Psyllid ID: psy1198


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
RRSSSRGGGGVGGGGHHNSGSAAAAAATSGGGQGGKAATLYGAPGGGKAATLYAQSGMSAGETQGGSVAGEEDKNAGAQGSTSTSGAASGTASTSLLSGVASSSSGPSHAPGAALDSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
ccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcc
rrsssrggggvgggghhnsgSAAAAAatsgggqggkaatlygapgggkaATLYAQSgmsagetqggsvageedknagaqgststsgaasgtasTSLLsgvassssgpshapgaaldseseDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMgnedtltgfpvkQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
rrsssrggggvgggghHNSGSAAAAAATSGGGQGGKAATLYGAPGGGKAATLYAQSGMSAGETQGGSVAGEEDKNAGAQGSTSTSGAASGTASTSLLSGVASSSSGPSHAPGAALDSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
RRsssrggggvgggghhnsgsaaaaaatsgggqggkaaTLYGAPGGGKAATLYAQSGMSAGETQGGSVAGEEDKNagaqgststsgaasgtastsllsgvassssgpshapgaalDSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
********************************************************************************************************************************LLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTAL***************
***********************************************************************************************************************************************QAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
***********************************KAATLYGAPGGGKAATLYAQSG******************************************************************TKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
*********************************************************************************************************GPSHA**********DTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RRSSSRGGGGVGGGGHHNSGSAAAAAATSGGGQGGKAATLYGAPGGGKAATLYAQSGMSAGETQGGSVAGEEDKNAGAQGSTSTSGAASGTASTSLLSGVASSSSGPSHAPGAALDSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSKAILQAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q14669 1992 E3 ubiquitin-protein liga yes N/A 0.502 0.062 0.833 7e-58
E1B7Q7 1992 E3 ubiquitin-protein liga yes N/A 0.502 0.062 0.833 8e-58
F1LP64 2025 E3 ubiquitin-protein liga yes N/A 0.502 0.061 0.833 9e-58
G5E870 2025 E3 ubiquitin-protein liga yes N/A 0.502 0.061 0.833 9e-58
B4F6W9 2056 E3 ubiquitin-protein liga yes N/A 0.502 0.060 0.833 1e-57
F1RCR6 2026 E3 ubiquitin-protein liga yes N/A 0.506 0.062 0.817 4e-56
Q6WWW4 1888 E3 ubiquitin-protein liga yes N/A 0.497 0.065 0.412 5e-20
Q9LYZ7 1502 E3 ubiquitin-protein liga no N/A 0.497 0.082 0.341 6e-13
Q10435 1647 Probable ubiquitin fusion yes N/A 0.477 0.072 0.292 4e-05
P33202 1483 Ubiquitin fusion degradat yes N/A 0.538 0.090 0.236 7e-05
>sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (92%), Gaps = 1/126 (0%)

Query: 123 ATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHN 182
           ++KAQQLL  LQA  DE QQLQAV+EMCQ+LVMGNE+TL GFPVK VVPALITLL M+HN
Sbjct: 436 SSKAQQLLQGLQA-SDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHN 494

Query: 183 FDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHS 242
           FD+MN+ACRALTYMMEALPRSSAVV+DA+P FLEKLQVIQC+DVAEQ+LTALEMLSRRHS
Sbjct: 495 FDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS 554

Query: 243 KAILQA 248
           KAILQA
Sbjct: 555 KAILQA 560




Component of PA700, an ATP-dependent multisubunit protein that activates the proteolytic activities of the multifunctional proteinase (20S proteasome) of the 26S complex. Specifically interacts with the ligand binding domain of the thyroid hormone receptor (in a thyroid hormone T3-independent manner) and with retinoid X receptor (RXR). Could be E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 Back     alignment and function description
>sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=2 SV=1 Back     alignment and function description
>sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 Back     alignment and function description
>sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 Back     alignment and function description
>sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=2 SV=1 Back     alignment and function description
>sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=1 SV=1 Back     alignment and function description
>sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 Back     alignment and function description
>sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
390342409 2243 PREDICTED: probable E3 ubiquitin-protein 0.506 0.056 0.857 2e-59
390342411 2243 PREDICTED: probable E3 ubiquitin-protein 0.506 0.056 0.857 3e-59
62822206 560 unknown [Homo sapiens] 0.502 0.223 0.833 3e-58
291235604 2140 PREDICTED: thyroid hormone receptor inte 0.506 0.058 0.850 4e-57
405954644 1942 Putative E3 ubiquitin-protein ligase TRI 0.497 0.063 0.838 5e-57
74144015 756 unnamed protein product [Mus musculus] 0.502 0.165 0.833 1e-56
183985686 1114 LOC100158539 protein [Xenopus (Silurana) 0.502 0.112 0.833 1e-56
119591305 822 thyroid hormone receptor interactor 12, 0.502 0.152 0.833 1e-56
119591308 807 thyroid hormone receptor interactor 12, 0.502 0.154 0.833 1e-56
74182645 983 unnamed protein product [Mus musculus] 0.502 0.127 0.833 2e-56
>gi|390342409|ref|XP_003725659.1| PREDICTED: probable E3 ubiquitin-protein ligase TRIP12-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 119/126 (94%)

