Psyllid ID: psy11771

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MPIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLVAPPAPTS
ccccccccccccEEEEEEccEEEEEcccccccccEEEccccccccccEEEEEEccccccHHHHHccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccEEEccccccccEEEEEEEEEEccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEcccEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEEccccccccccEEEEEccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccccccccEEEccccccc
cccccccccccccEEEEEccEEEEEccccccccHHHEEEEccccccccEEEcccHHHHHccccHHHHHHccccccccHHHHHEEcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEcccccccccc
mpiapmlyrrsrsgvaglGKMLYVVGGFYCQLLVFykyplygrpavnsscgnyilpTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLpeqrsllttkrtqerkpegmlpyVFAIGTcsfdgllyacggydgasclssmerydpltgvwsscpamttrrrycRIAVVENCLYalggfdstnyqasverldprmgkwapvpsmssrrsscgvaaldgaiycvggndgtmcmssgerfnvrrnswepiapmlsrrsthevVNIEGYLLtmggndgssslnsvekydpklnkwqlltpmltrrssigaAVLETLNIEKRllvappapts
MPIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLlpeqrsllttkrtqerkpegmLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEpiapmlsrrsthEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLetlniekrllvappapts
MPIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLVAPPAPTS
************SGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPE****************GMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVE*********************CGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMG*************YDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLV*******
MPIAPM*YRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLL*APP****
MPIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWA***********CGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLVAPPAPTS
*****MLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLV*******
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLVAPPAPTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q8K430640 Kelch-like protein 17 OS= yes N/A 0.778 0.421 0.434 3e-79
Q6TDP3640 Kelch-like protein 17 OS= yes N/A 0.778 0.421 0.434 3e-79
Q6TDP4642 Kelch-like protein 17 OS= yes N/A 0.778 0.420 0.434 7e-79
Q5ZKD9610 Kelch-like protein 20 OS= no N/A 0.757 0.431 0.397 1e-54
D3Z8N4609 Kelch-like protein 20 OS= no N/A 0.757 0.431 0.397 2e-54
Q9Y2M5609 Kelch-like protein 20 OS= no N/A 0.757 0.431 0.397 2e-54
Q08DK3609 Kelch-like protein 20 OS= no N/A 0.757 0.431 0.397 2e-54
Q6DFF6604 Kelch-like protein 20 OS= N/A N/A 0.757 0.435 0.397 2e-54
Q8VCK5604 Kelch-like protein 20 OS= no N/A 0.757 0.435 0.397 2e-54
Q5R7B8609 Kelch-like protein 20 OS= yes N/A 0.737 0.420 0.408 3e-54
>sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 Back     alignment and function desciption
 Score =  295 bits (756), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 211/352 (59%), Gaps = 82/352 (23%)

Query: 65  QLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQER 124
           +L++ V+LPLL+RDFL+  V++ESL++   +C++LL+EA+K+HLLPEQR +L T RT+ R
Sbjct: 274 RLMKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPR 333

Query: 125 KPEGMLPYVFAIGTCSFDGL-----------------------------------LYACG 149
           + EG  P +FA+G  S   +                                   LYA G
Sbjct: 334 RCEGAGPVLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVG 393

Query: 150 G-----------------------------------------------YDGASCLSSMER 162
           G                                               YDGASCL+S ER
Sbjct: 394 GYDGTSDLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYAAGGYDGASCLNSAER 453

Query: 163 YDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPS 222
           YDPLTG W+S  AM+TRRRY R+A ++  LYA+GG+DS+++ A+VE+ +P++  W PV S
Sbjct: 454 YDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLATVEKYEPQVNSWTPVAS 513

Query: 223 MSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNI 282
           M SRRSS GVA L+GA+Y  GGNDGT C++S ER++ +  +WE +APM  RRSTH++V +
Sbjct: 514 MLSRRSSAGVAVLEGALYVAGGNDGTSCLNSVERYSTKAGAWESVAPMNIRRSTHDLVAM 573

