Psyllid ID: psy1188


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MAIQASIKNQKPIVIFVNVRKFTMAESSREAEEKPSSERTPDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNRERRMMQMMQGRGGPGPSGAHAPLLTGPPMPRGSVPLQAALSSTRMGRGDY
cccHHHHHHccccEEEEccEEEEEcccccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHccccEEEEEcccccccHHHHHHHHcccccEEEEEEEccEEEEEEccHHHHHHHHHHHcccEEccEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
cccEcccccccHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEcccHHHHHHHHHHHcccccEEEccccEEEEcccccccccHHHHHHHEEEEEEcccccccHHHHHHHHHHcccEEEEEEcccEEEEEcccHHHHHHHHHHHcccEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
maiqasiknqkpIVIFVNVRKFtmaessreaeekpssertpdyTKLLEYGLDKRIAGKLDDIFKTGKHLlsrgcdiivdwadpqeepdtetmsKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNelngqtvagstlevslakppsdkkkkEEILRNRERRMMQMMqgrggpgpsgahaplltgppmprgsvplqaalsstrmgrgdy
maiqasiknqkpivifVNVRKFTMaessreaeekpssertpdytKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADpqeepdtetmskvkVLYVRNLTQYCTEEKLKEafeqygrvervkRIKDYAFVHFEDRQEAITAMNELNGQTVAGStlevslakppsdkkkkeeILRNRERRMMQMMQGRGGPGPSGAHAPLLTGPPMPRGSVPlqaalsstrmgrgdy
MAIQASIKNQKPIVIFVNVRKFTMAESSREAEEKPSSERTPDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNrerrmmqmmqgrggpgpSGAHAPLLTGPPMPRGSVPLQAALSSTRMGRGDY
***********PIVIFVNVRKFT*******************YTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWAD**********SKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMN***********************************************************************************
**************IFVNVRKFTMAESSREAEEKPSSERTPDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIV*******************LYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLEV*********************************************************************
MAIQASIKNQKPIVIFVNVRKFTM****************PDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLE*************EEILRNRERRMMQM*********SGAHAPLLTGPPMPRGSVPLQAA***********
*AIQASIKNQKPIVIFVNVRKFTMAESSREAEEKPSSERTPDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSD************RRMMQMMQGRGGPGPSGAHAPLLTGPPMPRGSVPLQAALSSTRMGRGD*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIQASIKNQKPIVIFVNVRKFTMAESSREAEEKPSSERTPDYTKLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNRERRMMQMMQGRGGPGPSGAHAPLLTGPPMPRGSVPLQAALSSTRMGRGDY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
O60506 623 Heterogeneous nuclear rib no N/A 0.508 0.187 0.487 7e-29
Q7TMK9 623 Heterogeneous nuclear rib no N/A 0.508 0.187 0.478 2e-28
Q7TP47 533 Heterogeneous nuclear rib yes N/A 0.508 0.219 0.478 2e-28
O43390 633 Heterogeneous nuclear rib no N/A 0.460 0.167 0.536 4e-27
Q8TBY0 533 Probable RNA-binding prot no N/A 0.486 0.210 0.464 4e-25
Q4R2Z0 485 Probable RNA-binding prot N/A N/A 0.486 0.230 0.464 6e-25
P86049 533 Probable RNA-binding prot no N/A 0.486 0.210 0.464 7e-25
Q08BH5 510 Probable RNA-binding prot no N/A 0.526 0.237 0.472 2e-24
Q91WT8 590 RNA-binding protein 47 OS no N/A 0.526 0.205 0.454 4e-24
Q66H68 590 RNA-binding protein 47 OS no N/A 0.526 0.205 0.454 5e-24
>sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 78  VDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFE 137
           V+WADP E+PD E M+KVKVL+VRNL    TEE L++AF Q+G++ERVK++KDYAF+HF+
Sbjct: 320 VEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFD 379

Query: 138 DRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNRERRMMQMMQGRGGP 194
           +R  A+ AM E+NG+ + G  +E+  AKPP  K+K+ +  R   +  M       GP
Sbjct: 380 ERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGP 436




Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins.
Homo sapiens (taxid: 9606)
>sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 Back     alignment and function description
>sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 Back     alignment and function description
>sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 Back     alignment and function description
>sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 Back     alignment and function description
>sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 Back     alignment and function description
>sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=4 SV=1 Back     alignment and function description
>sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 Back     alignment and function description
>sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=2 SV=1 Back     alignment and function description
>sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
242011880 548 Heterogeneous nuclear ribonucleoprotein 0.647 0.271 0.689 2e-57
332026895 724 Heterogeneous nuclear ribonucleoprotein 0.586 0.186 0.760 2e-56
307212325 649 Heterogeneous nuclear ribonucleoprotein 0.586 0.208 0.760 2e-56
350409228 664 PREDICTED: heterogeneous nuclear ribonuc 0.665 0.230 0.695 3e-56
328789990 664 PREDICTED: heterogeneous nuclear ribonuc 0.665 0.230 0.695 4e-56
380011709 667 PREDICTED: LOW QUALITY PROTEIN: heteroge 0.665 0.229 0.695 4e-56
307173250 683 Heterogeneous nuclear ribonucleoprotein 0.6 0.202 0.757 1e-55
383847619 664 PREDICTED: heterogeneous nuclear ribonuc 0.665 0.230 0.689 2e-55
195055139 532 GH17270 [Drosophila grimshawi] gi|193892 0.643 0.278 0.701 4e-52
270001371 638 hypothetical protein TcasGA2_TC000185 [T 0.578 0.208 0.764 4e-52
>gi|242011880|ref|XP_002426671.1| Heterogeneous nuclear ribonucleoprotein Q, putative [Pediculus humanus corporis] gi|212510842|gb|EEB13933.1| Heterogeneous nuclear ribonucleoprotein Q, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/164 (68%), Positives = 127/164 (77%), Gaps = 15/164 (9%)

Query: 73  GCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYA 132
           GCDIIVDWADPQEEPD ETMSKVKVLYVRNLTQ C+EEKLKE+FE YG+++RVK+IKDYA
Sbjct: 330 GCDIIVDWADPQEEPDAETMSKVKVLYVRNLTQDCSEEKLKESFEVYGKIDRVKKIKDYA 389

Query: 133 FVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNRERRMMQMMQGRG 192
           F+HFEDR  AI A+NELNG+ +AG+ +EVSLAKPPSDKKKKEE+LR RERRMMQMMQGRG
Sbjct: 390 FIHFEDRDNAIKALNELNGKDLAGACIEVSLAKPPSDKKKKEEVLRARERRMMQMMQGRG 449

Query: 193 GPGPSGAHAPLLTGPPM---------PRGSVPLQAALSSTRMGR 227
           G  PS    P + G PM         PRGS      L    MGR
Sbjct: 450 GSSPS---HPAMMGSPMASLRGPGAGPRGSA---GGLRCAAMGR 487




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332026895|gb|EGI66996.1| Heterogeneous nuclear ribonucleoprotein Q [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307212325|gb|EFN88129.1| Heterogeneous nuclear ribonucleoprotein Q [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350409228|ref|XP_003488661.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328789990|ref|XP_392307.4| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380011709|ref|XP_003689940.1| PREDICTED: LOW QUALITY PROTEIN: heterogeneous nuclear ribonucleoprotein Q-like [Apis florea] Back     alignment and taxonomy information
>gi|307173250|gb|EFN64303.1| Heterogeneous nuclear ribonucleoprotein Q [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383847619|ref|XP_003699450.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195055139|ref|XP_001994478.1| GH17270 [Drosophila grimshawi] gi|193892241|gb|EDV91107.1| GH17270 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|270001371|gb|EEZ97818.1| hypothetical protein TcasGA2_TC000185 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
FB|FBgn0038826 711 Syp "Syncrip" [Drosophila mela 0.643 0.208 0.596 4.5e-54
WB|WBGene00002000611 hrp-2 [Caenorhabditis elegans 0.478 0.180 0.531 1.4e-31
UNIPROTKB|F6XIK8562 SYNCRIP "Uncharacterized prote 0.439 0.179 0.534 1.6e-30
UNIPROTKB|O60506 623 SYNCRIP "Heterogeneous nuclear 0.439 0.162 0.534 3.2e-30
UNIPROTKB|F2Z5D4 627 SYNCRIP "Uncharacterized prote 0.439 0.161 0.534 3.3e-30
UNIPROTKB|F1MCT8 638 SYNCRIP "Uncharacterized prote 0.439 0.158 0.534 3.7e-30
MGI|MGI:1891690 623 Syncrip "synaptotagmin binding 0.439 0.162 0.524 6.8e-30
UNIPROTKB|E7ETM7 473 HNRNPR "Heterogeneous nuclear 0.543 0.264 0.523 1.6e-29
UNIPROTKB|E1BZR1 661 HNRNPR "Uncharacterized protei 0.543 0.189 0.531 3.1e-29
ZFIN|ZDB-GENE-030131-3104560 syncripl "synaptotagmin bindin 0.447 0.183 0.514 3.4e-29
FB|FBgn0038826 Syp "Syncrip" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 443 (161.0 bits), Expect = 4.5e-54, Sum P(2) = 4.5e-54
 Identities = 90/151 (59%), Positives = 106/151 (70%)

Query:    73 GCDIIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYA 132
             GCDIIVDWADPQEEPD +TMSKVKVLYVRNLTQ  +E+KLKE FEQYG+VERVK+IKDYA
Sbjct:   317 GCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKVERVKKIKDYA 376

Query:   133 FVHFEDRQEAITAMNELNGQTVAGSTLEVSLAKPPSDKKKKEEILR--NXXXXXXXXXXX 190
             F+HFEDR  A+ AM  LNG+ +  S +EVSLAKPPSDKKKKEEILR              
Sbjct:   377 FIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQARP 436

Query:   191 XXXXXXSGAHAPLLTGPPM-PRGSVPLQAAL 220
                   S  H  +++  PM P   +PL+  +
Sbjct:   437 GIVGNLSPTHPSIMSLTPMRPGARMPLRTPI 467


GO:0003729 "mRNA binding" evidence=ISS;IDA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0022008 "neurogenesis" evidence=IMP
GO:0046011 "regulation of oskar mRNA translation" evidence=IMP
GO:0007310 "oocyte dorsal/ventral axis specification" evidence=IMP
GO:0046843 "dorsal appendage formation" evidence=IMP
GO:0035770 "ribonucleoprotein granule" evidence=IDA
WB|WBGene00002000 hrp-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F6XIK8 SYNCRIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O60506 SYNCRIP "Heterogeneous nuclear ribonucleoprotein Q" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5D4 SYNCRIP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCT8 SYNCRIP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1891690 Syncrip "synaptotagmin binding, cytoplasmic RNA interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETM7 HNRNPR "Heterogeneous nuclear ribonucleoprotein R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZR1 HNRNPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3104 syncripl "synaptotagmin binding, cytoplasmic RNA interacting protein, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-38
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 4e-36
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 4e-25
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 8e-25
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 5e-24
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 8e-24
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 3e-22
smart0036073 smart00360, RRM, RNA recognition motif 1e-19
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-18
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-18
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-16
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-15
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-14
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 2e-13
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-13
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-13
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 6e-13
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-12
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 5e-12
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 8e-12
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 9e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-11
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-11
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-11
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-11
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-11
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-11
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-10
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-10
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-10
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-10
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-10
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-10
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-10
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-10
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-10
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-10
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 6e-10
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-09
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-09
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 4e-09
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-09
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 6e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 7e-09
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 8e-09
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 8e-09
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-09
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-08
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-08
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-08
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 1e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-08
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-08
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 2e-08
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-08
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 2e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-08
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-08
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 3e-08
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-08
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 5e-08
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-08
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 6e-08
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 7e-08
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 7e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 8e-08
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 9e-08
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 1e-07
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-07
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 1e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-07
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-07
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 2e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 3e-07
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-07
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 3e-07
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 4e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 4e-07
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-07
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 4e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 4e-07
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-07
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 6e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 7e-07
cd12696107 cd12696, RRM3_PTBP2, RNA recognition motif 3 in ve 7e-07
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 8e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-07
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-06
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 1e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-06
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 1e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-06
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 2e-06
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-06
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 2e-06
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 3e-06
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 3e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 3e-06
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 3e-06
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 4e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 4e-06
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 5e-06
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 5e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 7e-06
cd1269776 cd12697, RRM3_ROD1, RNA recognition motif 3 in ver 8e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 8e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 8e-06
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 9e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 1e-05
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 1e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-05
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 1e-05
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 1e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 1e-05
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 2e-05
cd1268681 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 2e-05
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 2e-05
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-05
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-05
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 2e-05
cd1243979 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA 2e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 3e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 3e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-05
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 3e-05
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 3e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 3e-05
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 3e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 3e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 4e-05
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 4e-05
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 5e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 5e-05
cd1242576 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 6e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 6e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 6e-05
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-05
cd1243290 cd12432, RRM_ACINU, RNA recognition motif in apopt 6e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 7e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 8e-05
cd1269593 cd12695, RRM3_PTBP1, RNA recognition motif 3 in ve 9e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 9e-05
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 9e-05
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 1e-04
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 1e-04
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 1e-04
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 1e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 1e-04
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 1e-04
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 1e-04
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 1e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 1e-04
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 1e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-04
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 2e-04
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 2e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 2e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 2e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-04
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-04
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 3e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 3e-04
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 3e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 3e-04
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 4e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 4e-04
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 4e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 4e-04
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 4e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 5e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 5e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 5e-04
cd12294102 cd12294, RRM_Rrp7A, RNA recognition motif in ribos 5e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 6e-04
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 7e-04
cd1269876 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in p 7e-04
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 7e-04
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 7e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 9e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.001
TIGR01649 481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 0.001
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.001
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.001
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 0.001
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 0.001
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 0.001
cd1244373 cd12443, RRM_MCM3A_like, RNA recognition motif in 0.001
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 0.001
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.001
cd1271977 cd12719, RRM_SYNJ1, RNA recognition motif in synap 0.001
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.001
cd1268775 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in p 0.001
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 0.001
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 0.001
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.002
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 0.002
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.002
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 0.002
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.002
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.002
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 0.002
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.003
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.003
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 0.003
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 0.003
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 0.003
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.003
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 0.004
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.004
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 0.004
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 0.004
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 0.004
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
 Score =  127 bits (321), Expect = 3e-38
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 95  VKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTV 154
           VKVLYVRNL    TEE+L+E F +YG VERVK+IKDYAFVHFE+R +A+ AM E+NG+ +
Sbjct: 1   VKVLYVRNLPLSTTEEQLRELFSEYGEVERVKKIKDYAFVHFEERDDAVKAMEEMNGKEL 60

Query: 155 AGSTLEVSLAKP 166
            GS +EVSLAKP
Sbjct: 61  EGSPIEVSLAKP 72


This subfamily corresponds to the RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation factor (ACF). hnRNP R is a ubiquitously expressed nuclear RNA-binding protein that specifically bind mRNAs with a preference for poly(U) stretches and has been implicated in mRNA processing and mRNA transport, and also acts as a regulator to modify binding to ribosomes and RNA translation. hnRNP Q is also a ubiquitously expressed nuclear RNA-binding protein. It has been identified as a component of the spliceosome complex, as well as a component of the apobec-1 editosome, and has been implicated in the regulation of specific mRNA transport. ACF is an RNA-binding subunit of a core complex that interacts with apoB mRNA to facilitate C to U RNA editing. It may also act as an apoB mRNA recognition factor and chaperone and play a key role in cell growth and differentiation. This family also includes two functionally unknown RNA-binding proteins, RBM46 and RBM47. All members contain three conserved RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). Length = 72

>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241140 cd12696, RRM3_PTBP2, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241141 cd12697, RRM3_ROD1, RNA recognition motif 3 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA (uracil-5-)-methyltransferase homolog A (TRMT2A) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240878 cd12432, RRM_ACINU, RNA recognition motif in apoptotic chromatin condensation inducer in the nucleus (acinus) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241139 cd12695, RRM3_PTBP1, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|241142 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240889 cd12443, RRM_MCM3A_like, RNA recognition motif in 80 kDa MCM3-associated protein (Map80) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241163 cd12719, RRM_SYNJ1, RNA recognition motif in synaptojanin-1 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241131 cd12687, RRM1_PTBPH3, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
KOG0117|consensus 506 99.98
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.96
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.96
KOG0109|consensus 346 99.93
KOG0144|consensus 510 99.93
KOG0148|consensus321 99.93
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.92
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.92
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.92
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.9
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.9
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.89
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.89
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.88
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.87
KOG0127|consensus 678 99.83
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.83
KOG0148|consensus 321 99.83
KOG0145|consensus360 99.82
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.81
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.79
KOG0127|consensus 678 99.78
KOG0145|consensus360 99.77
KOG0131|consensus203 99.76
KOG0117|consensus 506 99.74
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.73
KOG0124|consensus 544 99.72
KOG0123|consensus 369 99.72
KOG0110|consensus725 99.72
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.71
KOG4205|consensus311 99.71
KOG0123|consensus369 99.68
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.68
KOG0125|consensus 376 99.66
PLN03120 260 nucleic acid binding protein; Provisional 99.65
KOG0107|consensus195 99.64
KOG0122|consensus270 99.6
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.6
PLN03213 759 repressor of silencing 3; Provisional 99.59
KOG0105|consensus241 99.58
KOG0114|consensus124 99.58
KOG0121|consensus153 99.58
KOG0146|consensus371 99.56
KOG0109|consensus 346 99.56
KOG0149|consensus247 99.55
KOG0105|consensus241 99.55
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.54
PLN03121243 nucleic acid binding protein; Provisional 99.53
KOG0147|consensus 549 99.53
KOG4207|consensus256 99.52
smart0036272 RRM_2 RNA recognition motif. 99.52
KOG1457|consensus284 99.52
KOG0111|consensus 298 99.51
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.51
KOG0113|consensus 335 99.5
KOG0106|consensus216 99.5
KOG0110|consensus725 99.49
KOG4206|consensus221 99.47
KOG0130|consensus170 99.47
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.45
smart0036071 RRM RNA recognition motif. 99.43
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.41
KOG0131|consensus203 99.38
KOG4206|consensus221 99.38
KOG0146|consensus 371 99.37
KOG0108|consensus 435 99.37
KOG4211|consensus 510 99.34
KOG0153|consensus377 99.33
KOG0126|consensus219 99.32
KOG1190|consensus492 99.31
KOG0144|consensus 510 99.3
KOG0132|consensus 894 99.29
smart0036170 RRM_1 RNA recognition motif. 99.25
KOG0415|consensus479 99.23
KOG1190|consensus492 99.22
KOG0124|consensus 544 99.17
KOG1456|consensus 494 99.17
KOG4661|consensus 940 99.14
KOG4212|consensus608 99.14
KOG0116|consensus419 99.12
KOG4212|consensus 608 99.11
KOG1548|consensus382 99.1
KOG1457|consensus 284 99.0
KOG0106|consensus216 98.98
KOG0151|consensus 877 98.92
KOG0226|consensus290 98.86
KOG4205|consensus 311 98.85
KOG4208|consensus214 98.81
KOG4660|consensus 549 98.77
KOG0533|consensus243 98.74
KOG0129|consensus520 98.74
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.7
KOG0112|consensus 975 98.69
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.65
KOG0147|consensus549 98.63
KOG1456|consensus494 98.62
KOG0120|consensus500 98.61
KOG4454|consensus 267 98.58
KOG4209|consensus231 98.58
KOG1548|consensus382 98.57
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.55
KOG4210|consensus285 98.55
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.49
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.45
KOG0120|consensus500 98.35
KOG2193|consensus 584 98.18
KOG0107|consensus195 98.17
COG5175 480 MOT2 Transcriptional repressor [Transcription] 98.16
KOG4211|consensus 510 98.15
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.06
PLN03120260 nucleic acid binding protein; Provisional 98.03
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 98.01
KOG1365|consensus508 97.98
KOG1855|consensus484 97.93
KOG0128|consensus881 97.85
KOG3152|consensus278 97.8
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.79
KOG0149|consensus247 97.78
KOG0121|consensus153 97.77
KOG2193|consensus 584 97.75
KOG1995|consensus 351 97.75
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.74
PLN03213 759 repressor of silencing 3; Provisional 97.68
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.68
KOG4849|consensus 498 97.67
KOG0125|consensus376 97.65
KOG0122|consensus270 97.63
KOG0153|consensus377 97.6
KOG2202|consensus260 97.51
KOG0111|consensus298 97.5
KOG1365|consensus 508 97.44
PLN03121243 nucleic acid binding protein; Provisional 97.39
KOG0113|consensus335 97.39
KOG1996|consensus378 97.37
KOG0126|consensus219 97.36
KOG4307|consensus944 97.35
KOG0115|consensus275 97.32
KOG0129|consensus 520 97.3
KOG2416|consensus 718 97.27
smart0036272 RRM_2 RNA recognition motif. 97.22
KOG0114|consensus124 97.17
KOG4676|consensus 479 97.16
KOG0132|consensus 894 97.12
KOG4207|consensus256 97.06
KOG2314|consensus 698 96.98
KOG0130|consensus170 96.95
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.94
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 96.88
KOG4454|consensus267 96.81
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.6
KOG2068|consensus 327 96.57
KOG0108|consensus 435 96.56
smart0036071 RRM RNA recognition motif. 96.56
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.54
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 96.53
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.51
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.48
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 96.46
KOG4307|consensus 944 96.41
KOG0128|consensus881 96.25
KOG0112|consensus 975 96.24
KOG0415|consensus479 96.16
KOG4660|consensus 549 96.13
KOG4676|consensus 479 96.08
KOG0116|consensus419 95.85
KOG4574|consensus 1007 95.81
KOG2253|consensus 668 95.72
KOG2135|consensus526 95.62
KOG2591|consensus 684 95.55
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.13
KOG4285|consensus350 94.32
KOG0533|consensus243 94.11
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 93.61
KOG0804|consensus 493 91.72
KOG4661|consensus 940 90.89
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 89.77
smart0036170 RRM_1 RNA recognition motif. 89.51
KOG4210|consensus285 89.07
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 87.69
KOG2318|consensus 650 85.98
KOG0151|consensus 877 82.3
>KOG0117|consensus Back     alignment and domain information
Probab=99.98  E-value=1e-31  Score=224.28  Aligned_cols=154  Identities=45%  Similarity=0.722  Sum_probs=143.6

Q ss_pred             eccceeEeecCccccccccccccccCCc---------------------ceEEecchHHHHHHhhhhhcCCCeeeeeCce
Q psy1188          17 VNVRKFTMAESSREAEEKPSSERTPDYT---------------------KLLEYGLDKRIAGKLDDIFKTGKHLLSRGCD   75 (230)
Q Consensus        17 ~n~~~~~v~~l~~~~~e~~l~~~f~~~g---------------------~fv~~~~~~~~a~~~~~~~~~~~~~~~~~~~   75 (230)
                      ..-++|||+|+|++.+++||.+-+++.+                     +||+|+ +|.+|+.++++++++ .++++|+.
T Consensus       162 van~RLFiG~IPK~k~keeIlee~~kVteGVvdVivy~~p~dk~KNRGFaFveYe-~H~~Aa~aRrKl~~g-~~klwgn~  239 (506)
T KOG0117|consen  162 VANCRLFIGNIPKTKKKEEILEEMKKVTEGVVDVIVYPSPDDKTKNRGFAFVEYE-SHRAAAMARRKLMPG-KIKLWGNA  239 (506)
T ss_pred             eecceeEeccCCccccHHHHHHHHHhhCCCeeEEEEecCccccccccceEEEEee-cchhHHHHHhhccCC-ceeecCCc
Confidence            3446789999999999999998888765                     999997 688999999999999 79999999


Q ss_pred             eeeecCCCCCCCCccCCCCccEEEEecCCCCCCHHHHHHHhhcCCCeEEEEEecCEEEEEecCHHHHHHHHHHhCCcEec
Q psy1188          76 IIVDWADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNELNGQTVA  155 (230)
Q Consensus        76 i~v~~a~~~~~~~~~~~~~~~~lfV~nL~~~~te~~L~~~F~~~G~i~~~~i~rg~aFV~F~~~e~A~~Ai~~lng~~i~  155 (230)
                      +.|+||++...++.+.+..-+.|||+||+.++|+|.|+++|++||.|+.|+.+|+||||+|.+.++|.+|++.+||++|.
T Consensus       240 ~tVdWAep~~e~ded~ms~VKvLYVRNL~~~tTeE~lk~~F~~~G~veRVkk~rDYaFVHf~eR~davkAm~~~ngkeld  319 (506)
T KOG0117|consen  240 ITVDWAEPEEEPDEDTMSKVKVLYVRNLMESTTEETLKKLFNEFGKVERVKKPRDYAFVHFAEREDAVKAMKETNGKELD  319 (506)
T ss_pred             ceeeccCcccCCChhhhhheeeeeeeccchhhhHHHHHHHHHhccceEEeecccceeEEeecchHHHHHHHHHhcCceec
Confidence            99999999999999888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEeEEEEeCCCCchhh
Q psy1188         156 GSTLEVSLAKPPSDKKK  172 (230)
Q Consensus       156 g~~l~V~~a~~~~~~~~  172 (230)
                      |.+|.|.+|+|..+++.
T Consensus       320 G~~iEvtLAKP~~k~k~  336 (506)
T KOG0117|consen  320 GSPIEVTLAKPVDKKKK  336 (506)
T ss_pred             CceEEEEecCChhhhcc
Confidence            99999999999876643



>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 5e-23
2dk2_A97 Solution Structure Of Rrm Domain In Heterogeneous N 1e-21
2cpd_A99 Solution Structure Of The Rna Recognition Motif Of 7e-20
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 7e-10
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 8e-09
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 5e-08
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 8e-08
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 3e-07
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 5e-07
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 2e-06
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 3e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-06
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 3e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 3e-06
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 4e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 4e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 4e-06
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 4e-06
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 7e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 9e-06
2osq_A74 Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length 1e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 1e-05
1wf1_A110 Solution Structure Of Rrm Domain In Rna-Binding Pro 2e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 3e-05
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 3e-05
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-05
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 4e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 4e-05
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 4e-05
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 4e-05
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 4e-05
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 5e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 5e-05
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 8e-05
2cqi_A103 Solution Structure Of The Rna Binding Domain Of Nuc 8e-05
3pgw_S 437 Crystal Structure Of Human U1 Snrnp Length = 437 1e-04
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 1e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 1e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 1e-04
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 1e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 2e-04
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 2e-04
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 2e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-04
3sde_B 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 2e-04
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 3e-04
3lqv_A115 Branch Recognition By Sf3b14 Length = 115 4e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 4e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 4e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 4e-04
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 6e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 7e-04
2f9d_A125 2.5 Angstrom Resolution Structure Of The Spliceosom 7e-04
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 7e-04
2cpe_A113 Solution Structure Of The Rna Recognition Motif Of 8e-04
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 8e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 8e-04
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 8e-04
3sde_A 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 9e-04
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 9e-04
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure

Iteration: 1

Score = 103 bits (258), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 45/90 (50%), Positives = 67/90 (74%) Query: 89 TETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMNE 148 + M+KVKVL+VRNL TEE L++AF Q+G++ERVK++KDYAF+HF++R A+ AM E Sbjct: 5 SSGMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEE 64 Query: 149 LNGQTVAGSTLEVSLAKPPSDKKKKEEILR 178 +NG+ + G +E+ AKPP K+K+ + R Sbjct: 65 MNGKDLEGENIEIVFAKPPDQKRKERKAQR 94
>pdb|2DK2|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein R (Hnrnp R) Length = 97 Back     alignment and structure
>pdb|2CPD|A Chain A, Solution Structure Of The Rna Recognition Motif Of Human Apobec-1 Complementation Factor, Acf Length = 99 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2OSQ|A Chain A, Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length = 74 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|1WF1|A Chain A, Solution Structure Of Rrm Domain In Rna-Binding Protein Np_057951 Length = 110 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2CQI|A Chain A, Solution Structure Of The Rna Binding Domain Of Nucleolysin Tiar Length = 103 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|3LQV|A Chain A, Branch Recognition By Sf3b14 Length = 115 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2F9D|A Chain A, 2.5 Angstrom Resolution Structure Of The Spliceosomal Protein P14 Bound To Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2CPE|A Chain A, Solution Structure Of The Rna Recognition Motif Of Ewing Sarcoma(Ews) Protein Length = 113 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-38
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-38
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-30
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-18
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-15
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-30
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-27
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-26
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-26
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-26
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-25
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-16
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-12
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-23
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-23
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-22
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 8e-22
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-15
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 9e-22
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-21
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-21
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-21
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-21
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-19
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-21
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 8e-21
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-20
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-20
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-17
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-20
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-20
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-20
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 8e-20
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 9e-20
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-19
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-19
1x5p_A97 Negative elongation factor E; structure genomics, 1e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-19
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-19
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-19
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-19
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-19
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-19
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-19
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-19
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-19
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-19
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 5e-19
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 5e-19
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 6e-19
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-19
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-11
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-19
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-19
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-13
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-19
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-18
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-18
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-18
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-18
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-18
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-18
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-18
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-18
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-18
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-18
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-18
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-18
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-16
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-18
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-18
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-18
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-18
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-18
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-18
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-18
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-17
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-18
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-18
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-17
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-17
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-17
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-16
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-17
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-17
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-15
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-15
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 9e-17
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-16
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-16
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-16
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-16
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-16
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-16
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-16
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-16
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 8e-16
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-16
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-15
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-15
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-15
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-15
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 7e-15
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-14
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-14
2div_A99 TRNA selenocysteine associated protein; structural 4e-14
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 6e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 9e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-13
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-13
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-11
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-13
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-13
2la6_A99 RNA-binding protein FUS; structural genomics, nort 6e-13
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-13
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-12
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-12
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-11
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-11
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 8e-11
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 8e-11
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-10
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-10
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-10
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 2e-10
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-10
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-10
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 6e-10
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-09
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 8e-09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 9e-09
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 6e-08
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 8e-08
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 3e-07
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 5e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-06
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-05
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 3e-05
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 9e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 1e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-04
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-04
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 3e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 8e-04
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
 Score =  128 bits (323), Expect = 2e-38
 Identities = 45/103 (43%), Positives = 69/103 (66%), Gaps = 3/103 (2%)

Query: 88  DTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITAMN 147
            +  M+KVKVL+VRNL    TEE L++AF Q+G++ERVK++KDYAF+HF++R  A+ AM 
Sbjct: 4   GSSGMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAME 63

Query: 148 ELNGQTVAGSTLEVSLAKPPSDKKKKEEILRNRERRMMQMMQG 190
           E+NG+ + G  +E+  AKPP  K+K+    + + +       G
Sbjct: 64  EMNGKDLEGENIEIVFAKPPDQKRKE---RKAQRQAASGPSSG 103


>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.95
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.94
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.94
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.94
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.94
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.94
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.94
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.94
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.94
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.94
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.94
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.93
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.93
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.92
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.91
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.88
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.87
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.87
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.86
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.86
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.86
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.86
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.86
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.86
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.85
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.85
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.85
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.85
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.85
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.85
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.85
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.85
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.85
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.84
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.84
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.84
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.84
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.84
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.84
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.84
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.84
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.84
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.84
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.84
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.84
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.84
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.83
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.83
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.83
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.83
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.83
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.83
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.83
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.83
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.83
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.83
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.83
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.83
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.83
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.83
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.83
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.83
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.82
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.82
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.82
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.82
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.82
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.82
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.82
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.82
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.82
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.82
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.82
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.82
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.82
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.82
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.82
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.82
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.82
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.82
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.82
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.82
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.82
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.82
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.81
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.81
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.81
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.81
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.81
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.81
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.81
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.81
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.81
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.8
1x5p_A97 Negative elongation factor E; structure genomics, 99.8
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.8
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.8
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.8
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.8
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.8
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.8
2div_A99 TRNA selenocysteine associated protein; structural 99.8
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.8
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.8
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.79
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.79
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.79
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.79
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.79
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.79
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.79
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.79
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.79
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.79
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.79
2dis_A109 Unnamed protein product; structural genomics, RRM 99.79
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.79
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.79
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.79
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.79
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.78
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.78
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.78
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.78
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.78
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.78
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.78
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.78
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.78
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.78
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.78
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.78
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.78
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.77
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.77
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.77
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.77
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.77
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.77
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.77
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.77
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.76
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.76
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.76
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.76
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.76
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.76
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.75
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.75
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.75
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.74
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.74
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.74
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.59
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.74
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.73
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.73
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.73
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.72
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.72
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.72
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.71
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.71
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.71
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.7
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.69
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.67
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.67
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.67
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.67
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.66
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.66
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.66
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.66
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.65
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.62
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.62
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.6
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.59
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.59
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.58
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.56
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.56
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.55
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.48
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.48
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.47
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.44
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.26
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.04
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.97
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.97
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.96
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.95
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.94
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.91
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.91
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.89
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.88
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.87
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.86
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.76
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.73
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.72
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.72
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.72
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.71
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.71
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.71
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.7
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.7
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.69
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.68
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.68
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.68
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.67
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.67
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.67
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.67
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.67
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.67
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.66
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.66
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.66
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.66
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.66
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.65
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.65
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.65
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.64
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.64
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.64
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.63
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.63
2dis_A109 Unnamed protein product; structural genomics, RRM 98.63
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.63
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.62
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.62
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.62
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.62
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.62
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.62
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.62
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.62
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.62
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.62
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.61
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.61
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.61
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.61
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.6
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.6
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.6
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.59
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.59
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.59
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.59
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.58
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.58
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.57
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.56
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.56
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.56
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.56
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.55
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.55
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.54
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.54
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.54
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.54
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.54
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.54
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.54
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.54
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.53
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.53
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.53
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.53
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.52
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.52
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.52
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.52
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.51
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.51
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.51
2div_A99 TRNA selenocysteine associated protein; structural 98.51
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.51
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.5
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.49
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.49
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.49
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.48
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.48
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.47
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.47
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.46
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.45
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.45
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.45
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.44
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.43
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.43
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.43
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.42
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.42
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.42
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.41
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.41
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.41
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.4
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.4
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.4
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.4
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.39
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.38
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.37
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.35
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.35
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.35
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.34
1x5p_A97 Negative elongation factor E; structure genomics, 98.33
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.33
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.32
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.3
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.3
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.28
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.27
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.25
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.25
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.24
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.23
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.23
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.22
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.21
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.21
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.2
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.5
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.18
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.16
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.14
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.09
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.08
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.03
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.96
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.74
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.61
2dit_A112 HIV TAT specific factor 1 variant; structural geno 97.5
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.49
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.45
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.4
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 97.31
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 96.96
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 96.91
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 96.9
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.77
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.53
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 96.51
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 96.18
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 95.56
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 95.27
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 95.17
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 94.32
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 93.9
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 93.12
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 91.81
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 90.93
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 87.3
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.96  E-value=1.3e-29  Score=201.57  Aligned_cols=142  Identities=19%  Similarity=0.322  Sum_probs=121.6

Q ss_pred             cceeEeecCccccccccccccccCCc-------------------ceEEecchHHHHHHhhhhhcCCCeeeeeCceeeee
Q psy1188          19 VRKFTMAESSREAEEKPSSERTPDYT-------------------KLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIVD   79 (230)
Q Consensus        19 ~~~~~v~~l~~~~~e~~l~~~f~~~g-------------------~fv~~~~~~~~a~~~~~~~~~~~~~~~~~~~i~v~   79 (230)
                      .++|||+|||++++|++|+++|++||                   +||+|.. ...|.+|.+.+...   .+.++.+++.
T Consensus        15 ~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~-~~~A~~Ai~~~~~~---~~~g~~i~~~   90 (213)
T 4f02_A           15 MASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQ-PADAERALDTMNFD---VIKGKPVRIM   90 (213)
T ss_dssp             CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESS-HHHHHHHHHHHTTC---EETTEECEEE
T ss_pred             CcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCC-HHHHHHHHHHhhhh---hcCCcccccc
Confidence            35799999999999999999999998                   7888974 55666665554333   8899999999


Q ss_pred             cCCCCCCCCccCCCCccEEEEecCCCCCCHHHHHHHhhcCCCeEEEEEe------cCEEEEEecCHHHHHHHHHHhCCcE
Q psy1188          80 WADPQEEPDTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRI------KDYAFVHFEDRQEAITAMNELNGQT  153 (230)
Q Consensus        80 ~a~~~~~~~~~~~~~~~~lfV~nL~~~~te~~L~~~F~~~G~i~~~~i~------rg~aFV~F~~~e~A~~Ai~~lng~~  153 (230)
                      ++.......   .....+|||+|||+++|+++|+++|+.||.|..|+|+      +|||||+|.+.++|.+|++.|||..
T Consensus        91 ~~~~~~~~~---~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~  167 (213)
T 4f02_A           91 WSQRDPSLR---KSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGML  167 (213)
T ss_dssp             ECCCCTHHH---HHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEETTEEEEEEEEEESSHHHHHHHHHHHTTCE
T ss_pred             ccccccccc---ccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccCCCCceEEEEEeCCHHHHHHHHHHhCCCE
Confidence            986543321   1234689999999999999999999999999999987      5799999999999999999999999


Q ss_pred             ecCcEeEEEEeCCC
Q psy1188         154 VAGSTLEVSLAKPP  167 (230)
Q Consensus       154 i~g~~l~V~~a~~~  167 (230)
                      |+|++|+|.+++++
T Consensus       168 ~~g~~i~V~~a~~~  181 (213)
T 4f02_A          168 LNDRKVFVGRFKSR  181 (213)
T ss_dssp             ETTEECEEEECCCH
T ss_pred             ECCEEEEEEEcCCC
Confidence            99999999999964



>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-21
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-20
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-19
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-17
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-16
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-16
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-16
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-16
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 7e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-15
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-15
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 9e-15
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-15
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-14
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-14
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-14
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-14
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 7e-14
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-13
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-13
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-13
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 5e-13
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 5e-13
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 9e-13
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-12
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-12
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 4e-12
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 5e-12
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 8e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 8e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-12
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-11
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-11
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-11
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-11
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 6e-11
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-10
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-10
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 4e-10
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 8e-10
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 9e-10
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-09
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-08
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 7e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 7e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-07
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 3e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-07
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-07
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 6e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 7e-07
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 6e-06
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-05
d1ufwa_95 d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) 7e-05
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 0.002
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: APOBEC1 stimulating protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 83.1 bits (205), Expect = 2e-21
 Identities = 41/82 (50%), Positives = 57/82 (69%), Gaps = 2/82 (2%)

Query: 88  DTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVE--RVKRIKDYAFVHFEDRQEAITA 145
           D +TMS VK+LYVRNL    +EE +++ F         RVK+I+DYAFVHF +R++A+ A
Sbjct: 1   DEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEA 60

Query: 146 MNELNGQTVAGSTLEVSLAKPP 167
           M  LNG+ + GS +EV+LAKP 
Sbjct: 61  MKALNGKVLDGSPIEVTLAKPV 82


>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.94
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.88
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.87
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.87
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.87
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.87
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.87
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.87
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.87
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.87
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.87
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.87
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.87
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.87
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.86
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.86
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.85
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.85
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.85
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.85
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.85
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.85
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.85
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.84
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.84
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.84
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.84
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.84
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.84
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.84
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.84
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.84
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.83
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.83
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.83
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.83
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.83
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.83
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.83
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.82
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.82
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.82
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.82
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.82
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.82
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.82
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.81
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.8
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.8
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.8
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.8
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.8
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.79
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.79
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.78
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.77
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.77
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.75
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.75
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.73
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.71
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.69
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.67
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.62
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.6
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.58
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.49
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.47
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.01
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.99
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.96
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.96
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.96
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.94
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.93
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.92
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.92
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.91
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.91
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.9
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.89
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.89
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.88
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.88
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.88
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.87
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.87
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.87
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.87
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.86
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.86
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.85
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.85
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.85
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.84
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.84
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.83
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.82
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.82
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.82
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.79
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.79
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.77
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.76
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.76
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.75
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.75
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.74
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.71
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.71
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.7
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.7
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.69
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.69
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.69
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.67
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.67
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.66
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.66
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.64
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.63
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.62
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.61
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.61
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.6
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.59
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.58
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.56
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.56
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.54
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.53
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.51
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.51
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.46
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.4
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.35
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.28
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.17
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.16
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.09
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.9
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.67
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.3
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 96.97
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 96.77
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.93
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 95.91
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=1e-26  Score=178.59  Aligned_cols=144  Identities=21%  Similarity=0.305  Sum_probs=118.3

Q ss_pred             ccceeEeecCccccccccccccccCCc-------------------ceEEecchHHHHHHhhhhhcCCCeeeeeCceeee
Q psy1188          18 NVRKFTMAESSREAEEKPSSERTPDYT-------------------KLLEYGLDKRIAGKLDDIFKTGKHLLSRGCDIIV   78 (230)
Q Consensus        18 n~~~~~v~~l~~~~~e~~l~~~f~~~g-------------------~fv~~~~~~~~a~~~~~~~~~~~~~~~~~~~i~v   78 (230)
                      .+++|||+|||+++|+++|+++|++||                   +|++|.. ...|.+|...    ....+..+.+.+
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~-~~~a~~a~~~----~~~~~~~~~~~~   79 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYAT-VEEVDAAMNA----RPHKVDGRVVEP   79 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESS-HHHHHHHHHT----CSCEETTEECEE
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCC-HHHHHHHHHh----cCCcccccchhh
Confidence            468999999999999999999999999                   7888864 5556655554    233677777777


Q ss_pred             ecCCCCCCC-CccCCCCccEEEEecCCCCCCHHHHHHHhhcCCCeEEEEEe--------cCEEEEEecCHHHHHHHHHHh
Q psy1188          79 DWADPQEEP-DTETMSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRI--------KDYAFVHFEDRQEAITAMNEL  149 (230)
Q Consensus        79 ~~a~~~~~~-~~~~~~~~~~lfV~nL~~~~te~~L~~~F~~~G~i~~~~i~--------rg~aFV~F~~~e~A~~Ai~~l  149 (230)
                      .+..+.... ........++|||+|||+++|+++|+++|+.||.|..+.++        +|||||+|.+.++|.+|++ +
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~  158 (183)
T d1u1qa_          80 KRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-Q  158 (183)
T ss_dssp             EECCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-S
T ss_pred             hhhhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-h
Confidence            766544332 22333456789999999999999999999999999999887        3599999999999999995 7


Q ss_pred             CCcEecCcEeEEEEeCCC
Q psy1188         150 NGQTVAGSTLEVSLAKPP  167 (230)
Q Consensus       150 ng~~i~g~~l~V~~a~~~  167 (230)
                      +++.|.|++|+|.+|.++
T Consensus       159 ~~~~~~G~~i~V~~A~~k  176 (183)
T d1u1qa_         159 KYHTVNGHNCEVRKALSK  176 (183)
T ss_dssp             SCEEETTEEEEEEECCCH
T ss_pred             CCCeECCEEEEEEecCCc
Confidence            999999999999999874



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure