Psyllid ID: psy11830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
cccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHcccccccccccccccccHHHccccccccccEEEEEEccccccEEcccEEccccccccccccccccccHHHHHHcccEEEEEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccEEHHHHHHHHHccccccccccccccccEEEEEEEccccccccccccccccccHHHHcccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccHEHHHHHHHHHHHHHHHHHHHHHHHHHc
MKMYANSLLDMKIVRTglnhipqfpvsndLVMEVIFLGYNnikiiegrafngsqiSKFVskirpeqklnprpsayntyynftrlifpgNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYdwqkgygckvAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGalpmfgissysttsiclpmdtrhlgskIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGIssysttsiclpmdtrhlgskIYVHTLLLFSSLVFAMICVCYFQIYSSL
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSkirpeqklnprpsAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLitgissysttsiCLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
*****NSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKI**********SAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIY***
******SLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADL**************ICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNV**************YSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMYANSLLDMKIVRTGLNHIPQFPVSNDLVMEVIFLGYNNIKIIEGRAFNGSQISKFVSKIRPEQKLNPRPSAYNTYYNFTRLIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLTADLLFLITGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query387 2.2.26 [Sep-21-2011]
P30730700 Lutropin-choriogonadotrop yes N/A 0.462 0.255 0.455 9e-42
P47799694 Follicle-stimulating horm yes N/A 0.462 0.257 0.466 2e-41
P16582696 Lutropin-choriogonadotrop yes N/A 0.462 0.257 0.455 4e-41
P35379695 Follicle-stimulating horm N/A N/A 0.462 0.257 0.472 5e-41
Q5GJ04695 Follicle-stimulating horm N/A N/A 0.462 0.257 0.461 5e-41
P35376695 Follicle-stimulating horm yes N/A 0.462 0.257 0.466 7e-41
Q95179687 Follicle-stimulating horm N/A N/A 0.462 0.260 0.461 8e-41
Q7ZTV5693 Follicle-stimulating horm N/A N/A 0.462 0.258 0.466 1e-40
Q28005701 Lutropin-choriogonadotrop no N/A 0.462 0.255 0.444 1e-40
O02721676 Lutropin-choriogonadotrop no N/A 0.462 0.264 0.45 2e-40
>sp|P30730|LSHR_MOUSE Lutropin-choriogonadotropic hormone receptor OS=Mus musculus GN=Lhcgr PE=2 SV=1 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 122/180 (67%), Gaps = 1/180 (0%)

Query: 148 GNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK 207
           GN  VL V L+   + +VPRFL+ +L+ AD CM  YLLL+A  D Q+   Y+N+A DWQ 
Sbjct: 380 GNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQT 439

Query: 208 GYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYAN-KLTIHRTTYFILVGYVYAS 266
           G GC  AGF TVFAS+LS++TL +ITLERW++I  A+  + KL +      +L G+++++
Sbjct: 440 GSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGWIFST 499

Query: 267 IMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGN 326
           +M  LP+ G+SSY   SICLPMD     S++Y+ ++LL +++ F +IC CY +IY ++ N
Sbjct: 500 LMATLPLVGVSSYMKVSICLPMDVESTLSQVYILSILLLNAVAFVVICACYVRIYFAVQN 559




Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Mus musculus (taxid: 10090)
>sp|P47799|FSHR_HORSE Follicle-stimulating hormone receptor OS=Equus caballus GN=FSHR PE=2 SV=1 Back     alignment and function description
>sp|P16582|LSHR_PIG Lutropin-choriogonadotropic hormone receptor OS=Sus scrofa GN=LHCGR PE=2 SV=1 Back     alignment and function description
>sp|P35379|FSHR_SHEEP Follicle-stimulating hormone receptor OS=Ovis aries GN=FSHR PE=1 SV=1 Back     alignment and function description
>sp|Q5GJ04|FSHR_FELCA Follicle-stimulating hormone receptor OS=Felis catus GN=FSHR PE=2 SV=1 Back     alignment and function description
>sp|P35376|FSHR_BOVIN Follicle-stimulating hormone receptor OS=Bos taurus GN=FSHR PE=2 SV=1 Back     alignment and function description
>sp|Q95179|FSHR_EQUAS Follicle-stimulating hormone receptor OS=Equus asinus GN=FSHR PE=2 SV=1 Back     alignment and function description
>sp|Q7ZTV5|FSHR_CAIMO Follicle-stimulating hormone receptor OS=Cairina moschata GN=FSHR PE=2 SV=1 Back     alignment and function description
>sp|Q28005|LSHR_BOVIN Lutropin-choriogonadotropic hormone receptor OS=Bos taurus GN=LHCGR PE=2 SV=1 Back     alignment and function description
>sp|O02721|LSHR_CALJA Lutropin-choriogonadotropic hormone receptor OS=Callithrix jacchus GN=LHCGR PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
328720344 758 PREDICTED: follicle-stimulating hormone 0.459 0.234 0.556 5e-51
157105802 860 leucine-rich transmembrane protein [Aede 0.462 0.208 0.544 3e-50
403182641 774 AAEL004399-PA, partial [Aedes aegypti] 0.462 0.231 0.544 4e-50
170043092 841 leucine-rich transmembrane protein [Cule 0.459 0.211 0.553 8e-49
347971116 959 AGAP004035-PA [Anopheles gambiae str. PE 0.459 0.185 0.541 3e-45
195396294 752 GJ11113 [Drosophila virilis] gi|19414347 0.459 0.236 0.572 2e-44
195055187 821 GH17283 [Drosophila grimshawi] gi|193892 0.459 0.216 0.561 2e-44
210076546 749 Sl LGR1 [Spodoptera littoralis] 0.457 0.236 0.471 3e-44
328708954 731 PREDICTED: lutropin-choriogonadotropic h 0.457 0.242 0.5 7e-44
194764509 656 GF23082 [Drosophila ananassae] gi|190614 0.692 0.408 0.375 2e-43
>gi|328720344|ref|XP_001945379.2| PREDICTED: follicle-stimulating hormone receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  207 bits (528), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 122/178 (68%)

Query: 148 GNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK 207
            N  V+ V   +    SVPRFL+ +LA AD C A YLLLLA KDL+S+E YFNYAY WQ 
Sbjct: 455 ANLVVMTVVFRKNFNHSVPRFLMCNLAFADFCTAIYLLLLAYKDLESSEKYFNYAYSWQN 514

Query: 208 GYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASI 267
           G GCK+ GF+TVF+SQLS+F L ++T+ERWYSI+RALY NK+T   T   +  G+VY+  
Sbjct: 515 GVGCKIGGFLTVFSSQLSVFALCLLTIERWYSIRRALYTNKMTFASTVRIMAFGWVYSIA 574

Query: 268 MGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLG 325
           M  +P+ GISSYSTTSICLPMDT       YV TLL F +  F ++  CY QIY SL 
Sbjct: 575 MATMPLLGISSYSTTSICLPMDTARASGMCYVFTLLTFGAAAFVLMLFCYVQIYMSLS 632




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157105802|ref|XP_001649032.1| leucine-rich transmembrane protein [Aedes aegypti] Back     alignment and taxonomy information
>gi|403182641|gb|EAT44221.2| AAEL004399-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|170043092|ref|XP_001849235.1| leucine-rich transmembrane protein [Culex quinquefasciatus] gi|167866512|gb|EDS29895.1| leucine-rich transmembrane protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347971116|ref|XP_309589.2| AGAP004035-PA [Anopheles gambiae str. PEST] gi|333466596|gb|EAA05376.3| AGAP004035-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195396294|ref|XP_002056767.1| GJ11113 [Drosophila virilis] gi|194143476|gb|EDW59879.1| GJ11113 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195055187|ref|XP_001994501.1| GH17283 [Drosophila grimshawi] gi|193892264|gb|EDV91130.1| GH17283 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|210076546|gb|ACJ06652.1| Sl LGR1 [Spodoptera littoralis] Back     alignment and taxonomy information
>gi|328708954|ref|XP_003243835.1| PREDICTED: lutropin-choriogonadotropic hormone receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194764509|ref|XP_001964371.1| GF23082 [Drosophila ananassae] gi|190614643|gb|EDV30167.1| GF23082 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
FB|FBgn0016650831 Lgr1 [Drosophila melanogaster 0.459 0.214 0.533 1.6e-49
ZFIN|ZDB-GENE-020423-5668 fshr "follicle stimulating hor 0.462 0.267 0.477 4.3e-46
UNIPROTKB|I3L9Z2620 FSHR "Follicle-stimulating hor 0.462 0.288 0.466 2.4e-44
UNIPROTKB|F1MT42695 FSHR "Follicle-stimulating hor 0.462 0.257 0.466 1.6e-43
UNIPROTKB|P49059695 FSHR "Follicle-stimulating hor 0.462 0.257 0.466 2e-43
UNIPROTKB|P35376695 FSHR "Follicle-stimulating hor 0.462 0.257 0.466 2e-43
ZFIN|ZDB-GENE-110524-4757 tshr "thyroid stimulating horm 0.462 0.236 0.483 4.1e-43
MGI|MGI:96783700 Lhcgr "luteinizing hormone/cho 0.472 0.261 0.459 4.4e-43
UNIPROTKB|E9PDH1637 LHCGR "Lutropin-choriogonadotr 0.462 0.281 0.444 5.4e-43
UNIPROTKB|F6XXE7689 FSHR "Uncharacterized protein" 0.462 0.259 0.461 6.6e-43
FB|FBgn0016650 Lgr1 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 491 (177.9 bits), Expect = 1.6e-49, Sum P(2) = 1.6e-49
 Identities = 96/180 (53%), Positives = 127/180 (70%)

Query:   148 GNAAVLAVTLS-RTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQ 206
             GN AVL V LS R     VPRFL+ HLA ADLC+  YLLL+A  D  S   YFN+AYDWQ
Sbjct:   505 GNVAVLTVILSIRPESTPVPRFLMCHLAFADLCLGLYLLLVACFDAHSMGEYFNFAYDWQ 564

Query:   207 KGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYAN-KLTIHRTTYFILVGYVYA 265
              G GCKVAGF+TVFAS LS+FTL +IT+ERW +I +A+Y N ++ +      +  G++Y+
Sbjct:   565 YGLGCKVAGFLTVFASHLSVFTLTVITIERWLAITQAMYLNHRIKLRPAALIMRGGWIYS 624

Query:   266 SIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLG 325
              +M +LP+FGIS+YS+TSICLPM+ R +   IY+  +L  + + F++I VCY QIY SLG
Sbjct:   625 MLMSSLPLFGISNYSSTSICLPMENRDVYDTIYLIAILGSNGVAFSIIAVCYAQIYLSLG 684


GO:0004930 "G-protein coupled receptor activity" evidence=ISS
GO:0016500 "protein-hormone receptor activity" evidence=IEA;ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS
ZFIN|ZDB-GENE-020423-5 fshr "follicle stimulating hormone receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9Z2 FSHR "Follicle-stimulating hormone receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT42 FSHR "Follicle-stimulating hormone receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P49059 FSHR "Follicle-stimulating hormone receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P35376 FSHR "Follicle-stimulating hormone receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110524-4 tshr "thyroid stimulating hormone receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:96783 Lhcgr "luteinizing hormone/choriogonadotropin receptor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDH1 LHCGR "Lutropin-choriogonadotropic hormone receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6XXE7 FSHR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 5e-17
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
 Score = 79.7 bits (197), Expect = 5e-17
 Identities = 44/182 (24%), Positives = 68/182 (37%), Gaps = 15/182 (8%)

Query: 154 AVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGY-GCK 212
            V L     ++     + +LA+ADL     L   A+        Y+    DW  G   CK
Sbjct: 1   LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWAL--------YYLVGGDWPFGDALCK 52

Query: 213 VAGFVTVFASQLSIFTLGMITLERWYSIKRAL-YANKLTIHRTTYFILVGYVYASIMGAL 271
           + GF+ V     SI  L  I+++R+ +I   L Y    T  R    ILV +V A ++   
Sbjct: 53  LVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLP 112

Query: 272 PMFGI----SSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLV-FAMICVCYFQIYSSLGN 326
           P+             + CL         + Y     L   ++   +I VCY  I  +L  
Sbjct: 113 PLLFSWLRTVEEGNVTTCLIDFPEESTKRSYTLLSTLLGFVLPLLVILVCYTLILRTLRK 172

Query: 327 VL 328
             
Sbjct: 173 RA 174


This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 387
KOG2087|consensus363 100.0
KOG4219|consensus 423 99.97
PHA03234338 DNA packaging protein UL33; Provisional 99.96
PHA02834323 chemokine receptor-like protein; Provisional 99.94
PHA03235 409 DNA packaging protein UL33; Provisional 99.93
KOG4220|consensus 503 99.93
PHA02638417 CC chemokine receptor-like protein; Provisional 99.92
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.9
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.89
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 99.37
KOG2087|consensus 363 99.29
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 98.99
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PF11710201 Git3: G protein-coupled glucose receptor regulatin 98.55
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 98.45
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 98.17
KOG4237|consensus498 98.11
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 97.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.76
KOG4194|consensus 873 97.44
PF10292324 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c 97.38
KOG4237|consensus498 97.35
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.34
KOG4194|consensus 873 97.14
PF00002242 7tm_2: 7 transmembrane receptor (Secretin family); 96.83
KOG4219|consensus423 96.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.4
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.23
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 96.11
smart0037026 LRR Leucine-rich repeats, outliers. 96.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.03
PF10316273 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep 95.69
KOG0444|consensus 1255 95.61
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 95.11
PF02101 405 Ocular_alb: Ocular albinism type 1 protein; InterP 94.88
KOG0472|consensus565 94.68
PF02117328 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemorecept 94.61
PF02118275 Srg: Srg family chemoreceptor; InterPro: IPR000609 94.41
PF10326307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 94.38
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.83
smart0037026 LRR Leucine-rich repeats, outliers. 93.83
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.7
KOG0444|consensus 1255 93.43
PLN00113968 leucine-rich repeat receptor-like protein kinase; 93.22
KOG0618|consensus 1081 93.12
KOG1644|consensus233 93.04
PF03383153 Serpentine_r_xa: Caenorhabditis serpentine recepto 92.99
PLN00113968 leucine-rich repeat receptor-like protein kinase; 92.68
PLN03150623 hypothetical protein; Provisional 92.57
PF10322307 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemorecept 92.42
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.4
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 91.3
KOG0617|consensus264 91.29
KOG4579|consensus177 91.01
KOG4579|consensus177 90.95
KOG4193|consensus610 90.78
KOG1259|consensus490 90.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.5
PF06681226 DUF1182: Protein of unknown function (DUF1182); In 90.21
PLN03150623 hypothetical protein; Provisional 90.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 89.91
KOG1259|consensus490 89.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 89.12
PF04789305 DUF621: Protein of unknown function (DUF621); Inte 88.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 88.49
PHA03234338 DNA packaging protein UL33; Provisional 88.14
PF02175236 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemorecept 87.62
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 87.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 85.55
KOG0472|consensus565 85.49
KOG0531|consensus414 84.7
KOG4220|consensus 503 83.01
PHA02638417 CC chemokine receptor-like protein; Provisional 82.38
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.06
>KOG2087|consensus Back     alignment and domain information
Probab=100.00  E-value=8.5e-33  Score=255.37  Aligned_cols=207  Identities=40%  Similarity=0.668  Sum_probs=191.4

Q ss_pred             CCCccccCCCCCCCchhhhH-----H--------hhhccCeeEEEeeeccCCCCCcchhhhhhhhHHHHHHHHHHHHHhh
Q psy11830         63 RPEQKLNPRPSAYNTYYNFT-----R--------LIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAV  129 (387)
Q Consensus        63 ~~~~~~~p~~~~~~~~~~~l-----~--------~~~~gn~~~~~~~~~~~~~~~~~~~~~~~l~~ad~~~~~~~~ii~~  129 (387)
                      ..+..|.|+||+|+||++.+     |        +|+.||.+|+..+..++.++++++|+|+|||+||++||+|+.+++.
T Consensus         3 ~~~~~C~P~~da~~pcEdllg~~~lRi~vW~i~~lAi~gN~~Vl~~~~~~~~~~~~~~~li~~la~ad~~mGiYl~~ia~   82 (363)
T KOG2087|consen    3 PHVITCKPSPDAFNPCEDLLGYWILRISVWVIALLAIVGNLLVLLTRFTSRYELNSHRFLICNLAFADLLMGIYLGLIAS   82 (363)
T ss_pred             CccceecCCCCCCCcHHHhhccceeeehhhhhhhHHhccCeeeeeeeeehhhhccchHHHHHHHHHHHHHcchHHHHHHH
Confidence            35678999999999998754     4        3799999999999999999999999999999999999999999999


Q ss_pred             ccccccchhhchhhhhhhcccceeeeeeeccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccceeeccccCcccCc
Q psy11830        130 KDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGY  209 (387)
Q Consensus       130 ~~~~~~~~Y~~~a~~w~~gN~lvi~vi~~~~~l~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~~~~~~~~w~~g~  209 (387)
                      +|..++|+|.+|+++|+-|                                                            .
T Consensus        83 vD~~~~gey~~~ai~W~tg------------------------------------------------------------~  102 (363)
T KOG2087|consen   83 VDAKTRGEYYKHAIDWQTG------------------------------------------------------------L  102 (363)
T ss_pred             hhHHHHHHHHHHHHhhhhc------------------------------------------------------------C
Confidence            9999999999999999977                                                            4


Q ss_pred             cchhhhHHHHHHHHHHHHHHHHHHHHHHhheeccccccc-cccchhhhhhHHHHHHHHHHhhhhhheecccCCceeeecc
Q psy11830        210 GCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANK-LTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPM  288 (387)
Q Consensus       210 ~C~~~~~~~~~~~~~Si~~L~~isidRy~aI~~P~~~~~-~t~~~~~~~i~~iWi~s~~~~~~p~~~~~~~~~~~~C~~~  288 (387)
                      .|++.||+..+++..|+++|+.+++||+++|++|++..+ ...|....+....|+.+++.+..|+++.+.|...+.|.|.
T Consensus       103 gC~~aGflavFASElSv~~LT~itlEr~l~i~~p~~~~~~~~lr~~~~ill~~wl~~~l~A~~Pl~g~s~Y~~~~vClPL  182 (363)
T KOG2087|consen  103 GCPVAGFLAVFASELSVFLLTLITLERWLSITYPFRLDRKAKLRPLVLILLLGWLFAFLMALLPLFGISSYGASSVCLPL  182 (363)
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHHHHhheeccccCCCcccccHHHHHHHHHHHHHHHHHhccccCCCCCcccceeeec
Confidence            899999999999999999999999999999999999988 6666699999999999999999999999999999999999


Q ss_pred             CcCcccch-hhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy11830        289 DTRHLGSK-IYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLT  329 (387)
Q Consensus       289 ~~~~~~~~-~~~~~~~~~~~iPl~ii~~~Y~~I~~~lr~~~~  329 (387)
                      ..++.... +|...+..+..+.+++|.++|++|+..+++...
T Consensus       183 ~~~~~~s~g~y~~~~l~~N~lafiiia~~Y~~iy~~l~~~~~  224 (363)
T KOG2087|consen  183 HIEEPLSTGYYLVALLGLNLLAFIIIAFSYGKIYCSLRKGDL  224 (363)
T ss_pred             ccCCccchhHHHHHHHHHHHHHHHHHHHHhhhhheeeecCCC
Confidence            88887777 687888888899999999999999999988665



>KOG4219|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PF02117 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemoreceptor Sra; InterPro: IPR000344 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF10322 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemoreceptor Sru; InterPro: IPR003839 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF06681 DUF1182: Protein of unknown function (DUF1182); InterPro: IPR010601 This family consists of several hypothetical proteins of around 360 residues in length and seems to be specific to Caenorhabditis elegans Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF04789 DUF621: Protein of unknown function (DUF621); InterPro: IPR006874 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans, and is noted to have possible G-protein-coupled receptor-like activity Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF02175 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemoreceptor Srb; InterPro: IPR002184 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
2ziy_A372 Crystal Structure Of Squid Rhodopsin Length = 372 2e-05
2z73_A 448 Crystal Structure Of Squid Rhodopsin Length = 448 2e-05
>pdb|2ZIY|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 372 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 7/130 (5%) Query: 204 DWQKGYG-CKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGY 262 W G+ CKV GF+ +SI T+ MI+++R+ I R + A+K HR + +++ Sbjct: 99 KWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFV 158 Query: 263 VYASIMGAL-PMFGISSYSTTSI-C-LPMDTRHLGSKIYVHTLLLFSSLVFAMICV---C 316 S++ A+ P+FG +Y+ + C D S + L +F F I + C Sbjct: 159 WLWSVLWAIGPIFGWGAYTLEGVLCNCSFDYISRDSTTRSNILCMFILGFFGPILIIFFC 218 Query: 317 YFQIYSSLGN 326 YF I S+ N Sbjct: 219 YFNIVMSVSN 228
>pdb|2Z73|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 448 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 7e-19
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-17
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 5e-13
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-11
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 1e-11
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 1e-10
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 6e-10
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 1e-09
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-09
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 7e-09
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 7e-09
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 1e-07
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-07
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 5e-07
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 1e-06
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
 Score = 85.9 bits (213), Expect = 7e-19
 Identities = 33/185 (17%), Positives = 75/185 (40%), Gaps = 16/185 (8%)

Query: 148 GNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK 207
            N   L VT+     ++   +++ +LA+ADL M F      +        Y +    +  
Sbjct: 55  INFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTL--------YTSLHGYFVF 106

Query: 208 GY-GCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYAS 266
           G  GC + GF      ++++++L ++ +ER+  + + +   +   +     +   +V A 
Sbjct: 107 GPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMAL 166

Query: 267 IMGALPMFGISSYS------TTSICLPMDTRHLGSKIYVHTLLLFSSLV-FAMICVCYFQ 319
              A P+ G S Y       +  I          ++ +V  + +   ++   +I  CY Q
Sbjct: 167 ACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQ 226

Query: 320 IYSSL 324
           +  ++
Sbjct: 227 LVFTV 231


>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.96
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.95
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.95
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.94
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.94
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.94
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.94
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.94
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.93
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.93
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.93
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.93
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.93
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.93
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.92
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.92
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.92
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.92
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.4
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.02
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.97
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.95
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.72
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.58
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.53
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.51
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.44
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.44
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.43
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.38
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.38
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.36
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.35
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.2
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.2
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.02
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.01
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 96.99
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 96.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.87
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.86
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 96.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.82
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 96.81
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.79
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 96.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.77
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.76
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.74
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.73
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.7
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.61
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.56
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 96.51
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.39
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.35
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.31
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 96.28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 96.25
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 96.16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 96.14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 96.08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 95.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 95.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 95.86
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 95.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 95.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 95.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 95.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 95.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 95.63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 95.61
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 95.49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 95.45
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 95.4
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 95.4
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 95.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 95.25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 95.24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 95.24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 95.18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 95.15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 95.1
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 95.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 94.96
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 94.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 94.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 94.83
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 94.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 94.69
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 94.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 94.3
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 94.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.18
1o6v_A466 Internalin A; bacterial infection, extracellular r 94.18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 94.05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 93.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.77
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 93.36
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 93.22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 93.13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 93.11
1o6v_A466 Internalin A; bacterial infection, extracellular r 93.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.52
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 92.21
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 91.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 91.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 89.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 87.37
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 86.97
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.68
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 85.13
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 85.05
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 85.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 83.0
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 82.98
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 82.7
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 81.94
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 81.45
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 81.24
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 80.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 80.28
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.96  E-value=3.9e-30  Score=259.81  Aligned_cols=176  Identities=15%  Similarity=0.250  Sum_probs=146.1

Q ss_pred             hcccceeeeeeeccCC---CchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccceeeccccCcccC-ccchhhhHHHHHHH
Q psy11830        147 KGNAAVLAVTLSRTSE---KSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKG-YGCKVAGFVTVFAS  222 (387)
Q Consensus       147 ~gN~lvi~vi~~~~~l---~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~~~~~~~~w~~g-~~C~~~~~~~~~~~  222 (387)
                      +||++|++++.++|++   ++++|+|++|||+||++++++.+|..+.....      ..+.|.+| ..|++..++..++.
T Consensus        48 ~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~------~~~~w~~g~~~C~~~~~~~~~~~  121 (510)
T 4grv_A           48 VGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIW------VHHPWAFGDAGCRGYYFLRDACT  121 (510)
T ss_dssp             HHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT------CCSSCSSHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------hCCCEEhhHHHHHHHHHHHHHHH
Confidence            9999999999887655   47889999999999999999999988765432      23479999 89999999999999


Q ss_pred             HHHHHHHHHHHHHHHhheeccccccc-cccchhhhhhHHHHHHHHHHhhhhhheecccC--------CceeeeccCcCcc
Q psy11830        223 QLSIFTLGMITLERWYSIKRALYANK-LTIHRTTYFILVGYVYASIMGALPMFGISSYS--------TTSICLPMDTRHL  293 (387)
Q Consensus       223 ~~Si~~L~~isidRy~aI~~P~~~~~-~t~~~~~~~i~~iWi~s~~~~~~p~~~~~~~~--------~~~~C~~~~~~~~  293 (387)
                      .+|++++++||+|||+||++|++|++ .|++++..+++++|++++++++|+++.++...        ....|.+.++...
T Consensus       122 ~~S~~~l~~is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~  201 (510)
T 4grv_A          122 YATALNVASLSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSADGTHPGGLVCTPIVDTAT  201 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHHHEEEEECSSSSCCGGGEEEEECSCHHH
T ss_pred             HHHHHHHHHHHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHHhhcccccccCCCCCCccccccccccch
Confidence            99999999999999999999999999 99999999999999999999988887654211        2346776665544


Q ss_pred             cchhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy11830        294 GSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVL  328 (387)
Q Consensus       294 ~~~~~~~~~~~~~~iPl~ii~~~Y~~I~~~lr~~~  328 (387)
                      ...++.+..++.+++|+++|+++|.+|+++++++.
T Consensus       202 ~~~~~~~~~~~~f~iP~~ii~~~Y~~I~~~l~~~~  236 (510)
T 4grv_A          202 VKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMV  236 (510)
T ss_dssp             HHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHTSC
T ss_pred             hhhhhhhhhhHHHhhhHHHHHHHHHHHHHHHHHHh
Confidence            44444445566679999999999999999998654



>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 387
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 0.001
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 38.4 bits (88), Expect = 0.001
 Identities = 29/267 (10%), Positives = 71/267 (26%), Gaps = 18/267 (6%)

Query: 84  LIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAY 143
           L FP N   L VT+     ++   +++ +LA+ADL M F      +         F    
Sbjct: 50  LGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTG 109

Query: 144 DWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAY 203
              +G  A L   ++  S                  +A    ++  K + +     N+A 
Sbjct: 110 CNLEGFFATLGGEIALWSLV---------------VLAIERYVVVCKPMSNFRFGENHAI 154

Query: 204 DWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYV 263
                                S +    +                        F++   +
Sbjct: 155 MGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFII 214

Query: 264 YASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQI--- 320
              ++       + +    +           ++  V  +++   + F +  + Y  +   
Sbjct: 215 PLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFY 274

Query: 321 YSSLGNVLTADLLFLITGISSYSTTSI 347
             +        +   I    + ++   
Sbjct: 275 IFTHQGSDFGPIFMTIPAFFAKTSAVY 301


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.96
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.48
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.35
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.3
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.29
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.14
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.12
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.09
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 95.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 95.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 95.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 95.6
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 95.41
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.07
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 94.92
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.3
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 94.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 92.56
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.79
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 89.24
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.87  E-value=6.3e-24  Score=200.37  Aligned_cols=191  Identities=19%  Similarity=0.312  Sum_probs=149.8

Q ss_pred             HHHHHHHHHHhhccccccchhhchhhhhhhcccceeeeeeeccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccce
Q psy11830        118 LCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEV  197 (387)
Q Consensus       118 ~~~~~~~~ii~~~~~~~~~~Y~~~a~~w~~gN~lvi~vi~~~~~l~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~  197 (387)
                      .+.+.++.++++.|+              +||+++++++.++|++|++.|+++.|||++|++.++...|..+.....   
T Consensus        38 ~~~~~~~~ii~v~gi--------------~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~---  100 (348)
T d1u19a_          38 SMLAAYMFLLIMLGF--------------PINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH---  100 (348)
T ss_dssp             HHHHHHHHHHHHHHH--------------HHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHH---
T ss_pred             HHHHHHHHHHHHHHH--------------HHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhcc---
Confidence            456677777777887              999999999999999999999999999999999999988887755443   


Q ss_pred             eeccccCcccC-ccchhhhHHHHHHHHHHHHHHHHHHHHHHhheeccccccccccchhhhhhHHHHHHHHHHhhhhhhee
Q psy11830        198 YFNYAYDWQKG-YGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGI  276 (387)
Q Consensus       198 ~~~~~~~w~~g-~~C~~~~~~~~~~~~~Si~~L~~isidRy~aI~~P~~~~~~t~~~~~~~i~~iWi~s~~~~~~p~~~~  276 (387)
                           +.|..+ ..|+...++...+..+|+++++++++|||.+|++|++++..++++....+..+|..+.++..+|.++.
T Consensus       101 -----~~~~~~~~~c~~~~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  175 (348)
T d1u19a_         101 -----GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGW  175 (348)
T ss_dssp             -----TSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCCCHHHHHHHHHHHHHHHHHHHSGGGTTS
T ss_pred             -----CccccCchhhhhhhhccccceeeecchhhhhhcccceeeeccccccccccccccccceeeehhhhheeccccccc
Confidence                 257777 88999999999999999999999999999999999998877777888888888988888887887754


Q ss_pred             ccc---CCceeeeccC---cCcccchhhhHHH-HHHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy11830        277 SSY---STTSICLPMD---TRHLGSKIYVHTL-LLFSSLVFAMICVCYFQIYSSLGNVLTA  330 (387)
Q Consensus       277 ~~~---~~~~~C~~~~---~~~~~~~~~~~~~-~~~~~iPl~ii~~~Y~~I~~~lr~~~~~  330 (387)
                      ...   .....|....   ........+.... .+.+++|++++.++|.++.+++|++.++
T Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~~~~  236 (348)
T d1u19a_         176 SRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQ  236 (348)
T ss_dssp             SCCEEETTTTEEECCCSCCCGGGTHHHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSCCCS
T ss_pred             ceeccCCcccccccccccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccc
Confidence            432   2233343222   1222233333333 3445899999999999998888876653



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure