Psyllid ID: psy11857
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| 340713996 | 702 | PREDICTED: tripartite motif-containing p | 0.899 | 0.165 | 0.879 | 4e-56 | |
| 350400611 | 932 | PREDICTED: tripartite motif-containing p | 0.899 | 0.124 | 0.879 | 5e-56 | |
| 340713994 | 927 | PREDICTED: tripartite motif-containing p | 0.899 | 0.125 | 0.879 | 5e-56 | |
| 328780417 | 927 | PREDICTED: tripartite motif-containing p | 0.899 | 0.125 | 0.870 | 2e-55 | |
| 380025130 | 927 | PREDICTED: LOW QUALITY PROTEIN: triparti | 0.899 | 0.125 | 0.870 | 2e-55 | |
| 383862071 | 936 | PREDICTED: tripartite motif-containing p | 0.899 | 0.123 | 0.870 | 3e-55 | |
| 91092518 | 685 | PREDICTED: similar to NHL (ring finger b | 0.899 | 0.169 | 0.862 | 4e-55 | |
| 307203608 | 987 | Chymotrypsin-1 [Harpegnathos saltator] | 0.899 | 0.117 | 0.862 | 1e-54 | |
| 307180992 | 687 | Tripartite motif-containing protein 2 [C | 0.899 | 0.168 | 0.862 | 1e-54 | |
| 242022977 | 687 | RING finger-containing protein, putative | 0.899 | 0.168 | 0.853 | 2e-54 |
| >gi|340713996|ref|XP_003395519.1| PREDICTED: tripartite motif-containing protein 2-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 222 bits (565), Expect = 4e-56, Method: Compositional matrix adjust.
Identities = 102/116 (87%), Positives = 108/116 (93%)
Query: 9 LSTNSTLVETVSINYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQ 68
+S +S LVETVSINYEDFNESFLTCGTCLC+YDGGEHTPKLLPCSHTVCLHCL+RIAASQ
Sbjct: 17 VSMSSMLVETVSINYEDFNESFLTCGTCLCVYDGGEHTPKLLPCSHTVCLHCLTRIAASQ 76
Query: 69 TRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTHNSQ 124
TRETG RCPICRE ITIPRGGVAALPPSFLVNQLLDLMSRQRR +IPKCS H +Q
Sbjct: 77 TRETGAFRCPICRELITIPRGGVAALPPSFLVNQLLDLMSRQRREVIPKCSVHINQ 132
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350400611|ref|XP_003485898.1| PREDICTED: tripartite motif-containing protein 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340713994|ref|XP_003395518.1| PREDICTED: tripartite motif-containing protein 2-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328780417|ref|XP_392730.4| PREDICTED: tripartite motif-containing protein 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380025130|ref|XP_003696332.1| PREDICTED: LOW QUALITY PROTEIN: tripartite motif-containing protein 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383862071|ref|XP_003706507.1| PREDICTED: tripartite motif-containing protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|91092518|ref|XP_969733.1| PREDICTED: similar to NHL (ring finger b-box coiled coil) domain containing family member (nhl-3) [Tribolium castaneum] gi|270012903|gb|EFA09351.1| hypothetical protein TcasGA2_TC001677 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307203608|gb|EFN82637.1| Chymotrypsin-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307180992|gb|EFN68766.1| Tripartite motif-containing protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242022977|ref|XP_002431913.1| RING finger-containing protein, putative [Pediculus humanus corporis] gi|212517257|gb|EEB19175.1| RING finger-containing protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| WB|WBGene00003599 | 698 | nhl-3 [Caenorhabditis elegans | 0.782 | 0.144 | 0.549 | 9.2e-28 | |
| ZFIN|ZDB-GENE-070112-1132 | 772 | trim3b "tripartite motif-conta | 0.697 | 0.116 | 0.377 | 7.1e-12 | |
| UNIPROTKB|J9NRL4 | 242 | TRIM2 "Uncharacterized protein | 0.589 | 0.314 | 0.385 | 1e-11 | |
| UNIPROTKB|C9JVI3 | 138 | TRIM2 "Tripartite motif-contai | 0.589 | 0.550 | 0.385 | 1e-11 | |
| ZFIN|ZDB-GENE-080522-4 | 774 | trim3a "tripartite motif-conta | 0.604 | 0.100 | 0.388 | 1.2e-11 | |
| UNIPROTKB|E9PMW5 | 96 | TRIM3 "Tripartite motif-contai | 0.612 | 0.822 | 0.360 | 1.3e-11 | |
| MGI|MGI:2685298 | 734 | Trim56 "tripartite motif-conta | 0.581 | 0.102 | 0.440 | 1.4e-11 | |
| UNIPROTKB|C9JI91 | 305 | TRIM56 "E3 ubiquitin-protein l | 0.581 | 0.245 | 0.416 | 1.7e-11 | |
| UNIPROTKB|E9PMK8 | 261 | TRIM3 "Tripartite motif-contai | 0.612 | 0.302 | 0.360 | 1.8e-11 | |
| UNIPROTKB|E1BD59 | 732 | TRIM56 "E3 ubiquitin-protein l | 0.581 | 0.102 | 0.440 | 2.2e-11 |
| WB|WBGene00003599 nhl-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 319 (117.4 bits), Expect = 9.2e-28, P = 9.2e-28
Identities = 56/102 (54%), Positives = 72/102 (70%)
Query: 21 INYEDFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAA-SQTRETGTLRCPI 79
IN +DF+E+FLTC TCL YDG PKLLPCSH+VCL C++++A S + TLRCP+
Sbjct: 13 INVDDFSETFLTCSTCLYTYDGNTRKPKLLPCSHSVCLFCVTQLAELSPETQPPTLRCPL 72
Query: 80 CREQITIPRGGVAALPPSFLVNQLLDLMSRQRRHIIPKCSTH 121
CRE IP GGV P +F +NQLLD+M QR+ ++P CS H
Sbjct: 73 CREVCPIPAGGVILFPAAFFINQLLDVMQIQRKDVVPSCSNH 114
|
|
| ZFIN|ZDB-GENE-070112-1132 trim3b "tripartite motif-containing 3b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NRL4 TRIM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JVI3 TRIM2 "Tripartite motif-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080522-4 trim3a "tripartite motif-containing 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PMW5 TRIM3 "Tripartite motif-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2685298 Trim56 "tripartite motif-containing 56" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JI91 TRIM56 "E3 ubiquitin-protein ligase TRIM56" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PMK8 TRIM3 "Tripartite motif-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BD59 TRIM56 "E3 ubiquitin-protein ligase TRIM56" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 3e-04 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.001 |
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
Score = 36.2 bits (84), Expect = 3e-04
Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 4/52 (7%)
Query: 28 ESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPI 79
S C + E+ P +LPC H L ++A + G +CP
Sbjct: 8 HSIFVCPISKEVMTDEENPPVMLPCGHVYSRKALEKLA----KNGGKFKCPY 55
|
This zinc-finger is the dimerisation motif for LisH proteins, and is also a typical RING-type of plant ubiquitin ligases. Length = 55 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.6 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.48 | |
| KOG0287|consensus | 442 | 99.46 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 99.43 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.43 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.37 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.35 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.33 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.32 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.3 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.3 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.28 | |
| KOG2177|consensus | 386 | 99.27 | ||
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.22 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.19 | |
| KOG0320|consensus | 187 | 99.17 | ||
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.15 | |
| KOG0823|consensus | 230 | 99.12 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.08 | |
| KOG4367|consensus | 699 | 99.07 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.07 | |
| KOG0317|consensus | 293 | 99.07 | ||
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 99.0 | |
| KOG4185|consensus | 296 | 98.91 | ||
| KOG2164|consensus | 513 | 98.79 | ||
| KOG0311|consensus | 381 | 98.74 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.7 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.68 | |
| KOG4628|consensus | 348 | 98.65 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.63 | |
| KOG2660|consensus | 331 | 98.61 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.61 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.56 | |
| KOG0978|consensus | 698 | 98.5 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.45 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.45 | |
| KOG4159|consensus | 398 | 98.43 | ||
| KOG0802|consensus | 543 | 98.32 | ||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.26 | |
| KOG0824|consensus | 324 | 98.24 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.24 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.12 | |
| KOG2879|consensus | 298 | 98.1 | ||
| KOG1813|consensus | 313 | 98.07 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.96 | |
| KOG0804|consensus | 493 | 97.95 | ||
| KOG0297|consensus | 391 | 97.95 | ||
| KOG4172|consensus | 62 | 97.86 | ||
| KOG1039|consensus | 344 | 97.84 | ||
| KOG1002|consensus | 791 | 97.8 | ||
| KOG1785|consensus | 563 | 97.8 | ||
| KOG3161|consensus | 861 | 97.74 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 97.71 | |
| KOG1493|consensus | 84 | 97.65 | ||
| KOG4265|consensus | 349 | 97.62 | ||
| KOG1814|consensus | 445 | 97.59 | ||
| KOG1734|consensus | 328 | 97.51 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.5 | |
| KOG1941|consensus | 518 | 97.47 | ||
| KOG1645|consensus | 463 | 97.45 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 97.32 | |
| KOG0827|consensus | 465 | 97.32 | ||
| KOG0828|consensus | 636 | 97.19 | ||
| KOG4739|consensus | 233 | 97.13 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 97.1 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.02 | |
| KOG4692|consensus | 489 | 97.01 | ||
| KOG2817|consensus | 394 | 96.94 | ||
| KOG3002|consensus | 299 | 96.92 | ||
| KOG1812|consensus | 384 | 96.92 | ||
| KOG0825|consensus | 1134 | 96.88 | ||
| KOG3800|consensus | 300 | 96.73 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 96.73 | |
| KOG4275|consensus | 350 | 96.7 | ||
| KOG3039|consensus | 303 | 96.66 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 96.33 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.3 | |
| KOG1940|consensus | 276 | 96.22 | ||
| KOG1001|consensus | 674 | 96.2 | ||
| PHA03096 | 284 | p28-like protein; Provisional | 96.04 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 96.03 | |
| KOG1571|consensus | 355 | 95.96 | ||
| KOG4185|consensus | 296 | 95.96 | ||
| KOG4362|consensus | 684 | 95.85 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 95.82 | |
| KOG3970|consensus | 299 | 95.63 | ||
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 95.61 | |
| KOG2930|consensus | 114 | 95.31 | ||
| KOG2932|consensus | 389 | 95.27 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 95.17 | |
| KOG1428|consensus | 3738 | 95.05 | ||
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 94.98 | |
| KOG2114|consensus | 933 | 94.76 | ||
| KOG0826|consensus | 357 | 94.59 | ||
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.4 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.25 | |
| KOG1815|consensus | 444 | 93.62 | ||
| KOG4445|consensus | 368 | 93.54 | ||
| PHA02862 | 156 | 5L protein; Provisional | 93.23 | |
| KOG1952|consensus | 950 | 93.18 | ||
| KOG3113|consensus | 293 | 92.93 | ||
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 92.52 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 92.15 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 91.77 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 91.64 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 91.41 | |
| KOG3039|consensus | 303 | 90.95 | ||
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 90.51 | |
| KOG1100|consensus | 207 | 90.38 | ||
| COG3813 | 84 | Uncharacterized protein conserved in bacteria [Fun | 90.21 | |
| KOG0298|consensus | 1394 | 89.93 | ||
| KOG3579|consensus | 352 | 89.66 | ||
| KOG3899|consensus | 381 | 89.52 | ||
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 89.39 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 88.84 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 88.69 | |
| KOG2034|consensus | 911 | 87.56 | ||
| KOG3268|consensus | 234 | 87.09 | ||
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 85.5 | |
| KOG3053|consensus | 293 | 84.4 | ||
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 83.77 | |
| PF14353 | 128 | CpXC: CpXC protein | 82.86 | |
| KOG2068|consensus | 327 | 82.58 | ||
| PF06844 | 68 | DUF1244: Protein of unknown function (DUF1244); In | 82.51 | |
| KOG2169|consensus | 636 | 81.3 |
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
Probab=99.60 E-value=4.6e-16 Score=82.31 Aligned_cols=42 Identities=36% Similarity=0.973 Sum_probs=32.3
Q ss_pred cccccccccCCCCceEeecCCchhHHHhHHHHHHhccCCCCccccccC
Q psy11857 33 CGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPIC 80 (129)
Q Consensus 33 C~iC~~~~~~~~~~p~~l~CgH~fC~~Cl~~~~~~~~~~~~~~~CP~C 80 (129)
||||+++| ++|++|+|||+||..||.+++.... +..+.||.|
T Consensus 1 CpiC~~~~----~~Pv~l~CGH~FC~~Cl~~~~~~~~--~~~~~CP~C 42 (42)
T PF15227_consen 1 CPICLDLF----KDPVSLPCGHSFCRSCLERLWKEPS--GSGFSCPEC 42 (42)
T ss_dssp ETTTTSB-----SSEEE-SSSSEEEHHHHHHHHCCSS--SST---SSS
T ss_pred CCccchhh----CCccccCCcCHHHHHHHHHHHHccC--CcCCCCcCC
Confidence 89999999 8999999999999999999998753 223789987
|
|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >KOG3113|consensus | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >COG3813 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >KOG3053|consensus | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >KOG2068|consensus | Back alignment and domain information |
|---|
| >PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length | Back alignment and domain information |
|---|
| >KOG2169|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 3e-21 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 7e-13 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-08 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 1e-07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 2e-06 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-06 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 4e-06 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-06 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 1e-05 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 5e-05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 7e-05 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-04 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 2e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 4e-04 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 6e-04 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 8e-04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 9e-04 |
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
Score = 80.1 bits (198), Expect = 3e-21
Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 5/81 (6%)
Query: 25 DFNESFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQI 84
D L C C+ + + PKLL C HT+C CL ++ AS +RCP C +
Sbjct: 10 DALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSIN---GVRCPFCSKIT 66
Query: 85 TIPRGGVAALPPSFLVNQLLD 105
I + L + V +
Sbjct: 67 RIT--SLTQLTDNLTVLKSGP 85
|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.76 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.72 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.69 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.68 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.68 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.66 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.66 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.65 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.65 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.65 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.64 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.62 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.61 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.61 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.61 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.6 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.6 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.59 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.58 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.56 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.55 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.55 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.54 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.54 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.54 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.53 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.53 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.52 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.52 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.51 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.51 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.48 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.46 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.45 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.45 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.44 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.44 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.44 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.42 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.42 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.41 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.4 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.39 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.38 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.37 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.37 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.36 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.33 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.31 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.29 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.29 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.24 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.22 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.21 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.2 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.17 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.15 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.15 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.13 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.11 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.02 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.02 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.01 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.9 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.86 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.86 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.72 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.5 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.49 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.21 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.03 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 97.54 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.75 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.65 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 94.15 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 93.6 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 93.27 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 92.96 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 87.5 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 84.93 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 84.86 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 84.43 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 84.25 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 83.61 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 81.98 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 81.81 |
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.76 E-value=1.1e-18 Score=106.46 Aligned_cols=73 Identities=19% Similarity=0.456 Sum_probs=62.6
Q ss_pred ccCccccccccccccCCCCceEeec-CCchhHHHhHHHHHHhccCCCCccccccCCcceeeCCCCCCCCChhHHHHHHHH
Q psy11857 27 NESFLTCGTCLCMYDGGEHTPKLLP-CSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLD 105 (129)
Q Consensus 27 ~~~~l~C~iC~~~~~~~~~~p~~l~-CgH~fC~~Cl~~~~~~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~n~~l~~l~~ 105 (129)
..+.+.|+||++.| .+|++++ |||+||..||..|+.. .....||.||..+... ..+.+|+.+.++++
T Consensus 10 ~~~~~~C~IC~~~~----~~p~~~~~CgH~fC~~Ci~~~~~~----~~~~~CP~Cr~~~~~~----~~~~~n~~l~~~i~ 77 (92)
T 3ztg_A 10 IPDELLCLICKDIM----TDAVVIPCCGNSYCDECIRTALLE----SDEHTCPTCHQNDVSP----DALIANKFLRQAVN 77 (92)
T ss_dssp CCTTTEETTTTEEC----SSCEECTTTCCEECHHHHHHHHHH----CTTCCCTTTCCSSCCT----TSCEECHHHHHHHH
T ss_pred CCcCCCCCCCChhh----cCceECCCCCCHHHHHHHHHHHHh----cCCCcCcCCCCcCCCc----cccCcCHHHHHHHH
Confidence 34589999999999 7999999 9999999999999986 3457999999986433 46889999999999
Q ss_pred HHHhhc
Q psy11857 106 LMSRQR 111 (129)
Q Consensus 106 ~~~~~~ 111 (129)
.+.+.+
T Consensus 78 ~~~~~~ 83 (92)
T 3ztg_A 78 NFKNET 83 (92)
T ss_dssp HHHHHH
T ss_pred HHHHHH
Confidence 998764
|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 129 | ||||
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 9e-07 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-06 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-05 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 1e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 5e-05 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 6e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-04 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 8e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 0.001 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.003 |
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Acute promyelocytic leukaemia proto-oncoprotein PML species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.0 bits (96), Expect = 9e-07
Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 13/63 (20%)
Query: 30 FLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRG 89
FL C C PKLLPC HT+C CL ++CPIC+ +
Sbjct: 6 FLRCQQCQAEAK----CPKLLPCLHTLCSGCLEA---------SGMQCPICQAPWPLGAD 52
Query: 90 GVA 92
A
Sbjct: 53 TPA 55
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.73 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.71 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.7 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.67 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.67 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.59 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.54 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.48 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.45 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.44 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.44 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.43 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.19 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.02 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.0 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.84 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 95.08 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 88.4 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 87.37 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 87.04 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 84.53 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 84.01 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 83.59 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.79 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 82.3 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 82.22 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.73 E-value=1.1e-18 Score=102.76 Aligned_cols=69 Identities=14% Similarity=0.215 Sum_probs=60.0
Q ss_pred CccccccccccccCCCCceEeecCCchhHHHhHHHHHHhccCCCCccccccCCcceeeCCCCCCCCChhHHHHHHHHHHH
Q psy11857 29 SFLTCGTCLCMYDGGEHTPKLLPCSHTVCLHCLSRIAASQTRETGTLRCPICREQITIPRGGVAALPPSFLVNQLLDLMS 108 (129)
Q Consensus 29 ~~l~C~iC~~~~~~~~~~p~~l~CgH~fC~~Cl~~~~~~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~n~~l~~l~~~~~ 108 (129)
+++.||||+++| ++|++++|||+||..||.+|+.. ....||.|+..+.. ..+.+|..++++++.+.
T Consensus 6 ~~l~CpIc~~l~----~dPv~~~cGhtfc~~ci~~~l~~-----~~~~cP~c~~~l~~-----~~l~pN~~L~~~I~~~l 71 (80)
T d2c2la2 6 DYLCGKISFELM----REPCITPSGITYDRKDIEEHLQR-----VGHFNPVTRSPLTQ-----EQLIPNLAMKEVIDAFI 71 (80)
T ss_dssp STTBCTTTCSBC----SSEEECSSCCEEETTHHHHHHHH-----TCSSCTTTCCCCCG-----GGCEECHHHHHHHHHHH
T ss_pred ccccCcCcCchh----hhhcccCCcCeecHHHHHHHHhc-----CCccCCCccccccc-----cccccHHHHHHHHHHHH
Confidence 489999999999 89999999999999999999986 34579999998764 36888999999999987
Q ss_pred hhc
Q psy11857 109 RQR 111 (129)
Q Consensus 109 ~~~ 111 (129)
+..
T Consensus 72 ~~~ 74 (80)
T d2c2la2 72 SEN 74 (80)
T ss_dssp TTC
T ss_pred HHC
Confidence 643
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|