Query: 123 ATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHN 182
           ++KA QLL  LQA GDE QQLQAV+EMCQ+LVMGNEDTL GFPVKQVVPALI+LLSM+HN
Sbjct: 529 SSKAHQLLSGLQASGDESQQLQAVIEMCQLLVMGNEDTLGGFPVKQVVPALISLLSMEHN 588

Query: 183 FDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHS 242
           FD+MN+ACRALTYMMEALPRSS+VV+DA+P FLEKLQVIQCMDVAEQSLTALEMLSRRHS
Sbjct: 589 FDIMNHACRALTYMMEALPRSSSVVMDAIPVFLEKLQVIQCMDVAEQSLTALEMLSRRHS 648

Query: 243 KAILQA 248
           KAILQA
Sbjct: 649 KAILQA 654




Source: Strongylocentrotus purpuratus

Species: Strongylocentrotus purpuratus

Genus: Strongylocentrotus

Family: Strongylocentrotidae

Order: Echinoida

Class: Echinoidea

Phylum: Echinodermata

Superkingdom: Eukaryota

>gi|390342411|ref|XP_783595.3| PREDICTED: probable E3 ubiquitin-protein ligase TRIP12-like isoform 3 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|62822206|gb|AAY14755.1| unknown [Homo sapiens] Back     alignment and taxonomy information
>gi|291235604|ref|XP_002737735.1| PREDICTED: thyroid hormone receptor interactor 12-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|405954644|gb|EKC22028.1| Putative E3 ubiquitin-protein ligase TRIP12 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|74144015|dbj|BAE22126.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|183985686|gb|AAI66201.1| LOC100158539 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|119591305|gb|EAW70899.1| thyroid hormone receptor interactor 12, isoform CRA_d [Homo sapiens] Back     alignment and taxonomy information
>gi|119591308|gb|EAW70902.1| thyroid hormone receptor interactor 12, isoform CRA_g [Homo sapiens] Back     alignment and taxonomy information
>gi|74182645|dbj|BAE34675.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
UNIPROTKB|F6X7F9 1980 TRIP12 "Uncharacterized protei 0.502 0.063 0.833 6.5e-49
UNIPROTKB|E1B7Q7 1992 TRIP12 "E3 ubiquitin-protein l 0.502 0.062 0.833 6.6e-49
UNIPROTKB|Q14669 1992 TRIP12 "E3 ubiquitin-protein l 0.502 0.062 0.833 6.6e-49
UNIPROTKB|E2R657 1993 TRIP12 "Uncharacterized protei 0.502 0.062 0.833 6.6e-49
UNIPROTKB|I3LK74 2002 TRIP12 "Uncharacterized protei 0.502 0.062 0.833 6.6e-49
UNIPROTKB|J9NRQ4 2011 TRIP12 "Uncharacterized protei 0.502 0.062 0.833 6.7e-49
MGI|MGI:1309481 2025 Trip12 "thyroid hormone recept 0.502 0.061 0.833 6.8e-49
RGD|1306607 2025 Trip12 "thyroid hormone recept 0.502 0.061 0.833 6.8e-49
UNIPROTKB|E1BZV7 2035 TRIP12 "Uncharacterized protei 0.502 0.061 0.833 8.7e-49
UNIPROTKB|B4F6W9 2056 trip12 "E3 ubiquitin-protein l 0.502 0.060 0.833 8.8e-49
UNIPROTKB|F6X7F9 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 6.5e-49, P = 6.5e-49
 Identities = 105/126 (83%), Positives = 117/126 (92%)

Query:   123 ATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALITLLSMDHN 182
             ++KAQQLL  LQA  DE QQLQAV+EMCQ+LVMGNE+TL GFPVK VVPALITLL M+HN
Sbjct:   442 SSKAQQLLQGLQA-SDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQMEHN 500

Query:   183 FDMMNNACRALTYMMEALPRSSAVVLDAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHS 242
             FD+MN+ACRALTYMMEALPRSSAVV+DA+P FLEKLQVIQC+DVAEQ+LTALEMLSRRHS
Sbjct:   501 FDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHS 560

Query:   243 KAILQA 248
             KAILQA
Sbjct:   561 KAILQA 566




GO:0005622 "intracellular" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
UNIPROTKB|E1B7Q7 TRIP12 "E3 ubiquitin-protein ligase TRIP12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14669 TRIP12 "E3 ubiquitin-protein ligase TRIP12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R657 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LK74 TRIP12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRQ4 TRIP12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1309481 Trip12 "thyroid hormone receptor interactor 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306607 Trip12 "thyroid hormone receptor interactor 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZV7 TRIP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4F6W9 trip12 "E3 ubiquitin-protein ligase TRIP12" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
G5E870TRIPC_MOUSE6, ., 3, ., 2, ., -0.83330.50200.0617yesN/A
B4F6W9TRIPC_XENTR6, ., 3, ., 2, ., -0.83330.50200.0607yesN/A
F1LP64TRIPC_RAT6, ., 3, ., 2, ., -0.83330.50200.0617yesN/A
E1B7Q7TRIPC_BOVIN6, ., 3, ., 2, ., -0.83330.50200.0627yesN/A
F1RCR6TRIPC_DANRE6, ., 3, ., 2, ., -0.81740.50600.0621yesN/A
Q14669TRIPC_HUMAN6, ., 3, ., 2, ., -0.83330.50200.0627yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
PRK13875440 PRK13875, PRK13875, conjugal transfer protein TrbL 3e-04
>gnl|CDD|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional Back     alignment and domain information
 Score = 41.0 bits (97), Expect = 3e-04
 Identities = 30/108 (27%), Positives = 44/108 (40%), Gaps = 4/108 (3%)

Query: 8   GGGVGGGGHHNSGSAAAAAATSGGGQGGKAATLYGAPGGGKAATLYAQSGMSAGETQGGS 67
           G   GGG     G+AAAA   +    G  +A   GA GG  AA     +G+      G S
Sbjct: 293 GLAAGGGAAAAGGAAAAARGGAAAAGGASSAYSAGAAGGSGAAG--VAAGLGGVARAGAS 350

Query: 68  VAGEEDKNA--GAQGSTSTSGAASGTASTSLLSGVASSSSGPSHAPGA 113
            A    + A   A  S  +S  A   ++     G A++++  + A G 
Sbjct: 351 AAASPLRRAASRAAESMKSSFRAGARSTGGGAGGAAAAAAAGAAAAGP 398


Length = 440

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG0168|consensus 1051 100.0
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.97
KOG0166|consensus 514 99.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.33
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.17
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.96
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.89
KOG0166|consensus 514 98.72
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.41
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.28
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.26
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.03
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.91
KOG4224|consensus 550 97.77
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.7
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.63
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.6
PF04826 254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.31
KOG1048|consensus 717 97.31
PF05804 708 KAP: Kinesin-associated protein (KAP) 97.29
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.17
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.86
KOG4224|consensus 550 96.84
PF05804 708 KAP: Kinesin-associated protein (KAP) 96.83
KOG2171|consensus 1075 96.64
PRK09687280 putative lyase; Provisional 96.29
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.29
KOG2160|consensus 342 96.28
PF0174997 IBB: Importin beta binding domain; InterPro: IPR00 96.28
PRK09687280 putative lyase; Provisional 96.25
PF1036392 DUF2435: Protein of unknown function (DUF2435) 96.25
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.04
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 95.94
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 95.74
PF08167165 RIX1: rRNA processing/ribosome biogenesis 95.6
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.33
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.05
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.99
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.88
PF05536 543 Neurochondrin: Neurochondrin 94.75
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 94.41
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 94.19
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 93.54
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 92.87
PF05004 309 IFRD: Interferon-related developmental regulator ( 92.78
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 92.68
KOG1059|consensus 877 92.68
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 92.65
KOG1967|consensus1030 92.56
KOG1241|consensus 859 92.19
KOG1048|consensus 717 91.99
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 91.76
KOG4199|consensus461 91.68
COG1413 335 FOG: HEAT repeat [Energy production and conversion 91.39
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 91.01
KOG1293|consensus 678 90.9
KOG0567|consensus289 90.48
KOG2171|consensus 1075 90.43
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 90.39
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 88.71
KOG0168|consensus 1051 88.58
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 87.82
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 87.48
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 86.9
KOG1820|consensus 815 86.76
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 85.89
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 85.27
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 85.06
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 85.02
TIGR02270 410 conserved hypothetical protein. Members are found 85.0
KOG2032|consensus 533 84.69
KOG1293|consensus 678 84.41
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 84.21
TIGR02270 410 conserved hypothetical protein. Members are found 84.01
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 83.95
COG1413 335 FOG: HEAT repeat [Energy production and conversion 83.08
KOG1824|consensus 1233 82.56
PF05536 543 Neurochondrin: Neurochondrin 81.59
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 81.07
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 80.82
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 80.18
PTZ00429 746 beta-adaptin; Provisional 80.16
>KOG0168|consensus Back     alignment and domain information
Probab=100.00  E-value=4.9e-41  Score=338.87  Aligned_cols=155  Identities=54%  Similarity=0.810  Sum_probs=148.4

Q ss_pred             cchhHHHHhhCCCCCCCCCCcc--------CccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCCCCC
Q psy1198          94 TSLLSGVASSSSGPSHAPGAAL--------DSESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFP  165 (249)
Q Consensus        94 ~~r~q~Llkrr~l~~~~~gs~~--------~~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~~fp  165 (249)
                      .+|+|++++.|++++|+||.+.        +.+.++.++|+++||++|++..||+.||++|.||||+|+|.||+.++.||
T Consensus       129 ~grl~~~~e~~~l~qhl~g~lgprv~~ll~rt~~~sasSk~kkLL~gL~~~~Des~Qleal~Elce~L~mgnEesLs~fp  208 (1051)
T KOG0168|consen  129 AGRLQALLEARGLPQHLFGRLGPRVLQLLHRTIGSSASSKAKKLLQGLQAESDESQQLEALTELCEMLSMGNEESLSGFP  208 (1051)
T ss_pred             hhhhhhhhhccccCcccccccchhHHHHhhhcccccchHHHHHHHHhccccCChHHHHHHHHHHHHHHhhcchhhhcccc
Confidence            3999999999999999999863        56667777899999999998669999999999999999999999999999


Q ss_pred             ccChHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhhchh
Q psy1198         166 VKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSK  243 (249)
Q Consensus       166 ~~glVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD~p~  243 (249)
                      ++.|||.||.+|++|+|+|||+.||||||||||+.|++..+||  +|||+||+||+.|+|||||||+|+|||+||++||+
T Consensus       209 v~slvp~Lv~LL~~E~n~DIMl~AcRaltyl~evlP~S~a~vV~~~aIPvl~~kL~~IeyiDvAEQ~LqALE~iSR~H~~  288 (1051)
T KOG0168|consen  209 VKSLVPVLVALLSHEHNFDIMLLACRALTYLCEVLPRSSAIVVDEHAIPVLLEKLLTIEYIDVAEQSLQALEKISRRHPK  288 (1051)
T ss_pred             HHHHHHHHHHHHhccccHHHHHHHHHHHHHHHhhccchhheeecccchHHHHHhhhhhhhhHHHHHHHHHHHHHHhhccH
Confidence            9999999999999999999999999999999999999999999  89999999999999999999999999999999999


Q ss_pred             HHhhc
Q psy1198         244 AILQA  248 (249)
Q Consensus       244 aIL~a  248 (249)
                      +||+|
T Consensus       289 AiL~A  293 (1051)
T KOG0168|consen  289 AILQA  293 (1051)
T ss_pred             HHHhc
Confidence            99996



>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF01749 IBB: Importin beta binding domain; InterPro: IPR002652 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.94
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.94
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.81
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.74
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.6
3nmz_A 458 APC variant protein; protein-protein complex, arma 99.54
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 99.53
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.52
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.44
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.39
4hxt_A 252 De novo protein OR329; structural genomics, PSI-bi 99.3
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.3
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.3
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.23
1xqr_A 296 HSPBP1 protein; armadillo repeat, superhelical twi 99.23
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.19
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.18
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.16
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.08
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.07
3tt9_A 233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.07
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.02
3nmz_A458 APC variant protein; protein-protein complex, arma 99.01
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.0
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.96
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.96
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.91
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.9
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.89
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.86
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.86
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.83
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.8
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.63
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.53
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.45
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.13
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.04
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.03
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.98
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.97
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.95
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.89
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 97.86
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.81
2qk2_A 242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.62
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.58
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.57
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.53
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.52
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.52
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.45
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.36
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.31
2qk1_A 249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.24
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.21
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.12
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 97.06
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.03
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.01
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 96.98
1qgr_A 876 Protein (importin beta subunit); transport recepto 96.91
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 96.89
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 96.85
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 96.57
3grl_A 651 General vesicular transport factor P115; vesicle t 96.55
3grl_A 651 General vesicular transport factor P115; vesicle t 96.33
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.24
4ffb_C 278 Protein STU2; tubulin fold, heat repeats, cytoskel 95.79
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 95.52
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 95.0
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.94
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 94.93
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 94.87
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 94.4
3gs3_A 257 Symplekin, LD45768P; helix-turn-helix heat repeat 91.9
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 91.44
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.93
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 90.71
2x19_B 963 Importin-13; nuclear transport, protein transport; 90.18
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 89.95
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 89.36
3eg5_B 383 Protein diaphanous homolog 1; protein-protein comp 88.25
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.13
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 87.84
2x1g_F 971 Cadmus; transport protein, developmental protein, 87.37
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 86.74
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 85.52
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 84.98
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 84.97
2x19_B 963 Importin-13; nuclear transport, protein transport; 83.93
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 83.16
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 82.38
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 81.12
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 80.67
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 80.13
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=99.94  E-value=8.4e-28  Score=225.09  Aligned_cols=148  Identities=14%  Similarity=0.213  Sum_probs=124.3

Q ss_pred             cchhHHHHhhCCCC--CCCCCCccC---ccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCCCCCccC
Q psy1198          94 TSLLSGVASSSSGP--SHAPGAALD---SESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQ  168 (249)
Q Consensus        94 ~~r~q~Llkrr~l~--~~~~gs~~~---~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~~fp~~g  168 (249)
                      .||+|.|.|||+++  ++...+.+.   .........+++|++.|+| +|+..|++|++.+|++||.+++|||+.++..|
T Consensus        41 ~kr~e~l~krR~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lv~~l~s-~d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G  119 (529)
T 3tpo_A           41 AKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINS-NNLESQLQATQAARKLLSREKQPPIDNIIRAG  119 (529)
T ss_dssp             ---CCSCSCCCCCC---------------CGGGSSCCHHHHHHHHTS-SCHHHHHHHHHHHHHHHTSSSCCCHHHHHHTT
T ss_pred             HHHHHHHHhccCCCCCcccccChhhhccchhhhHHHHHHHHHHHhcC-CCHHHHHHHHHHHHHHHcCCCCchHHHHHHCC
Confidence            48999999999975  222222221   1122334568999999999 69999999999999999999999999988999


Q ss_pred             hHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhhchh
Q psy1198         169 VVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRRHSK  243 (249)
Q Consensus       169 lVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD~p~  243 (249)
                      +||.||++|+.++++++|++|||||+||++++++++..||  |+||.|++ |+.+++.+|.|||+|||+||+.|++.
T Consensus       120 ~ip~Lv~lL~~~~~~~~q~~Aa~aL~nia~~~~~~~~~vv~~Gaip~Lv~-LL~s~~~~v~e~A~~aL~nLa~~~~~  195 (529)
T 3tpo_A          120 LIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS-LLASPHAHISEQAVWALGNIAGAGSA  195 (529)
T ss_dssp             HHHHHHHHHTCTTCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHH-HTTCSCHHHHHHHHHHHHHHHTTCHH
T ss_pred             CHHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCCHHHHHH-HHcCCCHHHHHHHHHHHHHHhccCHH
Confidence            9999999999888999999999999999999999999999  99999996 88999999999999999999998764



>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-13
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-04
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 4e-13
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-05
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-04
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 67.5 bits (163), Expect = 1e-13
 Identities = 24/131 (18%), Positives = 50/131 (38%), Gaps = 4/131 (3%)

Query: 116 DSESED-TATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLTGFPVKQVVPALI 174
           D  S   T   + + +V      + + QLQA     ++L    +  +       ++P  +
Sbjct: 3   DIGSNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV 62

Query: 175 TLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLT 232
           + L       +   +  ALT +       +  V+   A+P F+  L       ++EQ++ 
Sbjct: 63  SFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA-SPHAHISEQAVW 121

Query: 233 ALEMLSRRHSK 243
           AL  ++   S 
Sbjct: 122 ALGNIAGDGSA 132


>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.81
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.77
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.22
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1xqra1 264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.84
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.71
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.58
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.64
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 97.59
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.46
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.43
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.05
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 96.82
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.7
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 96.58
d1b3ua_588 Constant regulatory domain of protein phosphatase 96.55
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 96.33
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 96.03
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 95.93
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 95.89
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 95.5
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.17
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 95.05
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.32
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 94.11
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 93.82
d2bnxa1 343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 88.73
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 87.01
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 82.53
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.81  E-value=7.6e-21  Score=169.60  Aligned_cols=148  Identities=23%  Similarity=0.263  Sum_probs=120.7

Q ss_pred             cchhHHHHhhCCCCCCCCCCc--------c--C-ccchhhHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhcCCCCCCC
Q psy1198          94 TSLLSGVASSSSGPSHAPGAA--------L--D-SESEDTATKAQQLLVSLQAIGDEDQQLQAVVEMCQMLVMGNEDTLT  162 (249)
Q Consensus        94 ~~r~q~Llkrr~l~~~~~gs~--------~--~-~~~s~~~~rl~~Ll~~L~S~~D~~~QLeAL~eLrelLSmsnep~I~  162 (249)
                      .||+|.|.|||++.+......        .  . .........++++++.+++ +|+..|+.++..+|++|+..++|+++
T Consensus        35 ~kr~e~l~kkR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~s-~~~~~~~~a~~~~r~~ls~~~~~~i~  113 (503)
T d1wa5b_          35 AKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNS-DDMQEQLSATVKFRQILSREHRPPID  113 (503)
T ss_dssp             CCCCSCCSCCCCC----------------------------CCHHHHHHHHSC-SSHHHHHHHHHHHHHHTCCSSSCSHH
T ss_pred             HHHHHHHHhhcCCCcccccccccchhccccchhhHHHHHHHHHHHHHHHHhcC-CCHHHHHHHHHHHHHHHhcCCCchHH
Confidence            478889999997542221110        0  0 1112334568999999999 69999999999999999999999999


Q ss_pred             CCCccChHHHHHHhcCCCCCccHHHHHHHHHHHHHhcCchhHHHHh--ccHHHHHHHhhcCCChhHHHHHHHHHHHhhhh
Q psy1198         163 GFPVKQVVPALITLLSMDHNFDMMNNACRALTYMMEALPRSSAVVL--DAVPTFLEKLQVIQCMDVAEQSLTALEMLSRR  240 (249)
Q Consensus       163 ~fp~~glVP~LV~iLs~e~n~dLQ~eAArALTNIasgtp~qT~~VV--GAVPiL~~kLLsi~yiDVAEQALwALenISgD  240 (249)
                      .+...+++|.||++|+.++++++|++|+|+|+||+++.++++..++  |++|.|++ ++.+++.++.|+|+|+|+||+.+
T Consensus       114 ~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~-lL~s~~~~i~~~a~~~L~nia~~  192 (503)
T d1wa5b_         114 VVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQ-LLYTGSVEVKEQAIWALGNVAGD  192 (503)
T ss_dssp             HHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHH-HHHHCCHHHHHHHHHHHHHHHTT
T ss_pred             HHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHH-HhcCCChhHHHHHHHHHHHHhhh
Confidence            8888999999999999888899999999999999999999998888  99999997 66678999999999999999998


Q ss_pred             chh
Q psy1198         241 HSK  243 (249)
Q Consensus       241 ~p~  243 (249)
                      ++.
T Consensus       193 ~~~  195 (503)
T d1wa5b_         193 STD  195 (503)
T ss_dssp             CHH
T ss_pred             hHH
Confidence            875



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure