Psyllid ID: psy11676

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
GNQAIRSLQTAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSPKDHSRSNHFDSENPKTNIYTHIILMFVDSQ
ccHHHHHHHHHHHHHcccccccHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccHHHHHcHHHHcccccccccHHHHHccHHHHHHHHHHHHcccccccccEEEEccccc
cccccccccccHHHcccccHHHHHHHHccEEEEEEccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccc
GNQAIRSLQTAERRRvtsfsdrgqLKYARRLVVKLGSAvitredehglALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMretlspkdhsrsnhfdsenpktniyTHIILMFVDSQ
gnqairslqtaerrrvtsfsdrgqlkyarrLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMREtlspkdhsrsnhfdsenpktniyTHIILMFVDSQ
GNQAIRSLQTAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSPKDHSRSNHFDSENPKTNIYTHIILMFVDSQ
**********************GQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELL***************************NIYTHIILMFV***
*************************KYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLA*************SPKDHSRSNHFDSENPKTNIYTHIILMFV***
GNQAIRSLQTAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMRE************FDSENPKTNIYTHIILMFVDSQ
******************FSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLS********HFDSENPKTNIYTHIILMFVD**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GNQAIRSLQTAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSPKDHSRSNHFDSENPKTNIYTHIILMFVDSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
P54889 800 Probable delta-1-pyrrolin yes N/A 0.687 0.112 0.655 4e-25
Q9Z110 795 Delta-1-pyrroline-5-carbo yes N/A 0.671 0.110 0.619 8e-24
Q5R4M8 795 Delta-1-pyrroline-5-carbo yes N/A 0.679 0.111 0.612 3e-23
P54886 795 Delta-1-pyrroline-5-carbo yes N/A 0.679 0.111 0.612 3e-23
Q96480 717 Delta-1-pyrroline-5-carbo N/A N/A 0.625 0.114 0.445 1e-11
O04015 717 Delta-1-pyrroline-5-carbo N/A N/A 0.625 0.114 0.421 9e-11
P54888 726 Delta-1-pyrroline-5-carbo yes N/A 0.610 0.110 0.432 1e-09
O04226 716 Delta-1-pyrroline-5-carbo no N/A 0.610 0.111 0.395 2e-09
P32296 671 Delta-1-pyrroline-5-carbo N/A N/A 0.610 0.119 0.382 2e-09
P54887 717 Delta-1-pyrroline-5-carbo no N/A 0.557 0.101 0.432 4e-09
>sp|P54889|ALH13_CAEEL Probable delta-1-pyrroline-5-carboxylate synthase OS=Caenorhabditis elegans GN=alh-13 PE=2 SV=1 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 73/90 (81%)

Query: 10  TAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRE 69
           T  R++    + R  LK A+R+VVKLGSAVITREDE GLALGRLASIVEQV+E    GR+
Sbjct: 61  TKTRQKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQ 120

Query: 70  CIMVTSGAVAFGKQKLAQELLMSLSMRETL 99
            ++V+SGAVAFG+QKL QEL+MS+SMR+TL
Sbjct: 121 MLIVSSGAVAFGRQKLRQELVMSMSMRQTL 150

Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q9Z110|P5CS_MOUSE Delta-1-pyrroline-5-carboxylate synthase OS=Mus musculus GN=Aldh18a1 PE=2 SV=2 Back     alignment and function description
>sp|Q5R4M8|P5CS_PONAB Delta-1-pyrroline-5-carboxylate synthase OS=Pongo abelii GN=ALDH18A1 PE=2 SV=1 Back     alignment and function description
>sp|P54886|P5CS_HUMAN Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens GN=ALDH18A1 PE=1 SV=2 Back     alignment and function description
>sp|Q96480|P5CS_SOLLC Delta-1-pyrroline-5-carboxylate synthase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1 Back     alignment and function description
>sp|O04015|P5CS_ACTDE Delta-1-pyrroline-5-carboxylate synthase OS=Actinidia deliciosa PE=2 SV=1 Back     alignment and function description
>sp|P54888|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1 Back     alignment and function description
>sp|O04226|P5CS_ORYSJ Delta-1-pyrroline-5-carboxylate synthase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2 Back     alignment and function description
>sp|P32296|P5CS_VIGAC Delta-1-pyrroline-5-carboxylate synthase OS=Vigna aconitifolia PE=2 SV=1 Back     alignment and function description
>sp|P54887|P5CS1_ARATH Delta-1-pyrroline-5-carboxylate synthase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
156538301 786 PREDICTED: delta-1-pyrroline-5-carboxyla 0.770 0.128 0.871 7e-43
193657053 795 PREDICTED: delta-1-pyrroline-5-carboxyla 0.786 0.129 0.809 9e-42
307168953 757 Delta-1-pyrroline-5-carboxylate syntheta 0.770 0.133 0.813 1e-40
289742147 778 gamma-glutamyl phosphate reductase [Glos 0.740 0.124 0.85 2e-40
189234141 816 PREDICTED: similar to CG7470 CG7470-PA [ 0.816 0.131 0.766 2e-40
270002534 798 hypothetical protein TcasGA2_TC004842 [T 0.816 0.134 0.766 2e-40
347968001 791 AGAP002518-PA [Anopheles gambiae str. PE 0.786 0.130 0.796 4e-40
357609554 780 glutamate semialdehyde dehydrogenase [Da 0.839 0.141 0.756 9e-40
389613354 241 glutamate 5-kinase [Papilio xuthus] 0.839 0.456 0.747 3e-39
322801558116 hypothetical protein SINV_13670 [Solenop 0.786 0.887 0.778 3e-39
>gi|156538301|ref|XP_001603792.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%)

Query: 6   RSLQTAERRRVTSFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHL 65
           R LQT ER R  +F++R QLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAEC  
Sbjct: 42  RELQTGERPRRATFTERNQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECQN 101

Query: 66  EGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSPKDHSR 106
           EGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSP DH+R
Sbjct: 102 EGRECIMVTSGAVAFGKQKLAQELLMSLSMRETLSPADHTR 142

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193657053|ref|XP_001947489.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 1 [Acyrthosiphon pisum] gi|328704972|ref|XP_003242657.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 2 [Acyrthosiphon pisum] gi|328704974|ref|XP_003242658.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307168953|gb|EFN61839.1| Delta-1-pyrroline-5-carboxylate synthetase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|289742147|gb|ADD19821.1| gamma-glutamyl phosphate reductase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|189234141|ref|XP_970358.2| PREDICTED: similar to CG7470 CG7470-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002534|gb|EEZ98981.1| hypothetical protein TcasGA2_TC004842 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347968001|ref|XP_312421.4| AGAP002518-PA [Anopheles gambiae str. PEST] gi|333468208|gb|EAA07467.4| AGAP002518-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357609554|gb|EHJ66511.1| glutamate semialdehyde dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|389613354|dbj|BAM20033.1| glutamate 5-kinase [Papilio xuthus] Back     alignment and taxonomy information
>gi|322801558|gb|EFZ22215.1| hypothetical protein SINV_13670 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0037146 776 CG7470 [Drosophila melanogaste 0.694 0.117 0.861 4.2e-35
WB|WBGene00011938 802 alh-13 [Caenorhabditis elegans 0.687 0.112 0.655 5.3e-23
UNIPROTKB|Q2KJH7 795 ALDH18A1 "Aldehyde dehydrogena 0.671 0.110 0.630 1.8e-22
MGI|MGI:1888908 795 Aldh18a1 "aldehyde dehydrogena 0.664 0.109 0.626 4.9e-22
RGD|1311431 795 Aldh18a1 "aldehyde dehydrogena 0.664 0.109 0.626 4.9e-22
UNIPROTKB|E2R3N2 747 ALDH18A1 "Uncharacterized prot 0.664 0.116 0.626 1.2e-21
UNIPROTKB|E2QYZ0 795 ALDH18A1 "Uncharacterized prot 0.664 0.109 0.626 1.3e-21
UNIPROTKB|P54886 795 ALDH18A1 "Delta-1-pyrroline-5- 0.664 0.109 0.626 1.3e-21
UNIPROTKB|F1SC47 795 ALDH18A1 "Uncharacterized prot 0.664 0.109 0.626 1.3e-21
UNIPROTKB|Q5R4M8 795 ALDH18A1 "Delta-1-pyrroline-5- 0.664 0.109 0.626 1.3e-21
FB|FBgn0037146 CG7470 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 388 (141.6 bits), Expect = 4.2e-35, P = 4.2e-35
 Identities = 81/94 (86%), Positives = 86/94 (91%)

Query:    18 SFSDRGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGA 77
             +F++R QLKYARRLVVKLGSAVITRED HGLALGRLASIVEQVAECHLEGRE +MVTSGA
Sbjct:    46 TFTERSQLKYARRLVVKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGA 105

Query:    78 VAFGKQKLAQELLMSLSMRETLSPKDHSRSNHFD 111
             VAFGKQKLAQELLMSLSMRETL+PKD   S  FD
Sbjct:   106 VAFGKQKLAQELLMSLSMRETLNPKD---SKEFD 136
GO:0005739 "mitochondrion" evidence=ISS
GO:0004350 "glutamate-5-semialdehyde dehydrogenase activity" evidence=ISS
GO:0004349 "glutamate 5-kinase activity" evidence=ISS
GO:0006561 "proline biosynthetic process" evidence=ISS
GO:0017084 "delta1-pyrroline-5-carboxylate synthetase activity" evidence=ISS
GO:0005743 "mitochondrial inner membrane" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00011938 alh-13 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJH7 ALDH18A1 "Aldehyde dehydrogenase 18 family, member A1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1888908 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311431 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3N2 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYZ0 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P54886 ALDH18A1 "Delta-1-pyrroline-5-carboxylate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SC47 ALDH18A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4M8 ALDH18A1 "Delta-1-pyrroline-5-carboxylate synthase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54886P5CS_HUMAN1, ., 2, ., 1, ., 4, 10.61290.67930.1119yesN/A
P54889ALH13_CAEEL1, ., 2, ., 1, ., 4, 10.65550.68700.1125yesN/A
Q9Z110P5CS_MOUSE1, ., 2, ., 1, ., 4, 10.61950.67170.1106yesN/A
Q60050PROB_THET22, ., 7, ., 2, ., 1, 10.55170.42740.1513yesN/A
Q5SH03PROB_THET82, ., 7, ., 2, ., 1, 10.55170.42740.1513yesN/A
Q5R4M8P5CS_PONAB1, ., 2, ., 1, ., 4, 10.61290.67930.1119yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
cd04256 284 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate 9e-47
TIGR01092 715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 1e-23
cd04242 251 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-k 7e-21
PLN02418 718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat 2e-20
PRK05429 372 PRK05429, PRK05429, gamma-glutamyl kinase; Provisi 3e-18
PRK12314 266 PRK12314, PRK12314, gamma-glutamyl kinase; Provisi 3e-16
COG0263 369 COG0263, ProB, Glutamate 5-kinase [Amino acid tran 6e-14
TIGR01027 363 TIGR01027, proB, glutamate 5-kinase 2e-12
PRK13402 368 PRK13402, PRK13402, gamma-glutamyl kinase; Provisi 2e-09
pfam00696 230 pfam00696, AA_kinase, Amino acid kinase family 3e-04
PTZ00489 264 PTZ00489, PTZ00489, glutamate 5-kinase; Provisiona 7e-04
cd02115 248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily 0.001
>gnl|CDD|239789 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information 
 Score =  151 bits (384), Expect = 9e-47
 Identities = 57/85 (67%), Positives = 69/85 (81%)