Query: 283 EGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNI 334
           +G+L  +GGNDGSSSLNS+EKY+P+ NKW   + M TRRSS+G AVLE LN 
Sbjct: 574 DGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVLELLNF 625
Substrate-recognition component of some cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(KLHL17) mediates the ubiquitination and subsequenct degradation of GLUR6. May play a role in the actin-based neuronal function.
Rattus norvegicus (taxid: 10116)
>sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=2 SV=1 Back     alignment and function description
>sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=KLHL17 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 Back     alignment and function description
>sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
195487313 721 GE13880 [Drosophila yakuba] gi|194177958 0.812 0.391 0.549 1e-111
195426774 713 GK20700 [Drosophila willistoni] gi|19415 0.780 0.380 0.563 1e-111
25009865 620 AT24465p, partial [Drosophila melanogast 0.824 0.461 0.547 1e-111
442624172 743 CG15097, isoform E [Drosophila melanogas 0.824 0.384 0.544 1e-110
442624170 734 CG15097, isoform D [Drosophila melanogas 0.824 0.389 0.544 1e-110
195335721 715 GM19869 [Drosophila sechellia] gi|194126 0.798 0.387 0.555 1e-110
201065837 620 FI06141p [Drosophila melanogaster] 0.824 0.461 0.544 1e-110
320544139 617 CG15097, isoform C [Drosophila melanogas 0.824 0.463 0.544 1e-110
194757904 707 GF13750 [Drosophila ananassae] gi|190622 0.925 0.454 0.514 1e-110
19922570 513 CG15097, isoform A [Drosophila melanogas 0.824 0.557 0.544 1e-110
>gi|195487313|ref|XP_002091857.1| GE13880 [Drosophila yakuba] gi|194177958|gb|EDW91569.1| GE13880 [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/364 (54%), Positives = 247/364 (67%), Gaps = 82/364 (22%)

Query: 65  QLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQER 124
           +L+ +V+LPL++RDFLM+ VE+E+L+++ +EC+ELLLEAMKYHLLPEQRS++ ++RTQER
Sbjct: 256 ELMSNVRLPLVSRDFLMSCVETETLMRDDSECKELLLEAMKYHLLPEQRSIMGSQRTQER 315

Query: 125 KPEGMLPYVFAIG-----------------------------------TCSFDGLLYACG 149
           +PEGM PYVFA+G                                     S    LY  G
Sbjct: 316 RPEGMKPYVFAVGGGSLFAIHNECEVYNPRSNSWSPVAPMLWRRSRSGVTSLHKQLYVVG 375

Query: 150 G-----------------------------------------------YDGASCLSSMER 162
           G                                               YDGASCLSSMER
Sbjct: 376 GYDGVSDLATAESYNPLTNKWSNITPMGTKRSCLGICSYDALIYVCGGYDGASCLSSMER 435

Query: 163 YDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPS 222
           YDPLTG+WSSCPAM+TRRRYCR+AV+ENC+Y+LGGFDSTNYQ+SVER DPR+G+W PVPS
Sbjct: 436 YDPLTGIWSSCPAMSTRRRYCRLAVLENCIYSLGGFDSTNYQSSVERFDPRVGRWQPVPS 495

Query: 223 MSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNI 282
           M++RRSSCGVA+ DG +YC+GGNDGTMCMSSGERFN+RRNSWEPIA M SRRSTHEVV +
Sbjct: 496 MTARRSSCGVASTDGHLYCIGGNDGTMCMSSGERFNLRRNSWEPIAAMHSRRSTHEVVEV 555

Query: 283 EGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVLETLNIEKRLLVAP 342
           EG L  +GGNDGSSSLNSVE+YDP+LNKW ++  M+ RRSS+GAAVLE  ++E+ L  A 
Sbjct: 556 EGALFALGGNDGSSSLNSVERYDPRLNKWSVVNAMVARRSSVGAAVLECFHLERGLSFAA 615

Query: 343 PAPT 346
            A +
Sbjct: 616 AAAS 619

Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195426774|ref|XP_002061471.1| GK20700 [Drosophila willistoni] gi|194157556|gb|EDW72457.1| GK20700 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|25009865|gb|AAN71102.1| AT24465p, partial [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442624172|ref|NP_001261079.1| CG15097, isoform E [Drosophila melanogaster] gi|440214512|gb|AGB93611.1| CG15097, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442624170|ref|NP_788412.2| CG15097, isoform D [Drosophila melanogaster] gi|440214511|gb|AAO41354.2| CG15097, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195335721|ref|XP_002034512.1| GM19869 [Drosophila sechellia] gi|194126482|gb|EDW48525.1| GM19869 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|201065837|gb|ACH92328.1| FI06141p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320544139|ref|NP_001188973.1| CG15097, isoform C [Drosophila melanogaster] gi|318068644|gb|ADV37219.1| CG15097, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194757904|ref|XP_001961202.1| GF13750 [Drosophila ananassae] gi|190622500|gb|EDV38024.1| GF13750 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|19922570|ref|NP_611377.1| CG15097, isoform A [Drosophila melanogaster] gi|16768124|gb|AAL28281.1| GH18278p [Drosophila melanogaster] gi|21627003|gb|AAF57630.2| CG15097, isoform A [Drosophila melanogaster] gi|220945566|gb|ACL85326.1| CG15097-PA [synthetic construct] gi|220955282|gb|ACL90184.1| CG15097-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
FB|FBgn0034396620 CG15097 [Drosophila melanogast 0.587 0.329 0.754 8.7e-98
MGI|MGI:2678948640 Klhl17 "kelch-like 17" [Mus mu 0.570 0.309 0.590 6e-70
RGD|708444640 Klhl17 "kelch-like family memb 0.570 0.309 0.590 6e-70
UNIPROTKB|Q6TDP4642 KLHL17 "Kelch-like protein 17" 0.570 0.308 0.585 2.6e-69
UNIPROTKB|Q5ZKD9610 KLHL20 "Kelch-like protein 20" 0.737 0.419 0.412 1.2e-51
UNIPROTKB|Q08DK3609 KLHL20 "Kelch-like protein 20" 0.737 0.420 0.412 1.5e-51
UNIPROTKB|F1PCW9609 KLHL20 "Uncharacterized protei 0.737 0.420 0.412 1.5e-51
UNIPROTKB|B4DUR0420 KLHL20 "Kelch-like protein 20" 0.737 0.609 0.412 1.5e-51
UNIPROTKB|Q9Y2M5609 KLHL20 "Kelch-like protein 20" 0.737 0.420 0.412 1.5e-51
UNIPROTKB|F1S729609 KLHL20 "Uncharacterized protei 0.737 0.420 0.412 1.5e-51
FB|FBgn0034396 CG15097 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 885 (316.6 bits), Expect = 8.7e-98, Sum P(2) = 8.7e-98
 Identities = 154/204 (75%), Positives = 183/204 (89%)

Query:   136 IGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYAL 195
             +G CS+D L+Y CGGYDGASCLSSMERYDPLTG+WSSCPAM+TRRRYCR+AV+ENC+Y+L
Sbjct:   412 LGICSYDALIYVCGGYDGASCLSSMERYDPLTGIWSSCPAMSTRRRYCRLAVLENCIYSL 471

Query:   196 GGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGE 255
             GGFDSTNYQ+SVER DPR+G+W PVPSMS+RRSSCGVA+ DG +YC+GGNDGTMCMSSGE
Sbjct:   472 GGFDSTNYQSSVERFDPRVGRWQPVPSMSARRSSCGVASTDGHLYCIGGNDGTMCMSSGE 531

Query:   256 RFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLT 315
             RFN+RRNSWEPIA M SRRSTHEVV +EG L  +GGNDGSSSLNSVE+YD +LNKW ++ 
Sbjct:   532 RFNLRRNSWEPIAAMHSRRSTHEVVEVEGALFALGGNDGSSSLNSVERYDTRLNKWSVVN 591

Query:   316 PMLTRRSSIGAAVLETLNIEKRLL 339
              M+ RRSS+GAAVLE  ++E+ L+
Sbjct:   592 AMVARRSSVGAAVLECFHLERGLV 615
GO:0003779 "actin binding" evidence=ISS
MGI|MGI:2678948 Klhl17 "kelch-like 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708444 Klhl17 "kelch-like family member 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6TDP4 KLHL17 "Kelch-like protein 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKD9 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DK3 KLHL20 "Kelch-like protein 20" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCW9 KLHL20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUR0 KLHL20 "Kelch-like protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2M5 KLHL20 "Kelch-like protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S729 KLHL20 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 9e-23
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-22
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-18
smart0061247 smart00612, Kelch, Kelch domain 3e-14
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-14
smart0061247 smart00612, Kelch, Kelch domain 1e-13
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-11
smart0061247 smart00612, Kelch, Kelch domain 3e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-10
smart0061247 smart00612, Kelch, Kelch domain 5e-09
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 6e-07
pfam1396450 pfam13964, Kelch_6, Kelch motif 7e-07
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 9e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-05
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 1e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 6e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.001
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.001
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 0.002
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 98.7 bits (246), Expect = 9e-23
 Identities = 48/192 (25%), Positives = 86/192 (44%), Gaps = 5/192 (2%)

Query: 131 PYVFAIGTCSFDGLLYACGGYDGAS-CLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVE 189
            YV+  G+   + ++Y  GG +  +  ++S+  YD  T  W+  P +   R+   + V  
Sbjct: 283 HYVYCFGSVVLNNVIYFIGGMNKNNLSVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFN 342

Query: 190 NCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGG-NDGT 248
           N +Y +GG  ++    +VE   P   KW   P +   R +  V  ++  IY +GG +   
Sbjct: 343 NRIYVIGGIYNSISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKND 402

Query: 249 MCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGG---NDGSSSLNSVEKYD 305
             + + E F++  N W   +P+         +  +G +  +GG    D     N VE Y+
Sbjct: 403 ELLKTVECFSLNTNKWSKGSPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIVESYN 462

Query: 306 PKLNKWQLLTPM 317
           P  NKW  L+ +
Sbjct: 463 PVTNKWTELSSL 474

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
KOG4441|consensus571 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441|consensus571 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693|consensus392 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.98
KOG4693|consensus392 99.97
KOG0379|consensus 482 99.96
KOG0379|consensus 482 99.95
KOG4152|consensus 830 99.93
KOG1230|consensus 521 99.92
KOG1230|consensus 521 99.91
KOG4152|consensus 830 99.85
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.65
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.6
KOG2437|consensus 723 99.44
PF1396450 Kelch_6: Kelch motif 99.4
PF1396450 Kelch_6: Kelch motif 99.32
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.2
PF1341549 Kelch_3: Galactose oxidase, central domain 99.14
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.12
KOG2437|consensus 723 99.09
PF1341549 Kelch_3: Galactose oxidase, central domain 99.04
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.04
smart0061247 Kelch Kelch domain. 99.03
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.98
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.96
smart0061247 Kelch Kelch domain. 98.94
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.88
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.71
PLN02772 398 guanylate kinase 98.69
PLN02772 398 guanylate kinase 98.64
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.54
PF1385442 Kelch_5: Kelch motif 98.54
PF1385442 Kelch_5: Kelch motif 98.47
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.14
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 97.87
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.85
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.79
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.75
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.75
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 97.4
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 97.18
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 97.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.09
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.94
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.87
PF12768281 Rax2: Cortical protein marker for cell polarity 96.83
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.74
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.66
PF03089 337 RAG2: Recombination activating protein 2; InterPro 96.49
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 96.44
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.14
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.12
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.06
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.92
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.84
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.69
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.54
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.51
KOG2055|consensus514 95.47
PRK04792448 tolB translocation protein TolB; Provisional 95.44
PRK00178430 tolB translocation protein TolB; Provisional 95.29
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 95.01
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.75
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.7
smart00284255 OLF Olfactomedin-like domains. 94.7
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.61
PRK04922433 tolB translocation protein TolB; Provisional 94.6
KOG0310|consensus 487 94.25
PF09910339 DUF2139: Uncharacterized protein conserved in arch 93.96
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.85
PRK05137435 tolB translocation protein TolB; Provisional 93.76
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.37
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.32
KOG0316|consensus307 92.85
PRK04043419 tolB translocation protein TolB; Provisional 92.68
KOG2055|consensus514 92.1
PRK03629429 tolB translocation protein TolB; Provisional 91.81
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 91.68
PRK04792448 tolB translocation protein TolB; Provisional 91.61
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.14
PF09910 339 DUF2139: Uncharacterized protein conserved in arch 91.01
PRK11028 330 6-phosphogluconolactonase; Provisional 90.94
PRK00178430 tolB translocation protein TolB; Provisional 90.82
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 90.72
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 90.31
PRK13684334 Ycf48-like protein; Provisional 89.48
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.33
KOG0278|consensus334 89.07
PTZ00421 493 coronin; Provisional 88.88
KOG1898|consensus 1205 88.76
KOG0310|consensus 487 88.73
smart00284255 OLF Olfactomedin-like domains. 88.67
KOG1332|consensus299 87.94
PLN00181793 protein SPA1-RELATED; Provisional 87.89
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 87.82
KOG4350|consensus 620 87.19
PRK04922433 tolB translocation protein TolB; Provisional 86.92
PRK05137435 tolB translocation protein TolB; Provisional 85.93
KOG0289|consensus506 85.74
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 85.62
COG1520 370 FOG: WD40-like repeat [Function unknown] 85.53
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 85.24
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 85.16
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 84.34
PRK02889427 tolB translocation protein TolB; Provisional 84.21
KOG0289|consensus506 83.11
COG1520370 FOG: WD40-like repeat [Function unknown] 82.3
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.98
KOG0316|consensus307 81.74
KOG2321|consensus 703 81.71
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 81.66
>KOG4441|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.2e-53  Score=401.35  Aligned_cols=289  Identities=43%  Similarity=0.762  Sum_probs=265.9

Q ss_pred             CCccCChHHHHHHHHHHHHhc--------cccccccccCCCChHHHHHhcccccccccChhHHHHHHHHHHhccCccccc
Q psy11771         43 RPAVNSSCGNYILPTAWVSVA--------LQLLRHVKLPLLARDFLMNSVESESLIKESTECQELLLEAMKYHLLPEQRS  114 (347)
Q Consensus        43 ~~~v~~E~~v~~~~~~Wv~~~--------~~ll~~vr~~~l~~~~l~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  114 (347)
                      +++|.+|++||+++++|++||        ++++++|||+++++.+|.+.+...+++..+..|++++.++.+++..+.++.
T Consensus       191 ~l~v~~E~~vf~a~~~Wv~~d~~~R~~~~~~ll~~vr~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~  270 (571)
T KOG4441|consen  191 DLNVDSEEEVFEAAMRWVKHDFEEREEHLPALLEAVRLPLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRP  270 (571)
T ss_pred             CCCcCCHHHHHHHHHHHHhcCHhhHHHHHHHHHHhcCccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCc
Confidence            335999999999999999998        999999999999999999999999999999999999999999999888777


Q ss_pred             ccccCccccccCC----------------------------------CCCCeEEEEEEEEECCEEEEEcccC-CCCCCCe
Q psy11771        115 LLTTKRTQERKPE----------------------------------GMLPYVFAIGTCSFDGLLYACGGYD-GASCLSS  159 (347)
Q Consensus       115 ~~~~~~~~~r~~~----------------------------------~~~~~~~~~~~~~~~~~lyv~GG~~-~~~~~~~  159 (347)
                      .++..+.++|...                                  .++..+..+++++++|+||++||.+ +...+++
T Consensus       271 ~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~~r~~~~~~~~~~~lYv~GG~~~~~~~l~~  350 (571)
T KOG4441|consen  271 VMQSPRTRPRRSVSGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPSPRCRVGVAVLNGKLYVVGGYDSGSDRLSS  350 (571)
T ss_pred             cccCCCcccCcCCCCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCcccccccEEEECCEEEEEccccCCCcccce
Confidence            6777777777410                                  0111122239999999999999999 7788899


Q ss_pred             EEEEeCCCCcEEeCCCCCCCccceEEEEECCEEEEEcCcCCCCccceEEEEeCCCCcEEecCCCCCCCcceEEEEECCEE
Q psy11771        160 MERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAI  239 (347)
Q Consensus       160 ~~~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~i  239 (347)
                      +++||+.+++|.++++|+.+|..+++++++|.||++||.++....+++++|||.+++|+.+++|+..|..+++++++++|
T Consensus       351 ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~i  430 (571)
T KOG4441|consen  351 VERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKL  430 (571)
T ss_pred             EEEecCCCCceeccCCccCccccceeEEECCEEEEEeccccccccccEEEecCCCCcccccCCCCcceeeeEEEEECCEE
Confidence            99999999999999999999999999999999999999998888999999999999999999999999999999999999


Q ss_pred             EEEcccCCCc-cCCeEEEEECCCCeEEEcCCCCCCCcceEEEEECCEEEEEeccCCCCCccEEEEEeCCCCcEEEccCCC
Q psy11771        240 YCVGGNDGTM-CMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPML  318 (347)
Q Consensus       240 yv~GG~~~~~-~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~  318 (347)
                      |++||.++.. .++++++|||.+++|+.+++|+.+|.++++++++++||++||.++.....++++|||++++|+.+++|+
T Consensus       431 Yi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~  510 (571)
T KOG4441|consen  431 YIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMT  510 (571)
T ss_pred             EEEcCcCCCccccceEEEEcCCCCceeecCCcccccccceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCc
Confidence            9999987776 899999999999999999999999999999999999999999988667788999999999999999999


Q ss_pred             CCcceeEEEEEcC
Q psy11771        319 TRRSSIGAAVLET  331 (347)
Q Consensus       319 ~~r~~~~~~~~~~  331 (347)
                      .+|+.++++++++
T Consensus       511 ~~rs~~g~~~~~~  523 (571)
T KOG4441|consen  511 SPRSAVGVVVLGG  523 (571)
T ss_pred             cccccccEEEECC
Confidence            9999999998876

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-36
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-33
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 3e-33
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-32
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 1e-32
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-30
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-30
1zgk_A 308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 1e-15
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-16
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 3e-15
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 5e-10
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 108/193 (55%)
Query: 137 GTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALG 196
           G  +   ++Y  GG+DG+   +SMERYDP    WS    M T R    + V    +Y LG
Sbjct: 107 GATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLG 166
Query: 197 GFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGER 256
           G+D  N   SVE+ DP  G W  V  M+++RS  GVA L+  IY VGG DGT  +SS E 
Sbjct: 167 GYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEA 226
Query: 257 FNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTP 316
           +N+R +SW  +  M + R       + G L  + G DG+S L+S+E YDP ++ W+++T 
Sbjct: 227 YNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTS 286
Query: 317 MLTRRSSIGAAVL 329
           M T+R   G  VL
Sbjct: 287 MGTQRCDAGVCVL 299
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-82
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-77
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-73
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-57
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-36
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 5e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-81
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-77
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-72
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-56
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-51
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-78
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-73
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 3e-54
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-35
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 3e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-04
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-75
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-70
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 7e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-71
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-69
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-61
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-51
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 1e-04
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-04
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-70
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-69
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 9e-61
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-53
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 6e-39
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-04
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-34
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-31
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-30
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-29
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-15
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-10
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 2e-20
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-17
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 7e-13
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-17
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-06
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 3e-17
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-07
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
 Score =  252 bits (645), Expect = 1e-82
 Identities = 77/193 (39%), Positives = 108/193 (55%)

Query: 137 GTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALG 196
           G  +   ++Y  GG+DG+   +SMERYDP    WS    M T R    + V    +Y LG
Sbjct: 107 GATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLG 166

Query: 197 GFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGER 256
           G+D  N   SVE+ DP  G W  V  M+++RS  GVA L+  IY VGG DGT  +SS E 
Sbjct: 167 GYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEA 226

Query: 257 FNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTP 316
           +N+R +SW  +  M + R       + G L  + G DG+S L+S+E YDP ++ W+++T 
Sbjct: 227 YNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTS 286

Query: 317 MLTRRSSIGAAVL 329
           M T+R   G  VL
Sbjct: 287 MGTQRCDAGVCVL 299
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.93
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 98.8
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 98.22
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.07
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.86
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.66
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.58
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.57
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.45
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.27
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.26
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 96.93
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.91
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 96.83
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.72
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.67
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.53
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.26
1itv_A195 MMP9; adaptive molecular recognition, beta propell 96.15
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.14
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.13
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.12
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.11
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 96.03
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.9
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.85
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.69
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 95.65
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.59
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 95.59
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.53
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.5
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.45
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.37
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.36
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.32
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.3
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.24
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.22
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.22
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.17
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.16
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.14
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 95.13
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.12
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 95.11
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.07
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.0
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 94.98
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 94.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 94.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.93
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.93
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.92
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.84
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.83
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.83
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.82
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.81
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.8
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.78
3jrp_A379 Fusion protein of protein transport protein SEC13 94.75
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 94.73
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.72
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.56
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.56
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.51
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.5
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.49
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.47
2pm7_B297 Protein transport protein SEC13, protein transport 94.46
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.4
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.35
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.23
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.15
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 94.14
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.99
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.89
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.86
3jro_A 753 Fusion protein of protein transport protein SEC13 93.82
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 93.75
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.73
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.71
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 93.71
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.66
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 93.56
3v9f_A 781 Two-component system sensor histidine kinase/RESP 93.49
3ott_A758 Two-component system sensor histidine kinase; beta 93.43
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.36
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.32
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.11
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.1
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 92.92
1itv_A195 MMP9; adaptive molecular recognition, beta propell 92.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.84
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.79
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 92.68
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.68
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.56
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 92.52
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.51
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 92.46
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 92.4
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.35
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 92.33
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.18
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 92.15
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 92.13
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.13
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.11
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.1
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.06
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.01
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.92
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.89
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.88
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.88
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.87
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.84
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 91.84
2p4o_A306 Hypothetical protein; putative lactonase, structur 91.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 91.8
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 91.7
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 91.61
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 91.6
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 91.57
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.51
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.5
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.34
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 91.25
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.24
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 91.21
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.01
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.83
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 90.75
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 90.73
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 90.62
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.51
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 90.43
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 90.42
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 90.39
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.22
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.94
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 89.9
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 89.82
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 89.78
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 89.74
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 89.72
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.66
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 89.65
2pm7_B297 Protein transport protein SEC13, protein transport 89.63
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.57
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 89.51
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 89.39
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 89.34
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 89.29
2cn3_A737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 89.28
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.24
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 89.09
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.05
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 88.97
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 88.83
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 88.8
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 88.72
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 88.71
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 88.63
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 88.51
2fp8_A322 Strictosidine synthase; six bladed beta propeller 88.46
3jro_A 753 Fusion protein of protein transport protein SEC13 88.41
3ott_A 758 Two-component system sensor histidine kinase; beta 88.15
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 88.14
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 88.04
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 87.91
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 87.87
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 87.73
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 87.6
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 87.34
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 87.25
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 86.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 86.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.79
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 86.7
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 86.54
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.5
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 86.44
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 86.39
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 86.39
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 85.99
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 85.78
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 85.75
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 85.74
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 85.68
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 85.61
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 85.1
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 84.99
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 84.63
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 84.26
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 84.02
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 83.43
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 83.36
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 83.31
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 83.24
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.14
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 82.79
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 82.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 82.7
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 82.51
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 82.11
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 81.84
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 81.83
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.82
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 81.8
2xyi_A430 Probable histone-binding protein CAF1; transcripti 81.19
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 80.97
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 80.96
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 80.16
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 80.14
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=6.1e-44  Score=320.20  Aligned_cols=194  Identities=40%  Similarity=0.677  Sum_probs=183.0

Q ss_pred             EEEEEECCEEEEEcccCCCCCCCeEEEEeCCCCcEEeCCCCCCCccceEEEEECCEEEEEcCcCCCCccceEEEEeCCCC
Q psy11771        136 IGTCSFDGLLYACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMG  215 (347)
Q Consensus       136 ~~~~~~~~~lyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~yd~~~~  215 (347)
                      +++++++++||++||.++...++++++||+.+++|++++++|.+|..++++.++++||++||.......+++++||+.++
T Consensus       115 ~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~  194 (308)
T 1zgk_A          115 IGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERN  194 (308)
T ss_dssp             CEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTT
T ss_pred             cEEEEECCEEEEEcCCCCCcccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCCCCCCcCceEEEEeCCCC
Confidence            47888999999999997766778999999999999999999999999999999999999999887766899999999999


Q ss_pred             cEEecCCCCCCCcceEEEEECCEEEEEcccCCCccCCeEEEEECCCCeEEEcCCCCCCCcceEEEEECCEEEEEeccCCC
Q psy11771        216 KWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGS  295 (347)
Q Consensus       216 ~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~  295 (347)
                      +|+.++++|.+|..++++.++++||++||.+.....+++++||+++++|+.++++|.+|..|++++++++||++||.++.
T Consensus       195 ~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~  274 (308)
T 1zgk_A          195 EWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGH  274 (308)
T ss_dssp             EEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSS
T ss_pred             eEeeCCCCCCccccceEEEECCEEEEEeCCCCCCccceEEEEeCCCCcEEECCCCCCCccceEEEEECCEEEEEcCcCCC
Confidence            99999999999999999999999999999987777899999999999999999999999999999999999999998877


Q ss_pred             CCccEEEEEeCCCCcEEEccCCCCCcceeEEEEE
Q psy11771        296 SSLNSVEKYDPKLNKWQLLTPMLTRRSSIGAAVL  329 (347)
Q Consensus       296 ~~~~~v~~yd~~~~~W~~~~~~~~~r~~~~~~~~  329 (347)
                      ...+++++||+++++|+.+++||.+|.+|+++++
T Consensus       275 ~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~l  308 (308)
T 1zgk_A          275 TFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT  308 (308)
T ss_dssp             CBCCEEEEEETTTTEEEEEEECSSCCBSCEEEEC
T ss_pred             cccceEEEEcCCCCEEeecCCCCCCcccceeEeC
Confidence            7788999999999999999999999999999875
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-22
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-21
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-16
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 9e-10
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-07
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-13
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-13
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-13
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-12
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-11
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-08
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 93.0 bits (229), Expect = 2e-22
 Identities = 73/183 (39%), Positives = 100/183 (54%)

Query: 146 YACGGYDGASCLSSMERYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQA 205
           YA GG  G    +S+ERY+P    W     M TRR    +AV+   LYA+GGFD TN   
Sbjct: 105 YAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLN 164

Query: 206 SVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYCVGGNDGTMCMSSGERFNVRRNSWE 265
           S E   P   +W  + +M++ RS  GV  L   IY  GG DG   ++S ER++V   +W 
Sbjct: 165 SAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWT 224

Query: 266 PIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRRSSIG 325
            +APM  RRS   +   +G +  +GG DG + L+SVE YDP  + W  +T M + RS +G
Sbjct: 225 FVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVG 284

Query: 326 AAV 328
            AV
Sbjct: 285 VAV 287
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.9
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 97.45
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 97.18
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.82
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 96.46
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.21
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 96.0
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.67
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.15
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.88
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 94.84
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.15
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.13
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.79
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.76
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.74
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.6
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 93.38
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.35
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.25
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.19
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 93.16
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.94
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.88
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.52
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 92.26
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 92.05
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.98
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.89
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.58
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 91.18
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 90.53
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 90.05
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.99
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.88
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 89.69
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 88.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.33
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 88.11
d1tbga_340 beta1-subunit of the signal-transducing G protein 87.91
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 87.61
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 87.5
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 86.23
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.06
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 85.95
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 82.76
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 82.51
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.71
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 80.95
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.2e-38  Score=276.66  Aligned_cols=255  Identities=35%  Similarity=0.548  Sum_probs=217.2

Q ss_pred             CCccceeeecccccccccceEEEecCeeEEEEEeeeCCCCCCCccCChHHHHHHHHHHHHhccccccccccCCCChHHHH
Q psy11771          2 PIAPMLYRRSRSGVAGLGKMLYVVGGFYCQLLVFYKYPLYGRPAVNSSCGNYILPTAWVSVALQLLRHVKLPLLARDFLM   81 (347)
Q Consensus         2 ~~~~~~~~r~~h~~~~~~~~~y~~GG~~~~~~~~~~~~l~~~~~v~~E~~v~~~~~~Wv~~~~~ll~~vr~~~l~~~~l~   81 (347)
                      .+++||.+|.+|++++++++|||+||........         ...                                  
T Consensus        33 ~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~---------~~~----------------------------------   69 (288)
T d1zgka1          33 RLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGN---------TDS----------------------------------   69 (288)
T ss_dssp             ECCCCSSCCBSCEEEEETTEEEEECCEEEETTEE---------EEC----------------------------------
T ss_pred             ECCCCCCccceeEEEEECCEEEEEeCcccCCCCc---------ccc----------------------------------
Confidence            3679999999999999999999999984220000         000                                  


Q ss_pred             HhcccccccccChhHHHHHHHHHHhccCcccccccccCccccccCCCCCCeEEEEEEEEECCEEEEEcccCCCCCCCeEE
Q psy11771         82 NSVESESLIKESTECQELLLEAMKYHLLPEQRSLLTTKRTQERKPEGMLPYVFAIGTCSFDGLLYACGGYDGASCLSSME  161 (347)
Q Consensus        82 ~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~  161 (347)
                                         .+.+.|+..+..|..++. .+.+|.         .++++++++++|++||..+...+++.+
T Consensus        70 -------------------~~~~~yd~~~~~w~~~~~-~p~~r~---------~~~~~~~~~~i~~~gg~~~~~~~~~~~  120 (288)
T d1zgka1          70 -------------------SALDCYNPMTNQWSPCAP-MSVPRN---------RIGVGVIDGHIYAVGGSHGCIHHNSVE  120 (288)
T ss_dssp             -------------------CCEEEEETTTTEEEECCC-CSSCCB---------TCEEEEETTEEEEECCEETTEECCCEE
T ss_pred             -------------------chhhhccccccccccccc-ccceec---------ceeccccceeeEEecceecccccceee
Confidence                               011223333333433322 233443         348899999999999998777788899


Q ss_pred             EEeCCCCcEEeCCCCCCCccceEEEEECCEEEEEcCcCCCCccceEEEEeCCCCcEEecCCCCCCCcceEEEEECCEEEE
Q psy11771        162 RYDPLTGVWSSCPAMTTRRRYCRIAVVENCLYALGGFDSTNYQASVERLDPRMGKWAPVPSMSSRRSSCGVAALDGAIYC  241 (347)
Q Consensus       162 ~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv  241 (347)
                      .||+.++.|...+.++..|..++++..++++|++||........+++.||+.+++|...+..+..+..++++..+++||+
T Consensus       121 ~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i  200 (288)
T d1zgka1         121 RYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYA  200 (288)
T ss_dssp             EEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEE
T ss_pred             eeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEeeccccccccccccccccccccccceeeeEEE
Confidence            99999999999999999999999999999999999988777788999999999999999999999999999999999999


Q ss_pred             EcccCCCccCCeEEEEECCCCeEEEcCCCCCCCcceEEEEECCEEEEEeccCCCCCccEEEEEeCCCCcEEEccCCCCCc
Q psy11771        242 VGGNDGTMCMSSGERFNVRRNSWEPIAPMLSRRSTHEVVNIEGYLLTMGGNDGSSSLNSVEKYDPKLNKWQLLTPMLTRR  321 (347)
Q Consensus       242 ~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~~~r  321 (347)
                      +||.+.....++.+.||..+++|+.++++|.+|..|+++.++++|||+||.++....+++++||+++++|+.+++||.+|
T Consensus       201 ~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R  280 (288)
T d1zgka1         201 AGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGR  280 (288)
T ss_dssp             ECCBCSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCC
T ss_pred             ecCccccccccceeeeeecceeeecccCccCcccceEEEEECCEEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCc
Confidence            99998888889999999999999999999999999999999999999999988788899999999999999999999999


Q ss_pred             ceeEEEE
Q psy11771        322 SSIGAAV  328 (347)
Q Consensus       322 ~~~~~~~  328 (347)
                      .+|++|+
T Consensus       281 ~~~~~~~  287 (288)
T d1zgka1         281 SGVGVAV  287 (288)
T ss_dssp             BSCEEEE
T ss_pred             EeEEEEE
Confidence            9999886
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure