Psyllid ID: psy1198
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| 390342409 | 2243 | PREDICTED: probable E3 ubiquitin-protein | 0.506 | 0.056 | 0.857 | 2e-59 | |
| 390342411 | 2243 | PREDICTED: probable E3 ubiquitin-protein | 0.506 | 0.056 | 0.857 | 3e-59 | |
| 62822206 | 560 | unknown [Homo sapiens] | 0.502 | 0.223 | 0.833 | 3e-58 | |
| 291235604 | 2140 | PREDICTED: thyroid hormone receptor inte | 0.506 | 0.058 | 0.850 | 4e-57 | |
| 405954644 | 1942 | Putative E3 ubiquitin-protein ligase TRI | 0.497 | 0.063 | 0.838 | 5e-57 | |
| 74144015 | 756 | unnamed protein product [Mus musculus] | 0.502 | 0.165 | 0.833 | 1e-56 | |
| 183985686 | 1114 | LOC100158539 protein [Xenopus (Silurana) | 0.502 | 0.112 | 0.833 | 1e-56 | |
| 119591305 | 822 | thyroid hormone receptor interactor 12, | 0.502 | 0.152 | 0.833 | 1e-56 | |
| 119591308 | 807 | thyroid hormone receptor interactor 12, | 0.502 | 0.154 | 0.833 | 1e-56 | |
| 74182645 | 983 | unnamed protein product [Mus musculus] | 0.502 | 0.127 | 0.833 | 2e-56 |
| >gi|390342409|ref|XP_003725659.1| PREDICTED: probable E3 ubiquitin-protein ligase TRIP12-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
Score = 234 bits (597), Expect = 2e-59, Method: Compositional matrix adjust.
Identities = 108/126 (85%), Positives = 119/126 (94%)
Query: 123 ATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHN 182
++KA QLL LQA GDE QQLQAV+EMCQ+LVMGNEDTL GFPVKQVVPALI+LLSM+HN
Sbjct: 529 SSKAHQLLSGLQASGDESQQLQAVIEMCQLLVMGNEDTLGGFPVKQVVPALISLLSMEHN 588
Query: 183 FDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHS 242
FD+MN+ACRALTYMMEALPRSS+VV+DA+P FLEKLQVIQCMDVAEQSLTALEMLSRRHS
Sbjct: 589 FDIMNHACRALTYMMEALPRSSSVVMDAIPVFLEKLQVIQCMDVAEQSLTALEMLSRRHS 648
Query: 243 KAILQA 248
KAILQA
Sbjct: 649 KAILQA 654
|
Source: Strongylocentrotus purpuratus Species: Strongylocentrotus purpuratus Genus: Strongylocentrotus Family: Strongylocentrotidae Order: Echinoida Class: Echinoidea Phylum: Echinodermata Superkingdom: Eukaryota |
| >gi|390342411|ref|XP_783595.3| PREDICTED: probable E3 ubiquitin-protein ligase TRIP12-like isoform 3 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|62822206|gb|AAY14755.1| unknown [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|291235604|ref|XP_002737735.1| PREDICTED: thyroid hormone receptor interactor 12-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|405954644|gb|EKC22028.1| Putative E3 ubiquitin-protein ligase TRIP12 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|74144015|dbj|BAE22126.1| unnamed protein product [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|183985686|gb|AAI66201.1| LOC100158539 protein [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|119591305|gb|EAW70899.1| thyroid hormone receptor interactor 12, isoform CRA_d [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|119591308|gb|EAW70902.1| thyroid hormone receptor interactor 12, isoform CRA_g [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|74182645|dbj|BAE34675.1| unnamed protein product [Mus musculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| UNIPROTKB|F6X7F9 | 1980 | TRIP12 "Uncharacterized protei | 0.502 | 0.063 | 0.833 | 6.5e-49 | |
| UNIPROTKB|E1B7Q7 | 1992 | TRIP12 "E3 ubiquitin-protein l | 0.502 | 0.062 | 0.833 | 6.6e-49 | |
| UNIPROTKB|Q14669 | 1992 | TRIP12 "E3 ubiquitin-protein l | 0.502 | 0.062 | 0.833 | 6.6e-49 | |
| UNIPROTKB|E2R657 | 1993 | TRIP12 "Uncharacterized protei | 0.502 | 0.062 | 0.833 | 6.6e-49 | |
| UNIPROTKB|I3LK74 | 2002 | TRIP12 "Uncharacterized protei | 0.502 | 0.062 | 0.833 | 6.6e-49 | |
| UNIPROTKB|J9NRQ4 | 2011 | TRIP12 "Uncharacterized protei | 0.502 | 0.062 | 0.833 | 6.7e-49 | |
| MGI|MGI:1309481 | 2025 | Trip12 "thyroid hormone recept | 0.502 | 0.061 | 0.833 | 6.8e-49 | |
| RGD|1306607 | 2025 | Trip12 "thyroid hormone recept | 0.502 | 0.061 | 0.833 | 6.8e-49 | |
| UNIPROTKB|E1BZV7 | 2035 | TRIP12 "Uncharacterized protei | 0.502 | 0.061 | 0.833 | 8.7e-49 | |
| UNIPROTKB|B4F6W9 | 2056 | trip12 "E3 ubiquitin-protein l | 0.502 | 0.060 | 0.833 | 8.8e-49 |
| UNIPROTKB|F6X7F9 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 525 (189.9 bits), Expect = 6.5e-49, P = 6.5e-49
Identities = 105/126 (83%), Positives = 117/126 (92%)
Query: 123 ATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHN 182
++KAQQLL LQA DE QQLQAV+EMCQ+LVMGNE+TL GFPVK VVPALITLL M+HN
Sbjct: 442 SSKAQQLLQGLQA-SDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHN 500
Query: 183 FDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHS 242
FD+MN+ACRALTYMMEALPRSSAVV+DA+P FLEKLQVIQC+DVAEQ+LTALEMLSRRHS
Sbjct: 501 FDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS 560
Query: 243 KAILQA 248
KAILQA
Sbjct: 561 KAILQA 566
|
|
| UNIPROTKB|E1B7Q7 TRIP12 "E3 ubiquitin-protein ligase TRIP12" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14669 TRIP12 "E3 ubiquitin-protein ligase TRIP12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R657 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LK74 TRIP12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NRQ4 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1309481 Trip12 "thyroid hormone receptor interactor 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306607 Trip12 "thyroid hormone receptor interactor 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZV7 TRIP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4F6W9 trip12 "E3 ubiquitin-protein ligase TRIP12" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| PRK13875 | 440 | PRK13875, PRK13875, conjugal transfer protein TrbL | 3e-04 |
| >gnl|CDD|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional | Back alignment and domain information |
|---|
Score = 41.0 bits (97), Expect = 3e-04
Identities = 30/108 (27%), Positives = 44/108 (40%), Gaps = 4/108 (3%)
Query: 8 GGGVGGGGHHNSGSAAAAAATSGGGQGGKAATLYGAPGGGKAATLYAQSGMSAGETQGGS 67
G GGG G+AAAA + G +A GA GG AA +G+ G S
Sbjct: 293 GLAAGGGAAAAGGAAAAARGGAAAAGGASSAYSAGAAGGSGAAG--VAAGLGGVARAGAS 350
Query: 68 VAGEEDKNA--GAQGSTSTSGAASGTASTSLLSGVASSSSGPSHAPGA 113
A + A A S +S A ++ G A++++ + A G
Sbjct: 351 AAASPLRRAASRAAESMKSSFRAGARSTGGGAGGAAAAAAAGAAAAGP 398
|
Length = 440 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| KOG0168|consensus | 1051 | 100.0 | ||
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.97 | |
| KOG0166|consensus | 514 | 99.97 | ||
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.33 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 99.17 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.96 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.89 | |
| KOG0166|consensus | 514 | 98.72 | ||
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 98.41 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 98.28 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 98.26 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 98.03 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 97.91 | |
| KOG4224|consensus | 550 | 97.77 | ||
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 97.7 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.63 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 97.6 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.31 | |
| KOG1048|consensus | 717 | 97.31 | ||
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 97.29 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 97.17 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 96.86 | |
| KOG4224|consensus | 550 | 96.84 | ||
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 96.83 | |
| KOG2171|consensus | 1075 | 96.64 | ||
| PRK09687 | 280 | putative lyase; Provisional | 96.29 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 96.29 | |
| KOG2160|consensus | 342 | 96.28 | ||
| PF01749 | 97 | IBB: Importin beta binding domain; InterPro: IPR00 | 96.28 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.25 | |
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 96.25 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 96.04 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 95.94 | |
| PF06371 | 187 | Drf_GBD: Diaphanous GTPase-binding Domain; InterPr | 95.74 | |
| PF08167 | 165 | RIX1: rRNA processing/ribosome biogenesis | 95.6 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 95.33 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 95.05 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 94.99 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 94.88 | |
| PF05536 | 543 | Neurochondrin: Neurochondrin | 94.75 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 94.41 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 94.19 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 93.54 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 92.87 | |
| PF05004 | 309 | IFRD: Interferon-related developmental regulator ( | 92.78 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 92.68 | |
| KOG1059|consensus | 877 | 92.68 | ||
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 92.65 | |
| KOG1967|consensus | 1030 | 92.56 | ||
| KOG1241|consensus | 859 | 92.19 | ||
| KOG1048|consensus | 717 | 91.99 | ||
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 91.76 | |
| KOG4199|consensus | 461 | 91.68 | ||
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 91.39 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 91.01 | |
| KOG1293|consensus | 678 | 90.9 | ||
| KOG0567|consensus | 289 | 90.48 | ||
| KOG2171|consensus | 1075 | 90.43 | ||
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 90.39 | |
| PF11865 | 160 | DUF3385: Domain of unknown function (DUF3385); Int | 88.71 | |
| KOG0168|consensus | 1051 | 88.58 | ||
| PF12031 | 257 | DUF3518: Domain of unknown function (DUF3518); Int | 87.82 | |
| PF14668 | 73 | RICTOR_V: Rapamycin-insensitive companion of mTOR, | 87.48 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 86.9 | |
| KOG1820|consensus | 815 | 86.76 | ||
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 85.89 | |
| COG5240 | 898 | SEC21 Vesicle coat complex COPI, gamma subunit [In | 85.27 | |
| cd03569 | 142 | VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s | 85.06 | |
| PF00790 | 140 | VHS: VHS domain; InterPro: IPR002014 The VHS domai | 85.02 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 85.0 | |
| KOG2032|consensus | 533 | 84.69 | ||
| KOG1293|consensus | 678 | 84.41 | ||
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 84.21 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 84.01 | |
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 83.95 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 83.08 | |
| KOG1824|consensus | 1233 | 82.56 | ||
| PF05536 | 543 | Neurochondrin: Neurochondrin | 81.59 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 81.07 | |
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 80.82 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 80.18 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 80.16 |
| >KOG0168|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-41 Score=338.87 Aligned_cols=155 Identities=54% Similarity=0.810 Sum_probs=148.4
Q ss_pred cchhHHHHhhCCCCCCCCCCcc--------CccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCCCCC
Q psy1198 94 TSLLSGVASSSSGPSHAPGAAL--------DSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFP 165 (249)
Q Consensus 94 ~~r~q~Llkrr~l~~~~~gs~~--------~~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~~fp 165 (249)
.+|+|++++.|++++|+||.+. +.+.++.++|+++||++|++..||+.||++|.||||+|+|.||+.++.||
T Consensus 129 ~grl~~~~e~~~l~qhl~g~lgprv~~ll~rt~~~sasSk~kkLL~gL~~~~Des~Qleal~Elce~L~mgnEesLs~fp 208 (1051)
T KOG0168|consen 129 AGRLQALLEARGLPQHLFGRLGPRVLQLLHRTIGSSASSKAKKLLQGLQAESDESQQLEALTELCEMLSMGNEESLSGFP 208 (1051)
T ss_pred hhhhhhhhhccccCcccccccchhHHHHhhhcccccchHHHHHHHHhccccCChHHHHHHHHHHHHHHhhcchhhhcccc
Confidence 3999999999999999999863 56667777899999999998669999999999999999999999999999
Q ss_pred ccChHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhhchh
Q psy1198 166 VKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSK 243 (249)
Q Consensus 166 ~~glVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD~p~ 243 (249)
++.|||.||.+|++|+|+|||+.||||||||||+.|++..+|| +|||+||+||+.|+|||||||+|+|||+||++||+
T Consensus 209 v~slvp~Lv~LL~~E~n~DIMl~AcRaltyl~evlP~S~a~vV~~~aIPvl~~kL~~IeyiDvAEQ~LqALE~iSR~H~~ 288 (1051)
T KOG0168|consen 209 VKSLVPVLVALLSHEHNFDIMLLACRALTYLCEVLPRSSAIVVDEHAIPVLLEKLLTIEYIDVAEQSLQALEKISRRHPK 288 (1051)
T ss_pred HHHHHHHHHHHHhccccHHHHHHHHHHHHHHHhhccchhheeecccchHHHHHhhhhhhhhHHHHHHHHHHHHHHhhccH
Confidence 9999999999999999999999999999999999999999999 89999999999999999999999999999999999
Q ss_pred HHhhc
Q psy1198 244 AILQA 248 (249)
Q Consensus 244 aIL~a 248 (249)
+||+|
T Consensus 289 AiL~A 293 (1051)
T KOG0168|consen 289 AILQA 293 (1051)
T ss_pred HHHhc
Confidence 99996
|
|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG2160|consensus | Back alignment and domain information |
|---|
| >PF01749 IBB: Importin beta binding domain; InterPro: IPR002652 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] | Back alignment and domain information |
|---|
| >PF08167 RIX1: rRNA processing/ribosome biogenesis | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1059|consensus | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG1967|consensus | Back alignment and domain information |
|---|
| >KOG1241|consensus | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG4199|consensus | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG1293|consensus | Back alignment and domain information |
|---|
| >KOG0567|consensus | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length | Back alignment and domain information |
|---|
| >KOG0168|consensus | Back alignment and domain information |
|---|
| >PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG1820|consensus | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) | Back alignment and domain information |
|---|
| >PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG2032|consensus | Back alignment and domain information |
|---|
| >KOG1293|consensus | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.94 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.94 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.81 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.74 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.6 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.54 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.53 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.52 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.44 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.39 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.3 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.3 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.3 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.23 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.23 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.19 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.18 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.16 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.08 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.07 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.07 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.02 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.01 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.0 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.96 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 98.96 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 98.91 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 98.9 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 98.89 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 98.86 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 98.86 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 98.83 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 98.8 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.63 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 98.53 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 98.45 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 98.13 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 98.04 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 98.03 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.98 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.97 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.95 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 97.89 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 97.86 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.81 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.62 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.58 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.57 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.53 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 97.52 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.52 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 97.45 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 97.36 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.31 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 97.24 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 97.21 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 97.12 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 97.06 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 97.03 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 97.01 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 96.98 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.91 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 96.89 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.85 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 96.57 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 96.55 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 96.33 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 96.24 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 95.79 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 95.52 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 95.0 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 94.94 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 94.93 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 94.87 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 94.4 | |
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 91.9 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 91.44 | |
| 2f31_A | 233 | Diaphanous protein homolog 1; formin,MDIA1, protei | 90.93 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 90.71 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 90.18 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 89.95 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 89.36 | |
| 3eg5_B | 383 | Protein diaphanous homolog 1; protein-protein comp | 88.25 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 88.13 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 87.84 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 87.37 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 86.74 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 85.52 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 84.98 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 84.97 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 83.93 | |
| 3ebb_A | 304 | Phospholipase A2-activating protein; armadillo rep | 83.16 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 82.38 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 81.12 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 80.67 | |
| 2bnx_A | 386 | Diaphanous protein homolog 1; autoinhibition, acti | 80.13 |
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
Probab=99.94 E-value=8.4e-28 Score=225.09 Aligned_cols=148 Identities=14% Similarity=0.213 Sum_probs=124.3
Q ss_pred cchhHHHHhhCCCC--CCCCCCccC---ccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCCCCCccC
Q psy1198 94 TSLLSGVASSSSGP--SHAPGAALD---SESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQ 168 (249)
Q Consensus 94 ~~r~q~Llkrr~l~--~~~~gs~~~---~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~~fp~~g 168 (249)
.||+|.|.|||+++ ++...+.+. .........+++|++.|+| +|+..|++|++.+|++||.+++|||+.++..|
T Consensus 41 ~kr~e~l~krR~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lv~~l~s-~d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G 119 (529)
T 3tpo_A 41 AKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINS-NNLESQLQATQAARKLLSREKQPPIDNIIRAG 119 (529)
T ss_dssp ---CCSCSCCCCCC---------------CGGGSSCCHHHHHHHHTS-SCHHHHHHHHHHHHHHHTSSSCCCHHHHHHTT
T ss_pred HHHHHHHHhccCCCCCcccccChhhhccchhhhHHHHHHHHHHHhcC-CCHHHHHHHHHHHHHHHcCCCCchHHHHHHCC
Confidence 48999999999975 222222221 1122334568999999999 69999999999999999999999999988999
Q ss_pred hHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhhchh
Q psy1198 169 VVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSK 243 (249)
Q Consensus 169 lVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD~p~ 243 (249)
+||.||++|+.++++++|++|||||+||++++++++..|| |+||.|++ |+.+++.+|.|||+|||+||+.|++.
T Consensus 120 ~ip~Lv~lL~~~~~~~~q~~Aa~aL~nia~~~~~~~~~vv~~Gaip~Lv~-LL~s~~~~v~e~A~~aL~nLa~~~~~ 195 (529)
T 3tpo_A 120 LIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS-LLASPHAHISEQAVWALGNIAGAGSA 195 (529)
T ss_dssp HHHHHHHHHTCTTCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHH-HTTCSCHHHHHHHHHHHHHHHTTCHH
T ss_pred CHHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCCHHHHHH-HHcCCCHHHHHHHHHHHHHHhccCHH
Confidence 9999999999888999999999999999999999999999 99999996 88999999999999999999998764
|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 249 | ||||
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 1e-13 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 2e-04 | |
| d1wa5b_ | 503 | a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S | 4e-13 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 2e-05 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 3e-04 |
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Importin alpha species: Mouse (Mus musculus) [TaxId: 10090]
Score = 67.5 bits (163), Expect = 1e-13
Identities = 24/131 (18%), Positives = 50/131 (38%), Gaps = 4/131 (3%)
Query: 116 DSESED-TATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALI 174
D S T + + +V + + QLQA ++L + + ++P +
Sbjct: 3 DIGSNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV 62
Query: 175 TLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLT 232
+ L + + ALT + + V+ A+P F+ L ++EQ++
Sbjct: 63 SFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVW 121
Query: 233 ALEMLSRRHSK 243
AL ++ S
Sbjct: 122 ALGNIAGDGSA 132
|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.81 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.77 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.22 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.85 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.84 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 98.71 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 98.58 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.64 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 97.59 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.46 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 97.43 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 97.05 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.82 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.7 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.67 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.58 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 96.55 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.33 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.03 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 95.93 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 95.89 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 95.5 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 95.17 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 95.05 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 94.32 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 94.11 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 93.82 | |
| d2bnxa1 | 343 | Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { | 88.73 | |
| d1dvpa1 | 145 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 87.01 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 82.53 |
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Karyopherin alpha species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.81 E-value=7.6e-21 Score=169.60 Aligned_cols=148 Identities=23% Similarity=0.263 Sum_probs=120.7
Q ss_pred cchhHHHHhhCCCCCCCCCCc--------c--C-ccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCC
Q psy1198 94 TSLLSGVASSSSGPSHAPGAA--------L--D-SESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLT 162 (249)
Q Consensus 94 ~~r~q~Llkrr~l~~~~~gs~--------~--~-~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~ 162 (249)
.||+|.|.|||++.+...... . . .........++++++.+++ +|+..|+.++..+|++|+..++|+++
T Consensus 35 ~kr~e~l~kkR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~s-~~~~~~~~a~~~~r~~ls~~~~~~i~ 113 (503)
T d1wa5b_ 35 AKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNS-DDMQEQLSATVKFRQILSREHRPPID 113 (503)
T ss_dssp CCCCSCCSCCCCC----------------------------CCHHHHHHHHSC-SSHHHHHHHHHHHHHHTCCSSSCSHH
T ss_pred HHHHHHHHhhcCCCcccccccccchhccccchhhHHHHHHHHHHHHHHHHhcC-CCHHHHHHHHHHHHHHHhcCCCchHH
Confidence 478889999997542221110 0 0 1112334568999999999 69999999999999999999999999
Q ss_pred CCCccChHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhh
Q psy1198 163 GFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRR 240 (249)
Q Consensus 163 ~fp~~glVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD 240 (249)
.+...+++|.||++|+.++++++|++|+|+|+||+++.++++..++ |++|.|++ ++.+++.++.|+|+|+|+||+.+
T Consensus 114 ~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~-lL~s~~~~i~~~a~~~L~nia~~ 192 (503)
T d1wa5b_ 114 VVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQ-LLYTGSVEVKEQAIWALGNVAGD 192 (503)
T ss_dssp HHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHH-HHHHCCHHHHHHHHHHHHHHHTT
T ss_pred HHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHH-HhcCCChhHHHHHHHHHHHHhhh
Confidence 8888999999999999888899999999999999999999998888 99999997 66678999999999999999998
Q ss_pred chh
Q psy1198 241 HSK 243 (249)
Q Consensus 241 ~p~ 243 (249)
++.
T Consensus 193 ~~~ 195 (503)
T d1wa5b_ 193 STD 195 (503)
T ss_dssp CHH
T ss_pred hHH
Confidence 875
|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|