Query: 22  RGQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFG 81
           R +LK+A+R+VVKLGSAV+TREDE GLALGRLASIVEQV+E   +GRE I+VTSGAVAFG
Sbjct: 2   RSELKHAKRIVVKLGSAVVTREDECGLALGRLASIVEQVSELQSQGREVILVTSGAVAFG 61

Query: 82  KQKLAQELLMSLSMRETLSPKDHSR 106
           KQ+L  E+L+S SMR+TL       
Sbjct: 62  KQRLRHEILLSSSMRQTLKSGQLKD 86

G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, and is subject to feedback allosteric inhibition by proline or ornithine. In plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia. Length = 284
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>gnl|CDD|239775 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|235460 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|183430 PRK12314, PRK12314, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|223341 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162163 TIGR01027, proB, glutamate 5-kinase Back     alignment and domain information
>gnl|CDD|184032 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|240438 PTZ00489, PTZ00489, glutamate 5-kinase; Provisional Back     alignment and domain information
>gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and 99.97
KOG1154|consensus 285 99.95
cd04256 284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase 99.92
PTZ00489 264 glutamate 5-kinase; Provisional 99.87
PRK13402 368 gamma-glutamyl kinase; Provisional 99.85
PRK12314 266 gamma-glutamyl kinase; Provisional 99.85
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.84
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 99.82
PRK05429 372 gamma-glutamyl kinase; Provisional 99.79
TIGR01027 363 proB glutamate 5-kinase. Bacterial ProB proteins h 99.79
cd04242 251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K 99.6
TIGR00746 310 arcC carbamate kinase. The seed alignment for this 99.43
PRK12353 314 putative amino acid kinase; Reviewed 99.36
PRK14558 231 pyrH uridylate kinase; Provisional 99.29
PRK00358 231 pyrH uridylate kinase; Provisional 98.98
cd04239 229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik 98.94
cd04234 227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 98.8
cd04246 239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 98.61
TIGR02075 233 pyrH_bact uridylate kinase. This protein, also cal 98.6
cd04261 239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 98.55
cd04241 252 AAK_FomA-like AAK_FomA-like: This CD includes a fo 98.45
cd04255 262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th 98.33
TIGR02076 221 pyrH_arch uridylate kinase, putative. This family 98.3
PRK06635 404 aspartate kinase; Reviewed 98.28
PRK14557 247 pyrH uridylate kinase; Provisional 98.12
PRK14556 249 pyrH uridylate kinase; Provisional 98.12
cd04254 231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi 98.07
PRK08841 392 aspartate kinase; Validated 98.03
PF00696 242 AA_kinase: Amino acid kinase family Match to Gluta 98.0
TIGR00656 401 asp_kin_monofn aspartate kinase, monofunctional cl 97.92
PRK08210 403 aspartate kinase I; Reviewed 97.9
PRK00942 283 acetylglutamate kinase; Provisional 97.73
cd04253 221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP 97.71
cd04260 244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase 97.58
TIGR00761 231 argB acetylglutamate kinase. This model describes 97.58
COG0528 238 PyrH Uridylate kinase [Nucleotide transport and me 97.56
cd02115 248 AAK Amino Acid Kinases (AAK) superfamily, catalyti 97.47
PRK07431 587 aspartate kinase; Provisional 96.9
cd04250 279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase 96.65
cd04235 308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot 96.63
cd04238 256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate 96.58
PRK12352 316 putative carbamate kinase; Reviewed 96.53
PRK12454 313 carbamate kinase-like carbamoyl phosphate syntheta 96.41
cd04237 280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) 96.38
PLN02512 309 acetylglutamate kinase 96.29
PRK05279 441 N-acetylglutamate synthase; Validated 96.22
CHL00202 284 argB acetylglutamate kinase; Provisional 96.2
cd04236 271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA 96.12
TIGR01890 429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 95.62
PRK12686 312 carbamate kinase; Reviewed 95.55
PRK12354 307 carbamate kinase; Reviewed 95.24
COG0527 447 LysC Aspartokinases [Amino acid transport and meta 94.94
cd04252 248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam 94.87
PRK04531 398 acetylglutamate kinase; Provisional 94.53
PLN02825 515 amino-acid N-acetyltransferase 94.4
PRK14058 268 acetylglutamate/acetylaminoadipate kinase; Provisi 94.33
COG0548 265 ArgB Acetylglutamate kinase [Amino acid transport 94.11
cd04249 252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina 93.69
cd04244 298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina 92.59
TIGR00657 441 asp_kinases aspartate kinase. The Lys-sensitive en 91.89
cd04251 257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina 89.98
PRK06291 465 aspartate kinase; Provisional 87.86
cd04259 295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super 86.53
COG1608 252 Predicted archaeal kinase [General function predic 85.3
cd04257 294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa 83.46
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 83.22
COG0549 312 ArcC Carbamate kinase [Amino acid transport and me 81.34
cd04240 203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin 80.51
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=8.5e-31  Score=223.78  Aligned_cols=103  Identities=29%  Similarity=0.439  Sum_probs=96.1

Q ss_pred             hccCCeEEEEeCccccccCCCCCCcHHHHHHHHHHHHHHHhCCCeEEEEccchHHHhhhhccc-cccCChHHHhhhccCC
Q psy11676         25 LKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQ-ELLMSLSMRETLSPKD  103 (131)
Q Consensus        25 l~~~krIVIKiGSs~Lt~~~~~~l~~~~l~~l~~qIa~L~~~G~eVILVSSGAVaaG~~~L~~-~~l~~~~~~qalaa~~  103 (131)
                      +.+++|||||||||+|++++ +.+|.++|..||++|++|+++|+|||||||||||+|+..|+. ++|..++.+||+||.|
T Consensus         3 ~~~~~riVvKiGSs~Lt~~~-g~l~~~~l~~l~~~ia~L~~~G~eVilVSSGAiaaG~~~Lg~~~rp~~l~~kQA~AAVG   81 (369)
T COG0263           3 LSSARRIVVKIGSSSLTDGT-GGLDRSKLEELVRQVAALHKAGHEVVLVSSGAIAAGRTRLGLPKRPKTLAEKQAAAAVG   81 (369)
T ss_pred             CCcceEEEEEECcceeeCCC-CCcCHHHHHHHHHHHHHHHhCCCEEEEEccchhhhChhhcCCCCCCcchHHHHHHHHhC
Confidence            67899999999999999985 789999999999999999999999999999999999999995 6788899999998866


Q ss_pred             ----------------------CcccccccCcchhhhHHhHHHHhhh
Q psy11676        104 ----------------------HSRSNHFDSENPKTNIYTHIILMFV  128 (131)
Q Consensus       104 ----------------------llT~~Df~~r~r~~Na~nTi~~~~~  128 (131)
                                            |||++||++|+||.|+||||+.|..
T Consensus        82 Q~~Lm~~y~~~f~~~g~~v~QiLLTr~D~~~r~ry~Nar~Tl~~Ll~  128 (369)
T COG0263          82 QVRLMQLYEELFARYGIKVGQILLTRDDFSDRRRYLNARNTLSALLE  128 (369)
T ss_pred             HHHHHHHHHHHHHhcCCeeeEEEeehhhhhhHHHHHHHHHHHHHHHH
Confidence                                  5699999999999999999999864

>KOG1154|consensus Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PTZ00489 glutamate 5-kinase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>TIGR00746 arcC carbamate kinase Back     alignment and domain information
>PRK12353 putative amino acid kinase; Reviewed Back     alignment and domain information
>PRK14558 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK14557 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK14556 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>PLN02512 acetylglutamate kinase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2j5v_A 367 Glutamate 5-kinase From Escherichia Coli Complexed 7e-05
2w21_A 259 Crystal Structure Of The Aminoacid Kinase Domain Of 1e-04
>pdb|2J5V|A Chain A, Glutamate 5-kinase From Escherichia Coli Complexed With Glutamyl-5-phosphate And Pyroglutamic Acid Length = 367 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
Query: 31  LVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLA-QEL 89
           LVVKLG++V+T      L    +  +V Q A+ H  G   ++VTSGA+A G++ L   EL
Sbjct: 7   LVVKLGTSVLTGGSRR-LNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPEL 65
Query: 90  LMSLSMRETLSPKDHSR 106
             +++ ++ L+    SR
Sbjct: 66  PATIASKQLLAAVGQSR 82
>pdb|2W21|A Chain A, Crystal Structure Of The Aminoacid Kinase Domain Of The Glutamate 5 Kinase Of Escherichia Coli Length = 259 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma gl 2e-17
2ako_A 251 Glutamate 5-kinase; structural genomics, PSI, prot 3e-15
3ll9_A 269 Isopentenyl phosphate kinase; mevalonate biosynthe 2e-14
3d40_A 286 FOMA protein; fosfomycin, antibiotic resistance, k 2e-12
3ll5_A 249 Gamma-glutamyl kinase related protein; alternate m 3e-09
2brx_A 244 Uridylate kinase; UMP kinase, amino acid kinase, p 1e-07
2va1_A 256 Uridylate kinase; UMPK, transferase, pyrimidine bi 2e-04
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinas 2e-04
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Length = 367 Back     alignment and structure
 Score = 75.6 bits (187), Expect = 2e-17
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 25 LKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQK 84
          +  ++ LVVKLG++V+T      L    +  +V Q A+ H  G   ++VTSGA+A G++ 
Sbjct: 1  MSDSQTLVVKLGTSVLTGGS-RRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREH 59

Query: 85 L 85
          L
Sbjct: 60 L 60
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Length = 251 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Length = 286 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma gl 99.76
3nwy_A 281 Uridylate kinase; allosterically activated form, A 99.47
2ako_A 251 Glutamate 5-kinase; structural genomics, PSI, prot 99.43
4a7w_A 240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 99.41
3ek6_A 243 Uridylate kinase; UMPK unique GTP B site, alloster 99.37
1z9d_A 252 Uridylate kinase, UK, UMP kinase; structural genom 99.22
2va1_A 256 Uridylate kinase; UMPK, transferase, pyrimidine bi 99.2
3l86_A 279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 99.14
1ybd_A 239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.1
2a1f_A 247 Uridylate kinase; PYRH, structural genomics, PSI, 99.0
2jjx_A 255 Uridylate kinase, UMP kinase; structural genomics, 98.99
2brx_A 244 Uridylate kinase; UMP kinase, amino acid kinase, p 98.96
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinas 98.92
4axs_A 332 Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm 98.85
1e19_A 314 Carbamate kinase-like carbamoylphosphate synthetas 98.79
2buf_A 300 Acetylglutamate kinase; acetyglutamate kinase, ADP 98.76
2e9y_A 316 Carbamate kinase; transferase, structural genomics 98.75
3d40_A 286 FOMA protein; fosfomycin, antibiotic resistance, k 98.73
2v5h_A 321 Acetylglutamate kinase; amino-acid biosynthesis, t 98.7
2bty_A 282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 98.68
2ap9_A 299 NAG kinase, acetylglutamate kinase, AGK; structura 98.66
2ij9_A 219 Uridylate kinase; structural genomics, protein str 98.63
2we5_A 310 Carbamate kinase 1; arginine catabolism, arginine 98.62
2j4j_A 226 Uridylate kinase; transferase, nucleoside monophos 98.62
2rd5_A 298 Acetylglutamate kinase-like protein; protein-prote 98.58
2ogx_A 276 Molybdenum storage protein subunit alpha; open alp 98.52
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu 98.49
2ogx_B 270 Molybdenum storage protein subunit beta; open alph 98.49
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase tran 98.41
3ll5_A 249 Gamma-glutamyl kinase related protein; alternate m 98.28
2egx_A 269 Putative acetylglutamate kinase; struc genomics, N 98.15
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibit 98.1
1gs5_A 258 Acetylglutamate kinase; carbamate kinase, amino ac 97.71
3ll9_A 269 Isopentenyl phosphate kinase; mevalonate biosynthe 97.62
3kzf_A 317 Carbamate kinase; arginine dihydrolase pathway, gi 96.24
3zzh_A 307 Acetylglutamate kinase; transferase, arginine bios 95.74
3s6g_A 460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 94.82
4ab7_A 464 Protein Arg5,6, mitochondrial; transferase, argini 94.19
3s6k_A 467 Acetylglutamate kinase; synthase, transferase; 2.8 92.96
3c1m_A 473 Probable aspartokinase; allosteric inhibition, thr 80.25
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
Probab=99.76  E-value=9.6e-19  Score=146.92  Aligned_cols=102  Identities=25%  Similarity=0.369  Sum_probs=86.5

Q ss_pred             ccCCeEEEEeCccccccCCCCCCcHHHHHHHHHHHHHHHhCCCeEEEEccchHHHhhhhcccc-ccCChHHHhhhcc---
Q psy11676         26 KYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQE-LLMSLSMRETLSP---  101 (131)
Q Consensus        26 ~~~krIVIKiGSs~Lt~~~~~~l~~~~l~~l~~qIa~L~~~G~eVILVSSGAVaaG~~~L~~~-~l~~~~~~qalaa---  101 (131)
                      .++|+||||+|+|+|++++ ++++.+++..++++|+.|++.|++||||+||++++|+..|+.+ +|..+..+|++++   
T Consensus         2 ~~~k~iVIKiGGs~l~~~~-~~~~~~~l~~la~~Ia~l~~~G~~vVlV~gGgi~~g~~~lg~~~~~~~l~~~qa~aavGq   80 (367)
T 2j5v_A            2 SDSQTLVVKLGTSVLTGGS-RRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQ   80 (367)
T ss_dssp             -CCCEEEEEECHHHHTTTS-SSCCHHHHHHHHHHHHHHHHTTCEEEEEECCHHHHHHHHHTSCCCCSSHHHHHHHHHHHH
T ss_pred             CCCCEEEEEECcHHhcCCC-CCcCHHHHHHHHHHHHHHHhCCCcEEEEEcCHHHHHHHHcCCCCCCCCHHHHHHHHHHHH
Confidence            4679999999999999875 5799999999999999999999999999999999999999843 4555555555433   


Q ss_pred             -------------CC------CcccccccCcchhhhHHhHHHHhhh
Q psy11676        102 -------------KD------HSRSNHFDSENPKTNIYTHIILMFV  128 (131)
Q Consensus       102 -------------~~------llT~~Df~~r~r~~Na~nTi~~~~~  128 (131)
                                   .|      ++|.+||.++.+|.|+++||+.|+.
T Consensus        81 ~~l~~~~~~~l~~~G~~~~qvllt~~d~~~~~r~~n~~~~i~~LL~  126 (367)
T 2j5v_A           81 SRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLD  126 (367)
T ss_dssp             HHHHHHHHHHHHTTTCCEEEEEECGGGGSSHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCceEEEEEecccccCceEEEhHHHHHHHHHH
Confidence                         23      4699999999999999999998763
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d2akoa1 250 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobact 8e-11
d1e19a_ 313 c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcu 2e-10
d1b7ba_ 307 c.73.1.1 (A:) Carbamate kinase {Enterococcus faeci 1e-09
d1z9da1 238 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc 4e-09
d2a1fa1 236 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi 6e-09
d1ybda1 236 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri 1e-08
d2ij9a1 219 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog 2e-06
d2brxa1 225 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc 3e-05
d1gs5a_ 258 c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escheri 8e-05
d2ap9a1 291 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {My 7e-04
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Glutamate 5-kinase
species: Campylobacter jejuni [TaxId: 197]

 Score = 55.5 bits (132), Expect = 8e-11
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 29 RRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQK 84
          +R+VVK+GS VI+  +E+ L+  RL ++V  +A+   E  E I+VTS A++ G  K
Sbjct: 1  KRIVVKVGSHVIS--EENTLSFERLKNLVAFLAKLM-EKYEVILVTSAAISAGHTK 53
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 313 Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307 Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1ybda1 236 Uridylate kinase PyrH {Neisseria meningitidis [Tax 99.65
d2a1fa1 236 Uridylate kinase PyrH {Haemophilus influenzae [Tax 99.59
d1z9da1 238 Uridylate kinase PyrH {Streptococcus pyogenes [Tax 99.55
d2akoa1 250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 99.49
d1e19a_ 313 Carbamate kinase {Archaeon Pyrococcus furiosus [Ta 99.22
d1b7ba_ 307 Carbamate kinase {Enterococcus faecium [TaxId: 135 99.12
d2ij9a1 219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 99.1
d1gs5a_ 258 N-acetyl-l-glutamate kinase {Escherichia coli [Tax 98.97
d2brxa1 225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 98.9
d2ap9a1 291 N-acetyl-l-glutamate kinase {Mycobacterium tubercu 98.58
d2btya1 282 N-acetyl-l-glutamate kinase {Thermotoga maritima [ 98.57
d2bufa1 300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginos 98.15
d2hmfa1 302 Aspartokinase {Methanococcus jannaschii [TaxId: 21 87.46
d2cdqa1 304 Aspartokinase {Thale cress (Arabidopsis thaliana) 83.48
d2j0wa1 292 Aspartokinase {Escherichia coli [TaxId: 562]} 81.96
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Uridylate kinase PyrH
species: Neisseria meningitidis [TaxId: 487]

Probab=99.65  E-value=7.4e-17  Score=120.62  Aligned_cols=61  Identities=20%  Similarity=0.286  Sum_probs=55.2

Q ss_pred             cCCeEEEEeCccccccCCCCCCcHHHHHHHHHHHHHHHhCCCeEEEEccchHHHhhhhccc
Q psy11676         27 YARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECHLEGRECIMVTSGAVAFGKQKLAQ   87 (131)
Q Consensus        27 ~~krIVIKiGSs~Lt~~~~~~l~~~~l~~l~~qIa~L~~~G~eVILVSSGAVaaG~~~L~~   87 (131)
                      ++||||||||+|+|+++++.++|.++|..||++|++|++.|++|++|||||+++|...+..
T Consensus         3 k~krIViKiGgs~l~~~~~~~i~~~~i~~la~~I~~l~~~g~~vviVssG~~~~~~~~~~~   63 (236)
T d1ybda1           3 KYKRVLLKLSGESLMGSDPFGINHDTIVQTVGEIAEVVKMGVQVGIVVGGGNIFRGVSAQA   63 (236)
T ss_dssp             SCSEEEEEECGGGGGTTSSSSCCHHHHHHHHHHHHHHHHTTCEEEEEECCHHHHHHHHHHH
T ss_pred             CCCEEEEEECcceecCCCCCCcCHHHHHHHHHHHHHHHHCCCEEEEEeccccccccccccc
Confidence            4699999999999997765569999999999999999999999999999999999887763
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure