferase PH0793; structural genomics, 97.35
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.33
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.31
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.31
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.29
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.28
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.27
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.2
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.19
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.18
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.18
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.08
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.07
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.96
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.87
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 96.87
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.85
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 96.84
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.81
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.77
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.77
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 96.77
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.76
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 96.76
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.75
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.75
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.75
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.75
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.7
2b3t_A276 Protein methyltransferase HEMK; translation termin 96.7
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.66
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.62
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.6
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.59
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.57
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 96.56
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.55
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 96.55
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 96.5
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 96.49
2qm3_A373 Predicted methyltransferase; putative methyltransf 96.48
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.46
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 96.45
3dh0_A219 SAM dependent methyltransferase; cystal structure, 96.45
3lpm_A259 Putative methyltransferase; structural genomics, p 96.42
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.39
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.39
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.39
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.38
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.37
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.37
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.36
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.34
2frn_A278 Hypothetical protein PH0793; structural genomics, 96.34
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.29
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 96.29
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 96.27
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.23
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 96.22
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.2
2b25_A 336 Hypothetical protein; structural genomics, methyl 96.18
3ll7_A 410 Putative methyltransferase; methytransferase, stru 96.08
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.06
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 96.05
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 95.89
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.89
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 95.85
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 95.83
3f4k_A257 Putative methyltransferase; structural genomics, P 95.81
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 95.8
3cvo_A202 Methyltransferase-like protein of unknown functio; 95.75
2fpo_A202 Methylase YHHF; structural genomics, putative meth 95.75
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 95.71
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 95.71
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 95.7
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.66
1xxl_A 239 YCGJ protein; structural genomics, protein structu 95.66
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 95.59
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 95.39
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 95.34
2esr_A177 Methyltransferase; structural genomics, hypothetic 95.3
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 95.29
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.21
2h00_A254 Methyltransferase 10 domain containing protein; st 95.19
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 95.12
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 95.12
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 95.09
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 95.04
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 94.97
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 94.96
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 94.95
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 94.89
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 94.73
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 94.69
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 94.59
1ws6_A171 Methyltransferase; structural genomics, riken stru 94.59
2b78_A385 Hypothetical protein SMU.776; structure genomics, 94.55
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 94.54
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 94.38
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 94.34
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 94.32
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 94.15
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 93.99
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 93.98
3ocj_A305 Putative exported protein; structural genomics, PS 93.95
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 93.93
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 93.91
1wzn_A252 SAM-dependent methyltransferase; structural genomi 93.84
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 93.83
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 93.79
3m70_A286 Tellurite resistance protein TEHB homolog; structu 93.75
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 93.73
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 93.68
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 93.66
2kw5_A202 SLR1183 protein; structural genomics, northeast st 93.63
3dtn_A234 Putative methyltransferase MM_2633; structural gen 93.46
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 93.42
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 93.31
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 93.21
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 93.2
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 93.0
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 92.93
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 92.86
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 92.76
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 92.68
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 92.61
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 92.53
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 92.46
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 92.41
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 92.17
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 92.14
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 91.87
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 91.71
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 91.7
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 91.41
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 91.41
1ne2_A200 Hypothetical protein TA1320; structural genomics, 91.3
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 91.25
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 91.22
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 91.14
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 91.06
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 90.94
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 90.92
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 90.86
3fut_A271 Dimethyladenosine transferase; methyltransferase, 90.85
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 90.59
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 90.58
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 90.48
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 90.47
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 90.31
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 89.75
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 89.68
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 89.68
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 89.67
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 89.62
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 89.6
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 89.33
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 89.27
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 89.15
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 89.14
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 88.99
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 88.96
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 88.64
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 88.55
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 88.5
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 88.47
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 88.4
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 88.32
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 88.28
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 87.97
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 87.87
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 87.86
3hnr_A220 Probable methyltransferase BT9727_4108; structural 87.53
3m33_A226 Uncharacterized protein; structural genomics, PSI- 87.46
3lcc_A235 Putative methyl chloride transferase; halide methy 86.91
2r3s_A335 Uncharacterized protein; methyltransferase domain, 86.89
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 86.87
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 86.83
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 86.67
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 86.37
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 86.12
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 85.55
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 85.43
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 85.19
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 85.15
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 85.14
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 84.74
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 84.3
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 83.83
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 83.76
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 83.72
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 83.6
1xj5_A334 Spermidine synthase 1; structural genomics, protei 83.16
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 82.91
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 82.59
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 81.88
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 81.75
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 81.55
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 81.31
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 81.21
3giw_A277 Protein of unknown function DUF574; rossmann-fold 80.85
2i7c_A283 Spermidine synthase; transferase, structural genom 80.66
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
Probab=100.00  E-value=6.8e-32  Score=227.22  Aligned_cols=175  Identities=27%  Similarity=0.325  Sum_probs=147.0

Q ss_pred             hCCCCCeEEEEcCCCCCHHHHHHHHHHCCCeeeecCCC------------------CCceEEEEccCCCCCCChhhccCc
Q psy11559          7 SETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKW------------------SKVGLVIYNSTVPIGATPEYLGGH   68 (189)
Q Consensus         7 ~~~~~p~~lRvN~~k~~~~~~~~~L~~~g~~~~~~~~~------------------~p~~~~~~~~~~~~~~~~~~~~G~   68 (189)
                      .+.++|+++|||++|++++++++.|++.|+.+++. +|                  +|+++.+.. ...+..+++|++|+
T Consensus         6 ~~~~~p~~lRvN~lk~~~~~~~~~L~~~g~~~~~~-~~~~~~~~~~~~~~~~~~~~~p~~l~~~~-~~~~~~~~~~~~G~   83 (309)
T 2b9e_A            6 PASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGR-ASSLDDLRALKGKHFLLDPLMPELLVFPA-QTDLHEHPLYRAGH   83 (309)
T ss_dssp             ---CCCEEEEECTTTCCHHHHHHHHHHTTCEEEEE-CSSHHHHHTCCTTEEEECSSSTTEEEECT-TCCCTTSHHHHTTS
T ss_pred             CCCCCCeEEEEeCCCCCHHHHHHHHHhCCCeeeec-cccccccccccccccccccCCCceEEeCC-CCCcccChHHHCCe
Confidence            34688999999999999999999999999988774 44                  456666653 35788999999999


Q ss_pred             eeeeCccchhh----------------cCCchHHHHHHHhcCCCcEEEEEcCChHHHHHHHHHHHHhCCCeEEEEcCCCC
Q psy11559         69 YILQGASKYWI----------------CAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGR  132 (189)
Q Consensus        69 ~~vQD~sS~l~----------------AAPGgKT~~la~~~~~~g~v~A~D~~~~Rl~~l~~~l~r~g~~nv~~~~~Da~  132 (189)
                      +++||.+||++                |||||||++||++|+++|.|+|+|+++.|++.+++|++|+|+.||.++..|+.
T Consensus        84 ~~~Qd~~s~l~~~~l~~~~g~~VLDlcaG~G~kt~~la~~~~~~g~V~a~D~~~~~l~~~~~n~~r~g~~~v~~~~~D~~  163 (309)
T 2b9e_A           84 LILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFL  163 (309)
T ss_dssp             EEECCTGGGHHHHHHCCCTTCEEEESSCTTCHHHHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCGG
T ss_pred             EEEECHHHHHHHHHhCCCCCCEEEEeCCChhHHHHHHHHHhCCCCEEEEEeCCHHHHHHHHHHHHHcCCCeEEEEeCChH
Confidence            99999999997                99999999999999888999999999999999999999999999999988875


Q ss_pred             CCC-------C----------------------------------------------------------------CCCcH
Q psy11559        133 QYG-------K----------------------------------------------------------------PEENE  141 (189)
Q Consensus       133 ~~~-------~----------------------------------------------------------------~eENE  141 (189)
                      .+.       .                                                                ++|||
T Consensus       164 ~~~~~~~~~~~fD~Vl~D~PcSg~G~~~r~pd~~~~~~~~~~~~~~l~~~Q~~iL~~a~~~l~gG~lvYsTCs~~~~Ene  243 (309)
T 2b9e_A          164 AVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENE  243 (309)
T ss_dssp             GSCTTCGGGTTEEEEEECCCCCC------------------CCHHHHHHHHHHHHHHHTTCTTCCEEEEEESCCCGGGTH
T ss_pred             hcCccccccCCCCEEEEcCCcCCCCCCccCCChhhhccCCHHHHHHHHHHHHHHHHHHHhccCCCEEEEECCCCChHHhH
Confidence            431       0                                                                89999


Q ss_pred             HHHHHHHhhC-C-cEEEecCCCCCCCCccCC---CcceeeCcccccc
Q psy11559        142 AVVNYALRKR-D-VKLVPTGLDFGTEGFVNY---RQNKSYRPEMQEK  183 (189)
Q Consensus       142 ~vV~~~L~~~-~-~~l~~~~~~~~~~g~~~~---~~~~~~~p~~~~~  183 (189)
                      +||.+||++| + |+++++...|...|+..+   .+++|++|+...+
T Consensus       244 ~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~P~~~~~  290 (309)
T 2b9e_A          244 DVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLS  290 (309)
T ss_dssp             HHHHHHHTTSTTTEEECCCCTTCCCBCCSSSTTGGGSEEECHHHHSS
T ss_pred             HHHHHHHHhCCCcEEEeccccccccccccccCCCCCeEEECCCCCCC
Confidence            9999999999 7 999987655655555443   4678999986554
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 5e-17
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 3e-04
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 2e-16
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 0.001
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 1e-11
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 5e-04
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 75.1 bits (183), Expect = 5e-17
 Identities = 42/153 (27%), Positives = 61/153 (39%), Gaps = 17/153 (11%)

Query: 3   FLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATP 62
             EA E   P   R NTLK   +DL + L  +G     +  W+K G  +      I +TP
Sbjct: 33  IAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRV-PWAKEGFCLTREPFSITSTP 91

Query: 63  EYLGGHYILQGASKYWICAPHRA----------------AKLAAALMKNTGVLFANDVSK 106
           E+L G   +Q AS  +                           A LM+N GV++A DV +
Sbjct: 92  EFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDE 151

Query: 107 ERSKAIVGNFHRLGVINSVVTCLDGRQYGKPEE 139
            R +    N  RLGV+N ++        G+   
Sbjct: 152 NRLRETRLNLSRLGVLNVILFHSSSLHIGELNV 184
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 100.0
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 100.0
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.09
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.0
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.9
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.75
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 97.64
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.54
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.49
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 97.46
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.34
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.2
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.11
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 96.99
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.89
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.83
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.57
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 96.33
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.32
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 96.16
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.15
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.79
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 95.59
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 95.58
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 95.51
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 95.39
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 95.25
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.01
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 94.77
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 94.63
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 94.13
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 94.07
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 93.98
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 93.69
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 93.68
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 93.65
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 93.6
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 93.5
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.49
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 93.26
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 93.25
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 92.96
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 92.56
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 90.58
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 90.57
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 90.39
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 89.86
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 89.23
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 88.0
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 87.33
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 86.58
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 86.18
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 85.43
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 84.85
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 84.51
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 84.4
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 83.92
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 82.35
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 81.06
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=3.3e-40  Score=276.37  Aligned_cols=180  Identities=33%  Similarity=0.544  Sum_probs=158.4

Q ss_pred             hhHHHhCCCCCeEEEEcCCCCCHHHHHHHHHHCCCeeeecCCCCCceEEEEccCCCCCCChhhccCceeeeCccchhh--
Q psy11559          2 SFLEASETQRPLTIRTNTLKTRRRDLAQALVNRGVNLDPIGKWSKVGLVIYNSTVPIGATPEYLGGHYILQGASKYWI--   79 (189)
Q Consensus         2 ~~l~~~~~~~p~~lRvN~~k~~~~~~~~~L~~~g~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~G~~~vQD~sS~l~--   79 (189)
                      +|++++++|+|+|+|||++|++++++++.|++.|+.++++ +|+|+++.+......+..+++|++|++++||.|||++  
T Consensus        32 ~l~~a~~~~~p~~iRvN~~k~~~e~~~~~L~~~g~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~G~~~vQD~aS~l~~~  110 (313)
T d1ixka_          32 RIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRV-PWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPV  110 (313)
T ss_dssp             HHHHHTTSCCCCEEEECTTTSCHHHHHHHHHHTTCEEEEE-TTEEEEEEEEECSSCGGGSHHHHTTSEEECCHHHHHHHH
T ss_pred             HHHHHcCCCCCeEEEEcCCcCCHHHHHHHHHhCCCceEEC-CCCcchhhhccCCCccccCHhhhhceEEEecccccchhh
Confidence            6899999999999999999999999999999999999996 9999999887645678999999999999999999998  


Q ss_pred             --------------cCCchHHHHHHHhcCCCcEEEEEcCChHHHHHHHHHHHHhCCCeEEEEcCCCCCCCC---------
Q psy11559         80 --------------CAPHRAAKLAAALMKNTGVLFANDVSKERSKAIVGNFHRLGVINSVVTCLDGRQYGK---------  136 (189)
Q Consensus        80 --------------AAPGgKT~~la~~~~~~g~v~A~D~~~~Rl~~l~~~l~r~g~~nv~~~~~Da~~~~~---------  136 (189)
                                    |||||||+||+++|.++|.|+|+|++++|++.++++++|+|+.|+.++..|++.++.         
T Consensus       111 ~l~~~~g~~vlD~CAapGgKt~~l~~~~~~~~~i~a~d~~~~r~~~l~~~~~r~~~~~i~~~~~d~~~~~~~~~~fD~IL  190 (313)
T d1ixka_         111 ALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKIL  190 (313)
T ss_dssp             HHCCCTTCEEEECCSSCSHHHHHHHHHTTTCSEEEEECSCHHHHHHHHHHHHHHTCCSEEEESSCGGGGGGGCCCEEEEE
T ss_pred             cccCCccceeeecccchhhhhHhhhhhcccccceeeeccCHHHHHHHHHHHHHHHhhccccccccccccccccccccEEE
Confidence                          999999999999999999999999999999999999999999999999999876532         


Q ss_pred             ----------------------------------------------------------CCCcHHHHHHHHhhCCcEEEec
Q psy11559        137 ----------------------------------------------------------PEENEAVVNYALRKRDVKLVPT  158 (189)
Q Consensus       137 ----------------------------------------------------------~eENE~vV~~~L~~~~~~l~~~  158 (189)
                                                                                |+|||+||++||++++++++++
T Consensus       191 vDaPCSg~G~~~r~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lVYsTCSl~~eENE~VV~~~L~~~~~~~~~~  270 (313)
T d1ixka_         191 LDAPCTGSGTIHKNPERKWNRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPL  270 (313)
T ss_dssp             EECCTTSTTTCC--------CCHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEESCCCGGGTHHHHHHHHHHSSEEEECC
T ss_pred             EccccccCCceeeccchhhhhhhhHHHHHHHHHHHHHHhhhheeCCCcEEEEeeccCChHhHHHHHHHHHhcCCCEEeec
Confidence                                                                      9999999999999999999886


Q ss_pred             CCCCCCCCccCC---------CcceeeCccccccc
Q psy11559        159 GLDFGTEGFVNY---------RQNKSYRPEMQEKQ  184 (189)
Q Consensus       159 ~~~~~~~g~~~~---------~~~~~~~p~~~~~~  184 (189)
                      ..  +.|++..+         ++++|++|+...|-
T Consensus       271 ~~--~~~~~~~~~~~~~~~~~~~~~r~~P~~~~~d  303 (313)
T d1ixka_         271 KY--GEPALTNPFGIELSEEIKNARRLYPDVHETS  303 (313)
T ss_dssp             CS--SEECCSSGGGCCCCGGGGGSEEECTTTSSSC
T ss_pred             cc--CCccccCccccccccccCCcEEECCCCCCcc
Confidence            53  23333332         34567777766553
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure