Psyllid ID: psy11830
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 387 | ||||||
| 328720344 | 758 | PREDICTED: follicle-stimulating hormone | 0.459 | 0.234 | 0.556 | 5e-51 | |
| 157105802 | 860 | leucine-rich transmembrane protein [Aede | 0.462 | 0.208 | 0.544 | 3e-50 | |
| 403182641 | 774 | AAEL004399-PA, partial [Aedes aegypti] | 0.462 | 0.231 | 0.544 | 4e-50 | |
| 170043092 | 841 | leucine-rich transmembrane protein [Cule | 0.459 | 0.211 | 0.553 | 8e-49 | |
| 347971116 | 959 | AGAP004035-PA [Anopheles gambiae str. PE | 0.459 | 0.185 | 0.541 | 3e-45 | |
| 195396294 | 752 | GJ11113 [Drosophila virilis] gi|19414347 | 0.459 | 0.236 | 0.572 | 2e-44 | |
| 195055187 | 821 | GH17283 [Drosophila grimshawi] gi|193892 | 0.459 | 0.216 | 0.561 | 2e-44 | |
| 210076546 | 749 | Sl LGR1 [Spodoptera littoralis] | 0.457 | 0.236 | 0.471 | 3e-44 | |
| 328708954 | 731 | PREDICTED: lutropin-choriogonadotropic h | 0.457 | 0.242 | 0.5 | 7e-44 | |
| 194764509 | 656 | GF23082 [Drosophila ananassae] gi|190614 | 0.692 | 0.408 | 0.375 | 2e-43 |
| >gi|328720344|ref|XP_001945379.2| PREDICTED: follicle-stimulating hormone receptor-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 207 bits (528), Expect = 5e-51, Method: Compositional matrix adjust.
Identities = 99/178 (55%), Positives = 122/178 (68%)
Query: 148 GNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK 207
N V+ V + SVPRFL+ +LA AD C A YLLLLA KDL+S+E YFNYAY WQ
Sbjct: 455 ANLVVMTVVFRKNFNHSVPRFLMCNLAFADFCTAIYLLLLAYKDLESSEKYFNYAYSWQN 514
Query: 208 GYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASI 267
G GCK+ GF+TVF+SQLS+F L ++T+ERWYSI+RALY NK+T T + G+VY+
Sbjct: 515 GVGCKIGGFLTVFSSQLSVFALCLLTIERWYSIRRALYTNKMTFASTVRIMAFGWVYSIA 574
Query: 268 MGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLG 325
M +P+ GISSYSTTSICLPMDT YV TLL F + F ++ CY QIY SL
Sbjct: 575 MATMPLLGISSYSTTSICLPMDTARASGMCYVFTLLTFGAAAFVLMLFCYVQIYMSLS 632
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157105802|ref|XP_001649032.1| leucine-rich transmembrane protein [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|403182641|gb|EAT44221.2| AAEL004399-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170043092|ref|XP_001849235.1| leucine-rich transmembrane protein [Culex quinquefasciatus] gi|167866512|gb|EDS29895.1| leucine-rich transmembrane protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|347971116|ref|XP_309589.2| AGAP004035-PA [Anopheles gambiae str. PEST] gi|333466596|gb|EAA05376.3| AGAP004035-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195396294|ref|XP_002056767.1| GJ11113 [Drosophila virilis] gi|194143476|gb|EDW59879.1| GJ11113 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195055187|ref|XP_001994501.1| GH17283 [Drosophila grimshawi] gi|193892264|gb|EDV91130.1| GH17283 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|210076546|gb|ACJ06652.1| Sl LGR1 [Spodoptera littoralis] | Back alignment and taxonomy information |
|---|
| >gi|328708954|ref|XP_003243835.1| PREDICTED: lutropin-choriogonadotropic hormone receptor-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|194764509|ref|XP_001964371.1| GF23082 [Drosophila ananassae] gi|190614643|gb|EDV30167.1| GF23082 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 387 | ||||||
| FB|FBgn0016650 | 831 | Lgr1 [Drosophila melanogaster | 0.459 | 0.214 | 0.533 | 1.6e-49 | |
| ZFIN|ZDB-GENE-020423-5 | 668 | fshr "follicle stimulating hor | 0.462 | 0.267 | 0.477 | 4.3e-46 | |
| UNIPROTKB|I3L9Z2 | 620 | FSHR "Follicle-stimulating hor | 0.462 | 0.288 | 0.466 | 2.4e-44 | |
| UNIPROTKB|F1MT42 | 695 | FSHR "Follicle-stimulating hor | 0.462 | 0.257 | 0.466 | 1.6e-43 | |
| UNIPROTKB|P49059 | 695 | FSHR "Follicle-stimulating hor | 0.462 | 0.257 | 0.466 | 2e-43 | |
| UNIPROTKB|P35376 | 695 | FSHR "Follicle-stimulating hor | 0.462 | 0.257 | 0.466 | 2e-43 | |
| ZFIN|ZDB-GENE-110524-4 | 757 | tshr "thyroid stimulating horm | 0.462 | 0.236 | 0.483 | 4.1e-43 | |
| MGI|MGI:96783 | 700 | Lhcgr "luteinizing hormone/cho | 0.472 | 0.261 | 0.459 | 4.4e-43 | |
| UNIPROTKB|E9PDH1 | 637 | LHCGR "Lutropin-choriogonadotr | 0.462 | 0.281 | 0.444 | 5.4e-43 | |
| UNIPROTKB|F6XXE7 | 689 | FSHR "Uncharacterized protein" | 0.462 | 0.259 | 0.461 | 6.6e-43 |
| FB|FBgn0016650 Lgr1 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 491 (177.9 bits), Expect = 1.6e-49, Sum P(2) = 1.6e-49
Identities = 96/180 (53%), Positives = 127/180 (70%)
Query: 148 GNAAVLAVTLS-RTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQ 206
GN AVL V LS R VPRFL+ HLA ADLC+ YLLL+A D S YFN+AYDWQ
Sbjct: 505 GNVAVLTVILSIRPESTPVPRFLMCHLAFADLCLGLYLLLVACFDAHSMGEYFNFAYDWQ 564
Query: 207 KGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYAN-KLTIHRTTYFILVGYVYA 265
G GCKVAGF+TVFAS LS+FTL +IT+ERW +I +A+Y N ++ + + G++Y+
Sbjct: 565 YGLGCKVAGFLTVFASHLSVFTLTVITIERWLAITQAMYLNHRIKLRPAALIMRGGWIYS 624
Query: 266 SIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQIYSSLG 325
+M +LP+FGIS+YS+TSICLPM+ R + IY+ +L + + F++I VCY QIY SLG
Sbjct: 625 MLMSSLPLFGISNYSSTSICLPMENRDVYDTIYLIAILGSNGVAFSIIAVCYAQIYLSLG 684
|
|
| ZFIN|ZDB-GENE-020423-5 fshr "follicle stimulating hormone receptor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L9Z2 FSHR "Follicle-stimulating hormone receptor" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MT42 FSHR "Follicle-stimulating hormone receptor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49059 FSHR "Follicle-stimulating hormone receptor" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35376 FSHR "Follicle-stimulating hormone receptor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110524-4 tshr "thyroid stimulating hormone receptor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96783 Lhcgr "luteinizing hormone/choriogonadotropin receptor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PDH1 LHCGR "Lutropin-choriogonadotropic hormone receptor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XXE7 FSHR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 387 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 5e-17 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 79.7 bits (197), Expect = 5e-17
Identities = 44/182 (24%), Positives = 68/182 (37%), Gaps = 15/182 (8%)
Query: 154 AVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGY-GCK 212
V L ++ + +LA+ADL L A+ Y+ DW G CK
Sbjct: 1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWAL--------YYLVGGDWPFGDALCK 52
Query: 213 VAGFVTVFASQLSIFTLGMITLERWYSIKRAL-YANKLTIHRTTYFILVGYVYASIMGAL 271
+ GF+ V SI L I+++R+ +I L Y T R ILV +V A ++
Sbjct: 53 LVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLP 112
Query: 272 PMFGI----SSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLV-FAMICVCYFQIYSSLGN 326
P+ + CL + Y L ++ +I VCY I +L
Sbjct: 113 PLLFSWLRTVEEGNVTTCLIDFPEESTKRSYTLLSTLLGFVLPLLVILVCYTLILRTLRK 172
Query: 327 VL 328
Sbjct: 173 RA 174
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| KOG2087|consensus | 363 | 100.0 | ||
| KOG4219|consensus | 423 | 99.97 | ||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.96 | |
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 99.94 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 99.93 | |
| KOG4220|consensus | 503 | 99.93 | ||
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 99.92 | |
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 99.9 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 99.89 | |
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 99.37 | |
| KOG2087|consensus | 363 | 99.29 | ||
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 98.99 | |
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 98.81 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.62 | |
| PF11710 | 201 | Git3: G protein-coupled glucose receptor regulatin | 98.55 | |
| PF10323 | 283 | 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept | 98.45 | |
| PF05462 | 303 | Dicty_CAR: Slime mold cyclic AMP receptor | 98.25 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.21 | |
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 98.17 | |
| KOG4237|consensus | 498 | 98.11 | ||
| PF03402 | 265 | V1R: Vomeronasal organ pheromone receptor family, | 97.88 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.76 | |
| KOG4194|consensus | 873 | 97.44 | ||
| PF10292 | 324 | 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c | 97.38 | |
| KOG4237|consensus | 498 | 97.35 | ||
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 97.34 | |
| KOG4194|consensus | 873 | 97.14 | ||
| PF00002 | 242 | 7tm_2: 7 transmembrane receptor (Secretin family); | 96.83 | |
| KOG4219|consensus | 423 | 96.73 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.44 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.4 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.39 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.23 | |
| PF10317 | 292 | 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept | 96.11 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 96.03 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 96.03 | |
| PF10316 | 273 | 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep | 95.69 | |
| KOG0444|consensus | 1255 | 95.61 | ||
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 95.11 | |
| PF02101 | 405 | Ocular_alb: Ocular albinism type 1 protein; InterP | 94.88 | |
| KOG0472|consensus | 565 | 94.68 | ||
| PF02117 | 328 | 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemorecept | 94.61 | |
| PF02118 | 275 | Srg: Srg family chemoreceptor; InterPro: IPR000609 | 94.41 | |
| PF10326 | 307 | 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept | 94.38 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.29 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 93.83 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 93.83 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.7 | |
| KOG0444|consensus | 1255 | 93.43 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 93.22 | |
| KOG0618|consensus | 1081 | 93.12 | ||
| KOG1644|consensus | 233 | 93.04 | ||
| PF03383 | 153 | Serpentine_r_xa: Caenorhabditis serpentine recepto | 92.99 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 92.68 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 92.57 | |
| PF10322 | 307 | 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemorecept | 92.42 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 92.4 | |
| PF10327 | 303 | 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept | 91.3 | |
| KOG0617|consensus | 264 | 91.29 | ||
| KOG4579|consensus | 177 | 91.01 | ||
| KOG4579|consensus | 177 | 90.95 | ||
| KOG4193|consensus | 610 | 90.78 | ||
| KOG1259|consensus | 490 | 90.51 | ||
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 90.5 | |
| PF06681 | 226 | DUF1182: Protein of unknown function (DUF1182); In | 90.21 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 90.06 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 89.91 | |
| KOG1259|consensus | 490 | 89.63 | ||
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 89.12 | |
| PF04789 | 305 | DUF621: Protein of unknown function (DUF621); Inte | 88.71 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 88.49 | |
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 88.14 | |
| PF02175 | 236 | 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemorecept | 87.62 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 87.59 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 85.55 | |
| KOG0472|consensus | 565 | 85.49 | ||
| KOG0531|consensus | 414 | 84.7 | ||
| KOG4220|consensus | 503 | 83.01 | ||
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 82.38 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 81.06 |
| >KOG2087|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.5e-33 Score=255.37 Aligned_cols=207 Identities=40% Similarity=0.668 Sum_probs=191.4
Q ss_pred CCCccccCCCCCCCchhhhH-----H--------hhhccCeeEEEeeeccCCCCCcchhhhhhhhHHHHHHHHHHHHHhh
Q psy11830 63 RPEQKLNPRPSAYNTYYNFT-----R--------LIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAV 129 (387)
Q Consensus 63 ~~~~~~~p~~~~~~~~~~~l-----~--------~~~~gn~~~~~~~~~~~~~~~~~~~~~~~l~~ad~~~~~~~~ii~~ 129 (387)
..+..|.|+||+|+||++.+ | +|+.||.+|+..+..++.++++++|+|+|||+||++||+|+.+++.
T Consensus 3 ~~~~~C~P~~da~~pcEdllg~~~lRi~vW~i~~lAi~gN~~Vl~~~~~~~~~~~~~~~li~~la~ad~~mGiYl~~ia~ 82 (363)
T KOG2087|consen 3 PHVITCKPSPDAFNPCEDLLGYWILRISVWVIALLAIVGNLLVLLTRFTSRYELNSHRFLICNLAFADLLMGIYLGLIAS 82 (363)
T ss_pred CccceecCCCCCCCcHHHhhccceeeehhhhhhhHHhccCeeeeeeeeehhhhccchHHHHHHHHHHHHHcchHHHHHHH
Confidence 35678999999999998754 4 3799999999999999999999999999999999999999999999
Q ss_pred ccccccchhhchhhhhhhcccceeeeeeeccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccceeeccccCcccCc
Q psy11830 130 KDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKGY 209 (387)
Q Consensus 130 ~~~~~~~~Y~~~a~~w~~gN~lvi~vi~~~~~l~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~~~~~~~~w~~g~ 209 (387)
+|..++|+|.+|+++|+-| .
T Consensus 83 vD~~~~gey~~~ai~W~tg------------------------------------------------------------~ 102 (363)
T KOG2087|consen 83 VDAKTRGEYYKHAIDWQTG------------------------------------------------------------L 102 (363)
T ss_pred hhHHHHHHHHHHHHhhhhc------------------------------------------------------------C
Confidence 9999999999999999977 4
Q ss_pred cchhhhHHHHHHHHHHHHHHHHHHHHHHhheeccccccc-cccchhhhhhHHHHHHHHHHhhhhhheecccCCceeeecc
Q psy11830 210 GCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANK-LTIHRTTYFILVGYVYASIMGALPMFGISSYSTTSICLPM 288 (387)
Q Consensus 210 ~C~~~~~~~~~~~~~Si~~L~~isidRy~aI~~P~~~~~-~t~~~~~~~i~~iWi~s~~~~~~p~~~~~~~~~~~~C~~~ 288 (387)
.|++.||+..+++..|+++|+.+++||+++|++|++..+ ...|....+....|+.+++.+..|+++.+.|...+.|.|.
T Consensus 103 gC~~aGflavFASElSv~~LT~itlEr~l~i~~p~~~~~~~~lr~~~~ill~~wl~~~l~A~~Pl~g~s~Y~~~~vClPL 182 (363)
T KOG2087|consen 103 GCPVAGFLAVFASELSVFLLTLITLERWLSITYPFRLDRKAKLRPLVLILLLGWLFAFLMALLPLFGISSYGASSVCLPL 182 (363)
T ss_pred CCchHHHHHHHHHHHHHHHHHHHHHHHHhheeccccCCCcccccHHHHHHHHHHHHHHHHHhccccCCCCCcccceeeec
Confidence 899999999999999999999999999999999999988 6666699999999999999999999999999999999999
Q ss_pred CcCcccch-hhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy11830 289 DTRHLGSK-IYVHTLLLFSSLVFAMICVCYFQIYSSLGNVLT 329 (387)
Q Consensus 289 ~~~~~~~~-~~~~~~~~~~~iPl~ii~~~Y~~I~~~lr~~~~ 329 (387)
..++.... +|...+..+..+.+++|.++|++|+..+++...
T Consensus 183 ~~~~~~s~g~y~~~~l~~N~lafiiia~~Y~~iy~~l~~~~~ 224 (363)
T KOG2087|consen 183 HIEEPLSTGYYLVALLGLNLLAFIIIAFSYGKIYCSLRKGDL 224 (363)
T ss_pred ccCCccchhHHHHHHHHHHHHHHHHHHHHhhhhheeeecCCC
Confidence 88887777 687888888899999999999999999988665
|
|
| >KOG4219|consensus | Back alignment and domain information |
|---|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor | Back alignment and domain information |
|---|
| >PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05462 Dicty_CAR: Slime mold cyclic AMP receptor | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG4219|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >PF02117 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemoreceptor Sra; InterPro: IPR000344 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10322 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemoreceptor Sru; InterPro: IPR003839 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG4193|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF06681 DUF1182: Protein of unknown function (DUF1182); InterPro: IPR010601 This family consists of several hypothetical proteins of around 360 residues in length and seems to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF04789 DUF621: Protein of unknown function (DUF621); InterPro: IPR006874 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans, and is noted to have possible G-protein-coupled receptor-like activity | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PF02175 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemoreceptor Srb; InterPro: IPR002184 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 387 | ||||
| 2ziy_A | 372 | Crystal Structure Of Squid Rhodopsin Length = 372 | 2e-05 | ||
| 2z73_A | 448 | Crystal Structure Of Squid Rhodopsin Length = 448 | 2e-05 |
| >pdb|2ZIY|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 372 | Back alignment and structure |
|
| >pdb|2Z73|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 448 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 387 | |||
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 7e-19 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 1e-17 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 5e-13 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 1e-11 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 1e-11 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 1e-10 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 6e-10 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 1e-09 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 1e-09 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 7e-09 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 7e-09 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 1e-07 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 3e-07 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 5e-07 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 1e-06 |
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 | Back alignment and structure |
|---|
Score = 85.9 bits (213), Expect = 7e-19
Identities = 33/185 (17%), Positives = 75/185 (40%), Gaps = 16/185 (8%)
Query: 148 GNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQK 207
N L VT+ ++ +++ +LA+ADL M F + Y + +
Sbjct: 55 INFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTL--------YTSLHGYFVF 106
Query: 208 GY-GCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYAS 266
G GC + GF ++++++L ++ +ER+ + + + + + + +V A
Sbjct: 107 GPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMAL 166
Query: 267 IMGALPMFGISSYS------TTSICLPMDTRHLGSKIYVHTLLLFSSLV-FAMICVCYFQ 319
A P+ G S Y + I ++ +V + + ++ +I CY Q
Sbjct: 167 ACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQ 226
Query: 320 IYSSL 324
+ ++
Sbjct: 227 LVFTV 231
|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 99.96 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.95 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.95 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.94 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.94 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.94 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.94 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.94 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.93 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 99.93 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.93 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 99.93 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.93 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 99.93 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 99.92 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 99.92 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 99.92 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.92 | |
| 1hll_A | 32 | Alpha-2A adrenergic receptor; helix-linker-helix, | 98.4 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.25 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.09 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.07 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.02 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.97 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.96 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.95 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.84 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.83 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.81 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.8 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.79 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.78 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.78 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.75 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.72 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.69 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.61 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.61 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.59 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.59 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.58 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.58 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.55 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.54 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.53 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.53 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.51 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.44 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.44 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.43 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.38 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.38 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.36 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.35 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.25 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.23 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.22 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.22 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.21 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.2 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.2 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.18 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.18 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.17 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.02 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.01 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.0 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 96.99 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.92 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.88 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.87 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.87 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.86 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.86 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.85 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.84 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.84 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.82 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 96.81 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.79 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.78 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.78 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.77 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.76 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.74 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.74 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.74 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 96.73 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.7 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.61 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.56 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.51 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.39 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.36 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.35 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.35 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.32 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.31 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.28 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.27 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.26 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 96.25 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 96.16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 96.14 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.08 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 95.89 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 95.87 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 95.86 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 95.86 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.8 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 95.77 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.74 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 95.71 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 95.66 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 95.63 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 95.63 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 95.61 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 95.49 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 95.45 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 95.4 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.4 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 95.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.28 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 95.25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.24 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 95.24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 95.18 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 95.15 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 95.1 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 95.08 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.07 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.97 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 94.96 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 94.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 94.84 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 94.83 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 94.82 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 94.69 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 94.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 94.3 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 94.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 94.18 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 94.18 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 94.05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 93.97 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.77 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 93.36 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 93.22 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 93.13 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 93.11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 93.11 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 93.05 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 92.52 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 92.21 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 91.88 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 91.23 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.42 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 87.37 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 86.97 | |
| 2lz0_A | 100 | Uncharacterized protein; hypothetical leucine rich | 86.68 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 85.13 | |
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 85.05 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 85.0 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 83.0 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 82.98 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 82.7 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 81.94 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 81.45 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 81.24 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 80.56 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 80.28 |
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.96 E-value=3.9e-30 Score=259.81 Aligned_cols=176 Identities=15% Similarity=0.250 Sum_probs=146.1
Q ss_pred hcccceeeeeeeccCC---CchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccceeeccccCcccC-ccchhhhHHHHHHH
Q psy11830 147 KGNAAVLAVTLSRTSE---KSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAYDWQKG-YGCKVAGFVTVFAS 222 (387)
Q Consensus 147 ~gN~lvi~vi~~~~~l---~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~~~~~~~~w~~g-~~C~~~~~~~~~~~ 222 (387)
+||++|++++.++|++ ++++|+|++|||+||++++++.+|..+..... ..+.|.+| ..|++..++..++.
T Consensus 48 ~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~------~~~~w~~g~~~C~~~~~~~~~~~ 121 (510)
T 4grv_A 48 VGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIW------VHHPWAFGDAGCRGYYFLRDACT 121 (510)
T ss_dssp HHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT------CCSSCSSHHHHHHHHHHHHHHHH
T ss_pred HHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------hCCCEEhhHHHHHHHHHHHHHHH
Confidence 9999999999887655 47889999999999999999999988765432 23479999 89999999999999
Q ss_pred HHHHHHHHHHHHHHHhheeccccccc-cccchhhhhhHHHHHHHHHHhhhhhheecccC--------CceeeeccCcCcc
Q psy11830 223 QLSIFTLGMITLERWYSIKRALYANK-LTIHRTTYFILVGYVYASIMGALPMFGISSYS--------TTSICLPMDTRHL 293 (387)
Q Consensus 223 ~~Si~~L~~isidRy~aI~~P~~~~~-~t~~~~~~~i~~iWi~s~~~~~~p~~~~~~~~--------~~~~C~~~~~~~~ 293 (387)
.+|++++++||+|||+||++|++|++ .|++++..+++++|++++++++|+++.++... ....|.+.++...
T Consensus 122 ~~S~~~l~~is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~ 201 (510)
T 4grv_A 122 YATALNVASLSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSADGTHPGGLVCTPIVDTAT 201 (510)
T ss_dssp HHHHHHHHHHHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHHHEEEEECSSSSCCGGGEEEEECSCHHH
T ss_pred HHHHHHHHHHHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHHhhcccccccCCCCCCccccccccccch
Confidence 99999999999999999999999999 99999999999999999999988887654211 2346776665544
Q ss_pred cchhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy11830 294 GSKIYVHTLLLFSSLVFAMICVCYFQIYSSLGNVL 328 (387)
Q Consensus 294 ~~~~~~~~~~~~~~iPl~ii~~~Y~~I~~~lr~~~ 328 (387)
...++.+..++.+++|+++|+++|.+|+++++++.
T Consensus 202 ~~~~~~~~~~~~f~iP~~ii~~~Y~~I~~~l~~~~ 236 (510)
T 4grv_A 202 VKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMV 236 (510)
T ss_dssp HHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHTSC
T ss_pred hhhhhhhhhhHHHhhhHHHHHHHHHHHHHHHHHHh
Confidence 44444445566679999999999999999998654
|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 387 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 0.001 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 38.4 bits (88), Expect = 0.001
Identities = 29/267 (10%), Positives = 71/267 (26%), Gaps = 18/267 (6%)
Query: 84 LIFPGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAVKDLQSTEVYFNYAY 143
L FP N L VT+ ++ +++ +LA+ADL M F + F
Sbjct: 50 LGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTG 109
Query: 144 DWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEVYFNYAY 203
+G A L ++ S +A ++ K + + N+A
Sbjct: 110 CNLEGFFATLGGEIALWSLV---------------VLAIERYVVVCKPMSNFRFGENHAI 154
Query: 204 DWQKGYGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYV 263
S + + F++ +
Sbjct: 155 MGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFII 214
Query: 264 YASIMGALPMFGISSYSTTSICLPMDTRHLGSKIYVHTLLLFSSLVFAMICVCYFQI--- 320
++ + + + ++ V +++ + F + + Y +
Sbjct: 215 PLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFY 274
Query: 321 YSSLGNVLTADLLFLITGISSYSTTSI 347
+ + I + ++
Sbjct: 275 IFTHQGSDFGPIFMTIPAFFAKTSAVY 301
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.87 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.18 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.0 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.96 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.67 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.48 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.48 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.35 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.3 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.29 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.29 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.2 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.14 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.12 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.09 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.07 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.55 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.53 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 95.93 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.86 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.8 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 95.6 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 95.41 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 95.29 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 95.07 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 94.92 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.73 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.3 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 94.26 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 92.56 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 91.79 | |
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 89.24 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.87 E-value=6.3e-24 Score=200.37 Aligned_cols=191 Identities=19% Similarity=0.312 Sum_probs=149.8
Q ss_pred HHHHHHHHHHhhccccccchhhchhhhhhhcccceeeeeeeccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhccce
Q psy11830 118 LCMAFYLLLLAVKDLQSTEVYFNYAYDWQKGNAAVLAVTLSRTSEKSVPRFLISHLAMADLCMAFYLLLLAIKDLQSTEV 197 (387)
Q Consensus 118 ~~~~~~~~ii~~~~~~~~~~Y~~~a~~w~~gN~lvi~vi~~~~~l~t~~~~~i~nLavaDll~~~~~~~~~~~~~~~~~~ 197 (387)
.+.+.++.++++.|+ +||+++++++.++|++|++.|+++.|||++|++.++...|..+.....
T Consensus 38 ~~~~~~~~ii~v~gi--------------~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~--- 100 (348)
T d1u19a_ 38 SMLAAYMFLLIMLGF--------------PINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH--- 100 (348)
T ss_dssp HHHHHHHHHHHHHHH--------------HHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHH---
T ss_pred HHHHHHHHHHHHHHH--------------HHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhcc---
Confidence 456677777777887 999999999999999999999999999999999999988887755443
Q ss_pred eeccccCcccC-ccchhhhHHHHHHHHHHHHHHHHHHHHHHhheeccccccccccchhhhhhHHHHHHHHHHhhhhhhee
Q psy11830 198 YFNYAYDWQKG-YGCKVAGFVTVFASQLSIFTLGMITLERWYSIKRALYANKLTIHRTTYFILVGYVYASIMGALPMFGI 276 (387)
Q Consensus 198 ~~~~~~~w~~g-~~C~~~~~~~~~~~~~Si~~L~~isidRy~aI~~P~~~~~~t~~~~~~~i~~iWi~s~~~~~~p~~~~ 276 (387)
+.|..+ ..|+...++...+..+|+++++++++|||.+|++|++++..++++....+..+|..+.++..+|.++.
T Consensus 101 -----~~~~~~~~~c~~~~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 175 (348)
T d1u19a_ 101 -----GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGW 175 (348)
T ss_dssp -----TSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCCCHHHHHHHHHHHHHHHHHHHSGGGTTS
T ss_pred -----CccccCchhhhhhhhccccceeeecchhhhhhcccceeeeccccccccccccccccceeeehhhhheeccccccc
Confidence 257777 88999999999999999999999999999999999998877777888888888988888887887754
Q ss_pred ccc---CCceeeeccC---cCcccchhhhHHH-HHHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy11830 277 SSY---STTSICLPMD---TRHLGSKIYVHTL-LLFSSLVFAMICVCYFQIYSSLGNVLTA 330 (387)
Q Consensus 277 ~~~---~~~~~C~~~~---~~~~~~~~~~~~~-~~~~~iPl~ii~~~Y~~I~~~lr~~~~~ 330 (387)
... .....|.... ........+.... .+.+++|++++.++|.++.+++|++.++
T Consensus 176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~~~~ 236 (348)
T d1u19a_ 176 SRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQ 236 (348)
T ss_dssp SCCEEETTTTEEECCCSCCCGGGTHHHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSCCCS
T ss_pred ceeccCCcccccccccccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccc
Confidence 432 2233343222 1222233333333 3445899999999999998888876653
|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|