Psyllid ID: psy11774

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----

MFRNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPGESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNCNCYGLIVPKSKREGRQDRRKPAAPLFQFYSSKIDETRNEKMREEDEEEKRRR

ccccHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccHHHHHcccccccccccEEEEEEcccccccccccEEEEEccccccccccccccccccccHHHcHHHHHHHccccccccccccEEEcccHHHHHHccccccccEEcccHHHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHcccccccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcc

cHHHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEEEccHHHHHHccccccccccccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHcHcHHHHHHcccccccccc

mfrnylycwqttffysthfpcpsfpgailcflpgwqDIIQVSRVLSAIPGLLVTMAHSkldtevqgaifghpppgmrkVVLSTnvaetsitiddvayvvdtgchketrynskddlvsLDNQWISRASVNqragragrtkpgesfhlysEDRYRRMAeyslpeifrKPLEQILLTCkvgeslysTERCSSFlsqlpeppdpasiTSAATELKLmgvfdqeenltplgkriaampchpklSKALVESVIYKgncncyglivpkskregrqdrrkpaaplfqfyssKIDETRNEKMREEDEEEKRRR

MFRNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIfghpppgmRKVVLSTNVAEtsitiddvayvVDTGCHKEtrynskddlvsldNQWISRASvnqragragrtkpgesfhlysedRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNCNCYGLivpkskregrqdrrkpaaplfqfysskidetrnekmreedeeekrrr

**RNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWIS*******************FHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCS*********************LKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNCNCYGLIV*********************************************

MFRNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRAS*************GESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNCNCYGLIVPKSK********KPAAPLFQFYSSKIDE*****************

MFRNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRAS***********KPGESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNCNCYGLIVPKSKREGRQDRRKPAAPLFQFYSS**D******************

iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		304	2.2.26 [Sep-21-2011]
Q2NKY8		1220	Putative ATP-dependent RN	yes	N/A	0.75	0.186	0.428	8e-50
Q5ZI74		1231	Putative ATP-dependent RN	yes	N/A	0.726	0.179	0.441	1e-49
Q7L2E3		1194	Putative ATP-dependent RN	yes	N/A	0.75	0.190	0.424	2e-49
Q5BJS0		1194	Putative ATP-dependent RN	yes	N/A	0.75	0.190	0.420	3e-49
Q99PU8		1217	Putative ATP-dependent RN	yes	N/A	0.75	0.187	0.420	4e-49
Q5R607		1194	Putative ATP-dependent RN	yes	N/A	0.75	0.190	0.420	7e-49
Q8VHK9		1001	Probable ATP-dependent RN	no	N/A	0.720	0.218	0.385	5e-45
Q9H2U1		1008	Probable ATP-dependent RN	no	N/A	0.720	0.217	0.385	7e-45
Q6P5D3		1388	Putative ATP-dependent RN	no	N/A	0.736	0.161	0.388	3e-41
Q6P158		1386	Putative ATP-dependent RN	no	N/A	0.736	0.161	0.388	3e-41

>sp\|Q2NKY8\|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1	Back alignment and function desciption

 Score =  197 bits (501), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 102/238 (42%), Positives = 149/238 (62%), Gaps = 10/238 (4%)

Query: 18  HFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGL-----LVTMAHSKLDTEVQGAIFGHP 72
           H      PG ILCFLPGWQ+I  V + L    G+     L+   HS +    Q AIF  P
Sbjct: 687 HIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPVHSNIPMMDQKAIFQQP 746

Query: 73  PPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRA 132
           P G+RK+VL+TN+AETSITI+D+ +VVD+G HKE RY+ K  +  L+  W+SRA+V QR 
Sbjct: 747 PIGVRKIVLATNIAETSITINDIVHVVDSGLHKEERYDLKTKVSCLETVWVSRANVIQRR 806

Query: 133 GRAGRTKPGESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCS-SFL 191
           GRAGR + G ++HL+   R  +MA + +PEI R PLE ++L  K+    +  E+ +  FL
Sbjct: 807 GRAGRCQSGFAYHLFPRSRLEKMAPFQVPEILRTPLENLVLQAKI----HMPEKTAVEFL 862

Query: 192 SQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYK 249
           S+  + P+  ++  A   L+ +GV DQ E LT LG+R+A +   P+L+KA+V + I++
Sbjct: 863 SKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFR 920

Associates with mitochondrial DNA.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q5ZI74\|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1	Back alignment and function description

>sp\|Q7L2E3\|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1	Back alignment and function description

>sp\|Q5BJS0\|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1	Back alignment and function description

>sp\|Q99PU8\|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=2 SV=1	Back alignment and function description

>sp\|Q5R607\|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1	Back alignment and function description

>sp\|Q8VHK9\|DHX36_MOUSE Probable ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=2 SV=2	Back alignment and function description

>sp\|Q9H2U1\|DHX36_HUMAN Probable ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2	Back alignment and function description

>sp\|Q6P5D3\|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=2 SV=2	Back alignment and function description

>sp\|Q6P158\|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		304
270010085		1007	hypothetical protein TcasGA2_TC009437 [T	0.723	0.218	0.484	8e-57
307173238		872	Putative ATP-dependent RNA helicase DHX3	0.746	0.260	0.456	5e-55
345489731		1008	PREDICTED: putative ATP-dependent RNA he	0.726	0.219	0.440	1e-54
328705567		964	PREDICTED: putative ATP-dependent RNA he	0.726	0.229	0.495	4e-53
410923739		949	PREDICTED: putative ATP-dependent RNA he	0.730	0.233	0.443	2e-52
348500733		1156	PREDICTED: putative ATP-dependent RNA he	0.730	0.192	0.443	1e-51
432917465		1126	PREDICTED: putative ATP-dependent RNA he	0.720	0.194	0.450	1e-51
321478026		562	hypothetical protein DAPPUDRAFT_41608 [D	0.723	0.391	0.469	1e-51
47220387		882	unnamed protein product [Tetraodon nigro	0.723	0.249	0.443	2e-50
390335207		932	PREDICTED: putative ATP-dependent RNA he	0.726	0.237	0.462	2e-49

>gi\|270010085\|gb\|EFA06533.1\| hypothetical protein TcasGA2_TC009437 [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  226 bits (577), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 151/225 (67%), Gaps = 5/225 (2%)

Query: 26  GAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNV 85
           GAILCFLPGW+DI++V +++     L V   HS+L    Q  IF   PPG+RKV+LSTN+
Sbjct: 556 GAILCFLPGWEDIVKVQKLIPMRGDLAVLCLHSRLQDSDQRKIFSRTPPGVRKVILSTNI 615

Query: 86  AETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPGESFH 145
           AETS+TIDDV YVVDTG HKE R+++   +  +DN WIS++S+ QR GRAGR +PGESFH
Sbjct: 616 AETSVTIDDVVYVVDTGIHKENRFDNAKGVTCIDNYWISQSSMTQRRGRAGRVRPGESFH 675

Query: 146 LYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCS-SFLSQLPEPPDPASIT 204
           LY++ +Y   + ++ PEI +  L +I+L  KV    YS    +  F+SQLP PP+  +  
Sbjct: 676 LYTKSKYDSFSPFTDPEILKTSLTKIVLNSKV----YSNNMDALEFMSQLPSPPEKNTTR 731

Query: 205 SAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYK 249
            A  ELK + + D+ ENLT LG+ +A     PKL+K LV +V++K
Sbjct: 732 RAVRELKDLQLLDENENLTSLGRVLANFQLEPKLAKVLVNAVVFK 776

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307173238\|gb\|EFN64291.1\| Putative ATP-dependent RNA helicase DHX30 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|345489731\|ref\|XP_003426215.1\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like isoform 2 [Nasonia vitripennis] gi\|345489733\|ref\|XP_001600929.2\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like isoform 1 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328705567\|ref\|XP_003242846.1\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|410923739\|ref\|XP_003975339.1\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like [Takifugu rubripes]	Back alignment and taxonomy information

>gi\|348500733\|ref\|XP_003437927.1\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like [Oreochromis niloticus]	Back alignment and taxonomy information

>gi\|432917465\|ref\|XP_004079522.1\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like [Oryzias latipes]	Back alignment and taxonomy information

>gi\|321478026\|gb\|EFX88984.1\| hypothetical protein DAPPUDRAFT_41608 [Daphnia pulex]	Back alignment and taxonomy information

>gi\|47220387\|emb\|CAF98486.1\| unnamed protein product [Tetraodon nigroviridis]	Back alignment and taxonomy information

>gi\|390335207\|ref\|XP_783104.3\| PREDICTED: putative ATP-dependent RNA helicase DHX30-like [Strongylocentrotus purpuratus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		304
UNIPROTKB\|F1N0J0		1220	DHX30 "Putative ATP-dependent	0.75	0.186	0.428	6.4e-45
UNIPROTKB\|Q2NKY8		1220	DHX30 "Putative ATP-dependent	0.75	0.186	0.428	6.4e-45
UNIPROTKB\|F1P1F4		1231	DHX30 "Putative ATP-dependent	0.726	0.179	0.441	8.4e-45
UNIPROTKB\|Q5ZI74		1231	DHX30 "Putative ATP-dependent	0.726	0.179	0.441	8.4e-45
UNIPROTKB\|H7BXY3		1166	DHX30 "Putative ATP-dependent	0.75	0.195	0.424	1.2e-44
UNIPROTKB\|Q7L2E3		1194	DHX30 "Putative ATP-dependent	0.75	0.190	0.424	1.3e-44
UNIPROTKB\|F1SLI4		1222	DHX30 "Uncharacterized protein	0.75	0.186	0.424	1.3e-44
UNIPROTKB\|J9P3P6		1135	DHX30 "Uncharacterized protein	0.75	0.200	0.420	1.5e-44
UNIPROTKB\|J9P264		1219	DHX30 "Uncharacterized protein	0.75	0.187	0.420	1.7e-44
UNIPROTKB\|E2RL62		1222	DHX30 "Uncharacterized protein	0.75	0.186	0.420	1.7e-44

UNIPROTKB\|F1N0J0 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

 Score = 484 (175.4 bits), Expect = 6.4e-45, P = 6.4e-45
 Identities = 102/238 (42%), Positives = 149/238 (62%)

Query:    18 HFPCPSFPGAILCFLPGWQDIIQVSRVLSAIPGL-----LVTMAHSKLDTEVQGAIFGHP 72
             H      PG ILCFLPGWQ+I  V + L    G+     L+   HS +    Q AIF  P
Sbjct:   687 HIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPVHSNIPMMDQKAIFQQP 746

Query:    73 PPGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRA 132
             P G+RK+VL+TN+AETSITI+D+ +VVD+G HKE RY+ K  +  L+  W+SRA+V QR 
Sbjct:   747 PIGVRKIVLATNIAETSITINDIVHVVDSGLHKEERYDLKTKVSCLETVWVSRANVIQRR 806

Query:   133 GRAGRTKPGESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCS-SFL 191
             GRAGR + G ++HL+   R  +MA + +PEI R PLE ++L  K+    +  E+ +  FL
Sbjct:   807 GRAGRCQSGFAYHLFPRSRLEKMAPFQVPEILRTPLENLVLQAKI----HMPEKTAVEFL 862

Query:   192 SQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYK 249
             S+  + P+  ++  A   L+ +GV DQ E LT LG+R+A +   P+L+KA+V + I++
Sbjct:   863 SKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFR 920

GO:0042645 "mitochondrial nucleoid" evidence=IEA

GO:0003682 "chromatin binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0008026 "ATP-dependent helicase activity" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

UNIPROTKB\|Q2NKY8 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P1F4 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZI74 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|H7BXY3 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7L2E3 DHX30 "Putative ATP-dependent RNA helicase DHX30" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SLI4 DHX30 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P3P6 DHX30 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P264 DHX30 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RL62 DHX30 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		304
COG1643		845	COG1643, HrpA, HrpA-like helicases [DNA replicatio	1e-68
TIGR01970		819	TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H	4e-43
PRK11664		812	PRK11664, PRK11664, ATP-dependent RNA helicase Hrp	1e-38
TIGR01967		1283	TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H	4e-35
PRK11131		1294	PRK11131, PRK11131, ATP-dependent RNA helicase Hrp	7e-27
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	1e-11
pfam04408		91	pfam04408, HA2, Helicase associated domain (HA2)	1e-10
smart00847		82	smart00847, HA2, Helicase associated domain (HA2)	2e-09
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	3e-09
PHA02653		675	PHA02653, PHA02653, RNA helicase NPH-II; Provision	1e-06
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	2e-05

>gnl\|CDD\|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

 Score =  227 bits (582), Expect = 1e-68
 Identities = 89/229 (38%), Positives = 132/229 (57%), Gaps = 12/229 (5%)

Query: 25  PGAILCFLPGWQDIIQVSRVLSAI---PGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVL 81
            G+IL FLPG ++I + +  L        L +   +  L  E Q  +F   P G RKVVL
Sbjct: 259 SGSILVFLPGQREIERTAEWLEKAELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVL 318

Query: 82  STNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPG 141
           +TN+AETS+TI  + YV+D+G  KE RY+ +  L  L+ + IS+AS +QRAGRAGRT PG
Sbjct: 319 ATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPG 378

Query: 142 ESFHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLP--EPPD 199
             + LYSE+ +    E++LPEI R  L  ++L  K   SL         ++  P  +PP 
Sbjct: 379 ICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQLK---SL----GIGQDIAPFPFLDPPP 431

Query: 200 PASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIY 248
            A+I +A T L+ +G  D    LTPLGK+++ +P  P+L++ L+ +   
Sbjct: 432 EAAIQAALTLLQELGALDDSGKLTPLGKQMSLLPLDPRLARMLLTAPEG 480

Length = 845

>gnl\|CDD\|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB	Back alignment and domain information

>gnl\|CDD\|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>gnl\|CDD\|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA	Back alignment and domain information

>gnl\|CDD\|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|218070 pfam04408, HA2, Helicase associated domain (HA2)	Back alignment and domain information

>gnl\|CDD\|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		304
KOG0923\|consensus		902		100.0
KOG0922\|consensus		674		100.0
KOG0924\|consensus		1042		100.0
KOG0925\|consensus		699		100.0
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	100.0
KOG0920\|consensus		924		100.0
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	100.0
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
KOG0926\|consensus		1172		100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
KOG0921\|consensus		1282		99.97
PRK01172		674	ski2-like helicase; Provisional	99.86
PRK02362		737	ski2-like helicase; Provisional	99.81
KOG0331\|consensus		519		99.79
KOG0345\|consensus		567		99.76
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	99.74
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	99.73
KOG0330\|consensus		476		99.72
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	99.72
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.72
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	99.71
PTZ00110		545	helicase; Provisional	99.71
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	99.71
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	99.71
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.71
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.7
PRK00254		720	ski2-like helicase; Provisional	99.7
PTZ00424		401	helicase 45; Provisional	99.7
KOG0333\|consensus		673		99.7
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	99.7
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.68
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	99.66
KOG0340\|consensus		442		99.64
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.64
KOG0342\|consensus		543		99.63
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.62
KOG0328\|consensus		400		99.61
KOG0347\|consensus		731		99.56
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.55
KOG0332\|consensus		477		99.54
KOG0343\|consensus		758		99.53
KOG0335\|consensus		482		99.53
PRK10689		1147	transcription-repair coupling factor; Provisional	99.51
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.51
PRK13767		876	ATP-dependent helicase; Provisional	99.49
KOG0336\|consensus		629		99.49
KOG0348\|consensus		708		99.49
KOG0339\|consensus		731		99.49
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.48
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.48
KOG0341\|consensus		610		99.48
PF04408		102	HA2: Helicase associated domain (HA2); InterPro: I	99.47
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.47
KOG0326\|consensus		459		99.45
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.45
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.45
KOG0338\|consensus		691		99.43
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.42
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.42
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.41
PRK05298		652	excinuclease ABC subunit B; Provisional	99.39
KOG0344\|consensus		593		99.39
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.39
smart00847		92	HA2 Helicase associated domain (HA2) Add an annota	99.38
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.38
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.37
PRK13766		773	Hef nuclease; Provisional	99.36
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.35
KOG0350\|consensus		620		99.33
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.32
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.3
COG1202		830	Superfamily II helicase, archaea-specific [General	99.28
KOG0354\|consensus		746		99.26
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.25
PHA02558		501	uvsW UvsW helicase; Provisional	99.24
KOG0349\|consensus		725		99.21
PRK04914		956	ATP-dependent helicase HepA; Validated	99.2
KOG0327\|consensus		397		99.19
KOG0334\|consensus		997		99.15
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.14
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.12
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.11
COG1204		766	Superfamily II helicase [General function predicti	99.1
PRK09694		878	helicase Cas3; Provisional	99.1
KOG0351\|consensus		941		99.09
KOG0921\|consensus		1282		99.08
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.06
KOG4284\|consensus		980		99.01
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.01
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.0
KOG0352\|consensus		641		98.99
PRK14701		1638	reverse gyrase; Provisional	98.78
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	98.74
KOG0346\|consensus		569		98.74
TIGR00595		505	priA primosomal protein N'. All proteins in this f	98.74
KOG0337\|consensus		529		98.73
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	98.64
KOG0953\|consensus		700		98.62
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	98.61
PRK12904		830	preprotein translocase subunit SecA; Reviewed	98.61
PRK09401		1176	reverse gyrase; Reviewed	98.56
PRK13107		908	preprotein translocase subunit SecA; Reviewed	98.53
PRK05580		679	primosome assembly protein PriA; Validated	98.5
KOG0353\|consensus		695		98.46
KOG0951\|consensus		1674		98.41
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	98.35
COG1205		851	Distinct helicase family with a unique C-terminal	98.31
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	98.28
KOG4150\|consensus		1034		98.24
KOG0950\|consensus		1008		98.23
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	98.13
KOG0948\|consensus		1041		97.97
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	97.74
KOG0952\|consensus		1230		97.66
KOG0947\|consensus		1248		97.65
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	97.64
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	97.64
PRK12326		764	preprotein translocase subunit SecA; Reviewed	97.44
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	97.17
KOG0329\|consensus		387		96.88
KOG1123\|consensus		776		96.83
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	96.82
KOG0391\|consensus		1958		96.77
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	96.71
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	96.69
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	96.69
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	96.61
COG4096		875	HsdR Type I site-specific restriction-modification	96.5
KOG0385\|consensus		971		96.48
KOG0384\|consensus		1373		96.4
KOG0392\|consensus		1549		96.34
CHL00122		870	secA preprotein translocase subunit SecA; Validate	96.29
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	96.15
KOG0389\|consensus		941		95.98
KOG0387\|consensus		923		95.8
KOG0949\|consensus		1330		95.78
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	95.28
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	94.92
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	94.68
PRK05580		679	primosome assembly protein PriA; Validated	94.57
KOG0390\|consensus		776		94.25
TIGR00595		505	priA primosomal protein N'. All proteins in this f	94.16
COG1198		730	PriA Primosomal protein N' (replication factor Y)	93.68
PRK14873		665	primosome assembly protein PriA; Provisional	93.39
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	93.36
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	93.32
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	93.2
KOG0388\|consensus		1185		92.59
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	92.39
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	92.1
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	91.91
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	91.57
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	91.26
KOG0347\|consensus		731		90.99
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	90.86
KOG0331\|consensus		519		89.52
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	88.5
PF13871		278	Helicase_C_4: Helicase_C-like	88.05
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	87.93
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	87.93
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	87.63
COG1198		730	PriA Primosomal protein N' (replication factor Y)	87.53
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	87.27
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	86.53
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	86.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	85.32
PRK10689		1147	transcription-repair coupling factor; Provisional	84.58
KOG1015\|consensus		1567		83.13
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	82.12
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	81.86
PRK14701		1638	reverse gyrase; Provisional	81.26
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	80.82
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	80.58

>KOG0923\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.3e-69  Score=524.45  Aligned_cols=281  Identities=37%  Similarity=0.535  Sum_probs=265.9

Q ss_pred             ccccchhchhhhhhhccCCCCCCCcEEEEcCCHHHHHHHHHHHhcC--------CCcEEEEecCCCCHHHHhhhhcCCCC
Q psy11774          3 RNYLYCWQTTFFYSTHFPCPSFPGAILCFLPGWQDIIQVSRVLSAI--------PGLLVTMAHSKLDTEVQGAIFGHPPP   74 (304)
Q Consensus         3 ~~Yl~~~~~~~~~~~~i~~~~~~g~iLVFlp~~~ei~~~~~~L~~~--------~~~~v~~lhs~l~~~~q~~~~~~~~~   74 (304)
                      .||+.+...+++   .|..+++.||||||++|.++|+.+.+.|.+.        ..+-++|+|++||.+.|.++|++.|+
T Consensus       454 AdYldAai~tVl---qIH~tqp~GDILVFltGQeEIEt~~e~l~~~~~~LGski~eliv~PiYaNLPselQakIFePtP~  530 (902)
T KOG0923|consen  454 ADYLDAAIVTVL---QIHLTQPLGDILVFLTGQEEIETVKENLKERCRRLGSKIRELIVLPIYANLPSELQAKIFEPTPP  530 (902)
T ss_pred             hhHHHHHHhhhe---eeEeccCCccEEEEeccHHHHHHHHHHHHHHHHHhccccceEEEeeccccCChHHHHhhcCCCCC
Confidence            589999999988   4445677899999999999999999888532        45899999999999999999999999


Q ss_pred             CCeEEEEeccccccCCCCCCeeEEEeCCCccceeecCCCCcccccceecchhhhhhhccccCCCCCccceeccCHHHHh-
Q psy11774         75 GMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPGESFHLYSEDRYR-  153 (304)
Q Consensus        75 g~~kvilaTniae~sitI~~V~~VID~g~~k~~~yd~~~~~~~l~~~~isk~~~~QR~GRaGR~~~G~c~rL~t~~~~~-  153 (304)
                      |.|||||||||||||+||+||.||||+|++|+..|+|++|+.+|...||||+++.||+|||||++||+||||||...|. 
T Consensus       531 gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynprtGmesL~v~piSKAsA~QRaGRAGRtgPGKCfRLYt~~aY~~  610 (902)
T KOG0923|consen  531 GARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNPRTGMESLLVTPISKASANQRAGRAGRTGPGKCFRLYTAWAYEH  610 (902)
T ss_pred             CceeEEEeecchhhceeecCeEEEecCccccccCcCCCcCceeEEEeeechhhhhhhccccCCCCCCceEEeechhhhhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             hhhhcCCCcccccchHHHHHHhh-cCCCccCCcccccccccCCCCCCHHHHHHHHHHHHHcCCcccCCCcccchhhhccC
Q psy11774        154 RMAEYSLPEIFRKPLEQILLTCK-VGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAM  232 (304)
Q Consensus       154 ~~~~~~~pei~r~~L~~~~L~lk-~~~~~~~~~~~~~fl~~~~~pP~~~~l~~al~~L~~lgald~~~~lT~lG~~l~~l  232 (304)
                      .+.+.+.|||+|++|..++|.+| +|++   ++-.|+||    |||+.+++..||+.|+.+|||+..|.||.+|+.|++|
T Consensus       611 eLE~~t~PEIqRtnL~nvVL~LkSLGI~---Dl~~FdFm----DpPp~etL~~aLE~LyaLGALn~~GeLTk~GrrMaEf  683 (902)
T KOG0923|consen  611 ELEEMTVPEIQRTNLGNVVLLLKSLGIH---DLIHFDFL----DPPPTETLLKALEQLYALGALNHLGELTKLGRRMAEF  683 (902)
T ss_pred             hhccCCCcceeeccchhHHHHHHhcCcc---hhcccccC----CCCChHHHHHHHHHHHHhhccccccchhhhhhhhhhc
Confidence            78889999999999999999999 9999   99999999    9999999999999999999999999999999999999


Q ss_pred             CCchhhhHHHHHhhccCCcc-----------cCCceecCCCcHHHHHHHhcccC-------hHHHHHHHHHHhhhcchh
Q psy11774        233 PCHPKLSKALVESVIYKGNC-----------NCYGLIVPKSKREGRQDRRKPAA-------PLFQFYSSKIDETRNEKM  293 (304)
Q Consensus       233 pl~p~~~k~l~~~~~~~C~~-----------~~~~f~~p~~~~~~~~~~~~~~~-------~l~~~y~~~~~~~~~~~~  293 (304)
                      |+||+++|||+.+..++|.+           ..++|++|.++...++.+++.|.       .++++|++|.....|.+|
T Consensus       684 P~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrpk~~~v~ad~a~~~f~~~~gDhi~~L~vyn~w~es~~s~~w  762 (902)
T KOG0923|consen  684 PVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRPKDKQVHADNARKNFEEPVGDHIVLLNVYNQWKESKYSTQW  762 (902)
T ss_pred             CCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecchhhhhhhhhhhhccCCCCcchhhhhHHHHHHhhcchhhHH
Confidence            99999999999999999996           66799999999988888877664       899999999999999998

>KOG0922\|consensus	Back alignment and domain information

>KOG0924\|consensus	Back alignment and domain information

>KOG0925\|consensus	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0920\|consensus	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>KOG0926\|consensus	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>KOG0921\|consensus	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0331\|consensus	Back alignment and domain information

>KOG0345\|consensus	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0330\|consensus	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0333\|consensus	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>KOG0340\|consensus	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0342\|consensus	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0328\|consensus	Back alignment and domain information

>KOG0347\|consensus	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>KOG0332\|consensus	Back alignment and domain information

>KOG0343\|consensus	Back alignment and domain information

>KOG0335\|consensus	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>KOG0336\|consensus	Back alignment and domain information

>KOG0348\|consensus	Back alignment and domain information

>KOG0339\|consensus	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0341\|consensus	Back alignment and domain information

>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0326\|consensus	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>KOG0338\|consensus	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>KOG0344\|consensus	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>smart00847 HA2 Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0350\|consensus	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0354\|consensus	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>KOG0349\|consensus	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0327\|consensus	Back alignment and domain information

>KOG0334\|consensus	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>KOG0351\|consensus	Back alignment and domain information

>KOG0921\|consensus	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>KOG4284\|consensus	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0352\|consensus	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0346\|consensus	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG0337\|consensus	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>KOG0953\|consensus	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0353\|consensus	Back alignment and domain information

>KOG0951\|consensus	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>KOG4150\|consensus	Back alignment and domain information

>KOG0950\|consensus	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0948\|consensus	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>KOG0952\|consensus	Back alignment and domain information

>KOG0947\|consensus	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>KOG0329\|consensus	Back alignment and domain information

>KOG1123\|consensus	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0391\|consensus	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0385\|consensus	Back alignment and domain information

>KOG0384\|consensus	Back alignment and domain information

>KOG0392\|consensus	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0389\|consensus	Back alignment and domain information

>KOG0387\|consensus	Back alignment and domain information

>KOG0949\|consensus	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0390\|consensus	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG0388\|consensus	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>KOG0347\|consensus	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0331\|consensus	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG1015\|consensus	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		304
3kx2_B		767	Crystal Structure Of Prp43p In Complex With Adp Len		3e-29
2xau_A		773	Crystal Structure Of The Prp43p Deah-Box Rna Helica		3e-29

>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767

Back alignment and structure

Iteration: 1

Score = 125 bits (314), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 90/241 (37%), Positives = 121/241 (50%), Gaps = 24/241 (9%) Query: 26 GAILCFLPGWQDIIQVSRVLSAIPGLLVTMA----------HSKLDTEVQGAIFGHPP-- 73 G IL FL G +I R +S LV + L Q IF P Sbjct: 304 GDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPES 363 Query: 74 ----PGMRKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVN 129 PG RKVV+STN+AETS+TID + YVVD G K+ YN + + SL IS+AS Sbjct: 364 HNGRPG-RKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQ 422 Query: 130 QRAGRAGRTKPGESFHLYSEDRYRR-MAEYSLPEIFRKPLEQILLTCKVGESLYSTERCS 188 QRAGRAGRT+PG+ F LY+E+ +++ + E S PEI R L +L K + Sbjct: 423 QRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKK----LGIDDLV 478 Query: 189 SFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIY 248 F +PP P ++ A EL + D E NLTPLG+ + P P L+ L+ S + Sbjct: 479 HF--DFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEF 536 Query: 249 K 249 + Sbjct: 537 Q 537

PyMOL of 3kx2

>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		304
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	8e-59
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	2e-32
1yks_A		440	Genome polyprotein [contains: flavivirin protease	4e-31
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	4e-31
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	4e-31
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	5e-31
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	2e-29
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	2e-28
3i4u_A		270	ATP-dependent RNA helicase DHX8; splicing, ATP-bin	7e-09

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773	Back alignment and structure

 Score =  199 bits (509), Expect = 8e-59
 Identities = 88/244 (36%), Positives = 120/244 (49%), Gaps = 28/244 (11%)

Query: 25  PGAILCFLPGWQDIIQVSRVLS----------AIPGLLVTMAHSKLDTEVQGAIFGHPPP 74
            G IL FL G  +I    R +S              L V   +  L    Q  IF   P 
Sbjct: 303 AGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPE 362

Query: 75  GM-----RKVVLSTNVAETSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVN 129
                  RKVV+STN+AETS+TID + YVVD G  K+  YN +  + SL    IS+AS  
Sbjct: 363 SHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQ 422

Query: 130 QRAGRAGRTKPGESFHLYSEDRYR-RMAEYSLPEIFRKPLEQILLTCK---VGESLYSTE 185
           QRAGRAGRT+PG+ F LY+E+ ++  + E S PEI R  L   +L  K   + + +    
Sbjct: 423 QRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLV---- 478

Query: 186 RCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVES 245
               F+     PP P ++  A  EL  +   D E NLTPLG+  +  P  P L+  L+ S
Sbjct: 479 HF-DFMD----PPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGS 533

Query: 246 VIYK 249
             ++
Sbjct: 534 FEFQ 537

PyMOL of 2xau

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673	Back alignment and structure

>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		304
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	100.0
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	99.97
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	99.96
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	99.94
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	99.93
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	99.92
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	99.86
3i4u_A		270	ATP-dependent RNA helicase DHX8; splicing, ATP-bin	99.81
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	99.8
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	99.79
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	99.79
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	99.79
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	99.78
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	99.78
1yks_A		440	Genome polyprotein [contains: flavivirin protease	99.76
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	99.76
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	99.75
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	99.75
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	99.74
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	99.74
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	99.59
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	99.73
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	99.73
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	99.73
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	99.72
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	99.72
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	99.72
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	99.72
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	99.71
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	99.7
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	99.7
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	99.7
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	99.7
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	99.68
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	99.67
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	99.66
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	99.65
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	99.65
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.64
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	99.64
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	99.64
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	99.63
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	99.62
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	99.61
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	99.61
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.6
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	99.59
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	99.58
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	99.58
4gl2_A		699	Interferon-induced helicase C domain-containing P;	99.57
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	99.55
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	99.53
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	99.52
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	99.49
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	99.44
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	99.4
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	99.39
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	99.36
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	99.3
3jux_A		822	Protein translocase subunit SECA; protein transloc	99.28
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	99.27
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	99.27
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	99.25
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.22
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	99.21
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	99.18
3h1t_A		590	Type I site-specific restriction-modification syst	99.13
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.02
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	98.89
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	98.81
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	98.19
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	97.05
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	95.66
3hgt_A		328	HDA1 complex subunit 3; RECA-like domain, SWI2/SNF	88.74
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	88.46
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	88.36
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	88.26
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	87.59
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	86.89
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	85.4
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	85.29
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	85.14
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	84.38
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	84.34
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	83.75
3bor_A		237	Human initiation factor 4A-II; translation initiat	83.22
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	80.43

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

Probab=100.00  E-value=1.9e-52  Score=431.98  Aligned_cols=259  Identities=37%  Similarity=0.534  Sum_probs=244.3

Q ss_pred             CCCCcEEEEcCCHHHHHHHHHHHhc----------CCCcEEEEecCCCCHHHHhhhhcCCC-----CCCeEEEEeccccc
Q psy11774         23 SFPGAILCFLPGWQDIIQVSRVLSA----------IPGLLVTMAHSKLDTEVQGAIFGHPP-----PGMRKVVLSTNVAE   87 (304)
Q Consensus        23 ~~~g~iLVFlp~~~ei~~~~~~L~~----------~~~~~v~~lhs~l~~~~q~~~~~~~~-----~g~~kvilaTniae   87 (304)
                      ..+|++|||+||+++++.+++.|.+          ..++.+.++||+|++++|.++++.++     .|.++||||||+||
T Consensus       301 ~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae  380 (773)
T 2xau_A          301 EEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAE  380 (773)
T ss_dssp             SCSCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHH
T ss_pred             cCCCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHH
Confidence            4589999999999999999999874          25689999999999999999999999     99999999999999


Q ss_pred             cCCCCCCeeEEEeCCCccceeecCCCCcccccceecchhhhhhhccccCCCCCccceeccCHHHH-hhhhhcCCCccccc
Q psy11774         88 TSITIDDVAYVVDTGCHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPGESFHLYSEDRY-RRMAEYSLPEIFRK  166 (304)
Q Consensus        88 ~sitI~~V~~VID~g~~k~~~yd~~~~~~~l~~~~isk~~~~QR~GRaGR~~~G~c~rL~t~~~~-~~~~~~~~pei~r~  166 (304)
                      +|||||+|++|||+|+++.+.||+..++..|...|+|+++|.||+|||||.++|.||+||++++| ..+.+++.|||++.
T Consensus       381 ~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~  460 (773)
T 2xau_A          381 TSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRS  460 (773)
T ss_dssp             HTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGS
T ss_pred             hCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999 57999999999999


Q ss_pred             chHHHHHHhh-cCCCccCCcccccccccCCCCCCHHHHHHHHHHHHHcCCcccCCCcccchhhhccCCCchhhhHHHHHh
Q psy11774        167 PLEQILLTCK-VGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVES  245 (304)
Q Consensus       167 ~L~~~~L~lk-~~~~~~~~~~~~~fl~~~~~pP~~~~l~~al~~L~~lgald~~~~lT~lG~~l~~lpl~p~~~k~l~~~  245 (304)
                      +|+.++|++| +|+.   +...|+|+    +||+.+++..|++.|..+||||++|+||++|+.|+.||+||++||||+.|
T Consensus       461 ~L~~~~L~l~~~gi~---~~~~f~~~----~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~  533 (773)
T 2xau_A          461 NLSSTVLELKKLGID---DLVHFDFM----DPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGS  533 (773)
T ss_dssp             CCHHHHHHHHHTTCC---CGGGCCCS----SCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHG
T ss_pred             cHHHHHHHHHHcCCC---Chhhcccc----CCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhh
Confidence            9999999999 9988   77778888    99999999999999999999999999999999999999999999999999


Q ss_pred             hccCCcc----------cCCceecCCCcHHHHHHHhcccC-------hHHHHHHHHHHhh
Q psy11774        246 VIYKGNC----------NCYGLIVPKSKREGRQDRRKPAA-------PLFQFYSSKIDET  288 (304)
Q Consensus       246 ~~~~C~~----------~~~~f~~p~~~~~~~~~~~~~~~-------~l~~~y~~~~~~~  288 (304)
                      ..|+|++          +++||+.|.+.+++++.+|+.|+       +++|+|+.|.+..
T Consensus       534 ~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~  593 (773)
T 2xau_A          534 FEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDE  593 (773)
T ss_dssp             GGGTCHHHHHHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHH
T ss_pred             cccCchhHHHHHHHhcccCCcccCChHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhc
Confidence            9999988          78999999999999998888774       8889999885544

PyMOL of 2xau

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens}	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		304
d1yksa2		299	c.37.1.14 (A:325-623) YFV helicase domain {Yellow	1e-26
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	2e-14
d1wp9a2		286	c.37.1.19 (A:201-486) putative ATP-dependent RNA h	8e-04

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  104 bits (260), Expect = 1e-26
 Identities = 33/226 (14%), Positives = 60/226 (26%), Gaps = 20/226 (8%)

Query: 24  FPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLST 83
                  FLP  +    ++  L    G  V + + K        I           +L+T
Sbjct: 35  DKRPTAWFLPSIRAANVMAASLRKA-GKSVVVLNRKTFEREYPTIKQK----KPDFILAT 89

Query: 84  NVAETSITIDDVAYVVDTG-CHKETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPGE 142
           ++AE    +  V  V+D     K    +    +       IS +S  QR GR GR    +
Sbjct: 90  DIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRD 148

Query: 143 S----FHLYSEDRYRRMAEYSLPEIFRKPLEQILLTCKVGESLYSTERCSSFLSQLPEPP 198
                +   + +       +    +    +E       +   LY  E   +         
Sbjct: 149 GDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRG---GMVAPLYGVEG--TKT----PVS 199

Query: 199 DPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVE 244
                           +    +    L  ++A         K   E
Sbjct: 200 PGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTNDRKWCFE 245

PyMOL of d1yksa2

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		304
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	99.97
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	99.83
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	99.81
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.8
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	99.8
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	99.8
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	99.79
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	99.79
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	99.79
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.76
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	99.74
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	99.71
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.62
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.62
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	99.58
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	99.5
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	99.47
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	99.39
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.16
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.36
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	98.25
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	98.22
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	97.14
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	93.13
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	90.6
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	90.23
d2p6ra1		85	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	86.86
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	86.32
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	82.22

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=99.97  E-value=4.5e-32  Score=248.56  Aligned_cols=224  Identities=16%  Similarity=0.058  Sum_probs=170.1

Q ss_pred             CCCcEEEEcCCHHHHHHHHHHHhcCCCcEEEEecCCCCHHHHhhhhcCCCCCCeEEEEeccccccCCCCCCeeEEEeCCC
Q psy11774         24 FPGAILCFLPGWQDIIQVSRVLSAIPGLLVTMAHSKLDTEVQGAIFGHPPPGMRKVVLSTNVAETSITIDDVAYVVDTGC  103 (304)
Q Consensus        24 ~~g~iLVFlp~~~ei~~~~~~L~~~~~~~v~~lhs~l~~~~q~~~~~~~~~g~~kvilaTniae~sitI~~V~~VID~g~  103 (304)
                      .+|++||||||..+++.+++.|++.+ ..|++|||.++.+++.++    .+++++|||||||+|+|+|| +|++|||+|+
T Consensus        35 ~~g~~~~F~~s~~~~~~~a~~L~~~g-~~V~~l~~~~~~~e~~~~----~~~~~~~~~~t~~~~~~~~~-~~~~vid~g~  108 (299)
T d1yksa2          35 DKRPTAWFLPSIRAANVMAASLRKAG-KSVVVLNRKTFEREYPTI----KQKKPDFILATDIAEMGANL-CVERVLDCRT  108 (299)
T ss_dssp             CCSCEEEECSCHHHHHHHHHHHHHTT-CCEEECCSSSCC------------CCCSEEEESSSTTCCTTC-CCSEEEECCE
T ss_pred             cCCCEEEEeCCHHHHHHHHHHHHhcC-CeEEEEcCcCcHhHHhhh----hcCCcCEEEEechhhhceec-CceEEEecCc
Confidence            47999999999999999999999876 789999999998887654    46788999999999999999 5999999999


Q ss_pred             c-cceeecCCCCcccccceecchhhhhhhccccCCCCCc-cceeccCHHHHhhhhhcCCCcccccc----hHHHHHHhh-
Q psy11774        104 H-KETRYNSKDDLVSLDNQWISRASVNQRAGRAGRTKPG-ESFHLYSEDRYRRMAEYSLPEIFRKP----LEQILLTCK-  176 (304)
Q Consensus       104 ~-k~~~yd~~~~~~~l~~~~isk~~~~QR~GRaGR~~~G-~c~rL~t~~~~~~~~~~~~pei~r~~----L~~~~L~lk-  176 (304)
                      + |...||+.+++..+...|||++++.||+||+||...| .||.+|+..    ..+...+++.+++    ++.+.+.++ 
T Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~~~~~~~~y~~~----~~~d~~~~~~~te~~i~l~~i~l~~~~  184 (299)
T d1yksa2         109 AFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEP----TSENNAHHVCWLEASMLLDNMEVRGGM  184 (299)
T ss_dssp             EEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTTCCCEEEEECSC----CCCCCTTBHHHHHHHHHHTTSCCGGGC
T ss_pred             eeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCCCceEEEEeCCC----CCCcccchhhhhhHHHHhhCccccccc
Confidence            6 7778999999999999999999999999999998543 344555532    2223334443333    233334555 


Q ss_pred             cCCCccCCcccccccccCCCCCCHHHHHHHHHHHHHcCCcccCCCcccchhhhccCCCchhhhHHHHHhhccCCcc----
Q psy11774        177 VGESLYSTERCSSFLSQLPEPPDPASITSAATELKLMGVFDQEENLTPLGKRIAAMPCHPKLSKALVESVIYKGNC----  252 (304)
Q Consensus       177 ~~~~~~~~~~~~~fl~~~~~pP~~~~l~~al~~L~~lgald~~~~lT~lG~~l~~lpl~p~~~k~l~~~~~~~C~~----  252 (304)
                      ++..   ....++|+    ++|+.+....+++.|..+|+|+..+..+++|..++..++.+...++++.+-.-....    
T Consensus       185 ~g~~---~~~e~~~~----~~p~g~~~L~~~~~l~~l~aL~~~d~p~~La~~va~~~~~~~~~~~~f~~P~e~~i~~~~~  257 (299)
T d1yksa2         185 VAPL---YGVEGTKT----PVSPGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTNDRKWCFEGPEEHEILNDSG  257 (299)
T ss_dssp             CCCC---STTHHHHS----SSCTTTTCCCHHHHHHHHHHHHTTCCCHHHHHHHHHTTCCTTCCGGGSCSCGGGCCBCTTS
T ss_pred             cccc---chhhhccc----cCCCchhhhhHhHHHHHHHHHhhcCCCcchHHHHHhcccccccccceeECchhchhhhhhc
Confidence            5555   55667777    888887777899999999999988888999999999999998888776665444322    


Q ss_pred             cCCceecCCCcH
Q psy11774        253 NCYGLIVPKSKR  264 (304)
Q Consensus       253 ~~~~f~~p~~~~  264 (304)
                      ....|..|.+..
T Consensus       258 ~~~~f~~~~Gd~  269 (299)
T d1yksa2         258 ETVKCRAPGGAK  269 (299)
T ss_dssp             CBCEEECTTSCE
T ss_pred             cccceeCCCcce
Confidence            222466666543

PyMOL of d1yksa2

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure