Psyllid ID: psy12003


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-
MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
cccccccccccccHHHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHHHcHccHHHccccccccccccccccccccHHHHHccc
mnllrdknpprgterQIKIWFQNRRMKWKKEHKMASmnvipyhyhmsqpygnpyqfthlat
mnllrdknpprgterqikiwfqnrrMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
****************IKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQF*****
*******NPPRGTERQIKIWFQNRR************************************
MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
******KNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query61 2.2.26 [Sep-21-2011]
P09077417 Homeotic protein Sex comb yes N/A 0.754 0.110 0.666 2e-14
P1585986 Homeobox protein H55 (Fra no N/A 0.639 0.453 0.857 2e-13
Q9IA11252 Homeobox protein Hox-D5 O N/A N/A 0.475 0.115 0.793 1e-07
Q1KKX0280 Homeobox protein Hox-B5b N/A N/A 0.459 0.1 0.714 1e-06
Q9PWD3281 Homeobox protein Hox-A5 O N/A N/A 0.442 0.096 0.777 1e-06
Q9YGT6265 Homeobox protein Hox-A5a yes N/A 0.459 0.105 0.75 1e-06
Q1KL14274 Homeobox protein Hox-A5a N/A N/A 0.442 0.098 0.777 2e-06
Q1KKX9319 Homeobox protein Hox-B5a N/A N/A 0.442 0.084 0.777 2e-06
Q9IA23275 Homeobox protein Hox-A5 O N/A N/A 0.459 0.101 0.75 2e-06
P24061242 Homeobox protein Hox-A7 O N/A N/A 0.442 0.111 0.814 2e-06
>sp|P09077|SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster GN=Scr PE=1 SV=5 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 11/57 (19%)

Query: 13  TERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPY--------QFTHLAT 61
           TERQIKIWFQNRRMKWKKEHKMASMN++PYH     PYG+PY        QF HL+ 
Sbjct: 364 TERQIKIWFQNRRMKWKKEHKMASMNIVPYHM---GPYGHPYHQFDIHPSQFAHLSA 417




Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Controls the segmental transformation of the first to the second thoracic segment (prothorax to mesothorax) and of the labial palps into maxillary palps. In embryo, required for fusion of labial lobes and development of the T1 denticle belt. In adult, expression in the head is necessary for proper development of the labium. In the first thoracic segment of the adult, required for proper development of the sex comb and to suppress improper prothoracic wing development.
Drosophila melanogaster (taxid: 7227)
>sp|P15859|SCR_APIME Homeobox protein H55 (Fragment) OS=Apis mellifera PE=3 SV=1 Back     alignment and function description
>sp|Q9IA11|HXD5_HETFR Homeobox protein Hox-D5 OS=Heterodontus francisci GN=HOXD5 PE=3 SV=1 Back     alignment and function description
>sp|Q1KKX0|HXB5B_TAKRU Homeobox protein Hox-B5b OS=Takifugu rubripes GN=hoxb5b PE=3 SV=1 Back     alignment and function description
>sp|Q9PWD3|HXA5_MORSA Homeobox protein Hox-A5 OS=Morone saxatilis GN=hoxa5 PE=3 SV=1 Back     alignment and function description
>sp|Q9YGT6|HXA5A_DANRE Homeobox protein Hox-A5a OS=Danio rerio GN=hoxa5a PE=2 SV=2 Back     alignment and function description
>sp|Q1KL14|HXA5A_TAKRU Homeobox protein Hox-A5a OS=Takifugu rubripes GN=hoxa5a PE=3 SV=1 Back     alignment and function description
>sp|Q1KKX9|HXB5A_TAKRU Homeobox protein Hox-B5a OS=Takifugu rubripes GN=hoxb5a PE=3 SV=1 Back     alignment and function description
>sp|Q9IA23|HXA5_HETFR Homeobox protein Hox-A5 OS=Heterodontus francisci GN=HOXA5 PE=3 SV=1 Back     alignment and function description
>sp|P24061|HXA7_COTJA Homeobox protein Hox-A7 OS=Coturnix coturnix japonica GN=HOXA7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query61
326370247 329 sex combs reduced [Publilia modesta] 0.803 0.148 0.979 6e-22
270065291 302 sex combs reduced [Oncopeltus fasciatus] 0.803 0.162 0.979 8e-22
224460203 338 sex combs reduced [Rhodnius prolixus] 0.803 0.144 0.938 2e-20
328778440 380 PREDICTED: homeotic protein Sex combs re 0.754 0.121 0.75 4e-14
383849607 373 PREDICTED: homeobox protein Hox-A5a-like 0.754 0.123 0.75 4e-14
7229537 312 sex combs reduced Scr [Tribolium castane 0.754 0.147 0.75 5e-14
350405517 372 PREDICTED: hypothetical protein LOC10074 0.754 0.123 0.75 5e-14
340727747 372 PREDICTED: hypothetical protein LOC10064 0.754 0.123 0.75 5e-14
86515396 312 cephalothorax [Tribolium castaneum] gi|1 0.754 0.147 0.75 5e-14
54607270 312 cephalothorax [Tribolium castaneum] 0.754 0.147 0.75 5e-14
>gi|326370247|gb|ADZ56089.1| sex combs reduced [Publilia modesta] Back     alignment and taxonomy information
 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 48/49 (97%), Positives = 48/49 (97%)

Query: 13  TERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT 61
           TERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHL T
Sbjct: 281 TERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLTT 329




Source: Publilia modesta

Species: Publilia modesta

Genus: Publilia

Family: Membracidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270065291|gb|ACZ60640.1| sex combs reduced [Oncopeltus fasciatus] Back     alignment and taxonomy information
>gi|224460203|gb|ACN43631.1| sex combs reduced [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|328778440|ref|XP_623903.2| PREDICTED: homeotic protein Sex combs reduced [Apis mellifera] Back     alignment and taxonomy information
>gi|383849607|ref|XP_003700436.1| PREDICTED: homeobox protein Hox-A5a-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|7229537|gb|AAF42868.1|AF227628_1 sex combs reduced Scr [Tribolium castaneum] gi|54607266|gb|AAL26542.2| cephalothorax [Tribolium castaneum] gi|54607268|gb|AAL27023.2| cephalothorax [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350405517|ref|XP_003487459.1| PREDICTED: hypothetical protein LOC100747162 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727747|ref|XP_003402198.1| PREDICTED: hypothetical protein LOC100643224 [Bombus terrestris] Back     alignment and taxonomy information
>gi|86515396|ref|NP_001034523.1| cephalothorax [Tribolium castaneum] gi|13241681|gb|AAK16422.1|AF321227_2 Scr [Tribolium castaneum] gi|270002805|gb|EEZ99252.1| sex combs reduced [Tribolium castaneum] Back     alignment and taxonomy information
>gi|54607270|gb|AAL23667.2| cephalothorax [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query61
FB|FBgn0003339417 Scr "Sex combs reduced" [Droso 0.672 0.098 0.822 9.4e-15
UNIPROTKB|P09016255 HOXD4 "Homeobox protein Hox-D4 0.360 0.086 0.863 6e-08
MGI|MGI:96208250 Hoxd4 "homeobox D4" [Mus muscu 0.360 0.088 0.863 6.9e-08
RGD|1309690251 Hoxd4 "homeo box D4" [Rattus n 0.360 0.087 0.863 7e-08
UNIPROTKB|F1RZG0257 HOXD4 "Uncharacterized protein 0.360 0.085 0.863 7.9e-08
UNIPROTKB|A7MBD6258 HOXD4 "Uncharacterized protein 0.360 0.085 0.863 8.1e-08
UNIPROTKB|F1NLW0187 LOC100858514 "Uncharacterized 0.393 0.128 0.916 1.1e-07
RGD|1587253105 Hoxa7 "homeobox A7" [Rattus no 0.344 0.2 1.0 1.4e-07
UNIPROTKB|P09634105 Hoxa7 "Homeobox protein Hox-A7 0.344 0.2 1.0 1.4e-07
UNIPROTKB|Q90VZ9219 HOXA7 "Homeobox protein Hox-A7 0.393 0.109 0.916 1.8e-07
FB|FBgn0003339 Scr "Sex combs reduced" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 9.4e-15, P = 9.4e-15
 Identities = 37/45 (82%), Positives = 40/45 (88%)

Query:    13 TERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPY-QF 56
             TERQIKIWFQNRRMKWKKEHKMASMN++PYH  M  PYG+PY QF
Sbjct:   364 TERQIKIWFQNRRMKWKKEHKMASMNIVPYH--MG-PYGHPYHQF 405




GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA;IMP
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007494 "midgut development" evidence=TAS
GO:0007379 "segment specification" evidence=NAS
GO:0007381 "specification of segmental identity, labial segment" evidence=TAS
GO:0045498 "sex comb development" evidence=IMP;NAS
GO:0007548 "sex differentiation" evidence=TAS
GO:0007432 "salivary gland boundary specification" evidence=NAS;TAS
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
UNIPROTKB|P09016 HOXD4 "Homeobox protein Hox-D4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96208 Hoxd4 "homeobox D4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309690 Hoxd4 "homeo box D4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZG0 HOXD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBD6 HOXD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLW0 LOC100858514 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1587253 Hoxa7 "homeobox A7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P09634 Hoxa7 "Homeobox protein Hox-A7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q90VZ9 HOXA7 "Homeobox protein Hox-A7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P09067HXB5_HUMANNo assigned EC number0.71420.45900.1040yesN/A
P09077SCR_DROMENo assigned EC number0.66660.75400.1103yesN/A
Q90VZ9HXA7_CHICKNo assigned EC number0.81480.44260.1232yesN/A
Q9YGT6HXA5A_DANRENo assigned EC number0.750.45900.1056yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-08
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 3e-07
smart0038957 smart00389, HOX, Homeodomain 9e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 45.2 bits (108), Expect = 1e-08
 Identities = 14/18 (77%), Positives = 17/18 (94%)

Query: 13 TERQIKIWFQNRRMKWKK 30
          TERQ+K+WFQNRR KWK+
Sbjct: 40 TERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 61
KOG0489|consensus261 99.66
KOG0487|consensus308 99.62
KOG0848|consensus317 99.6
KOG0850|consensus245 99.59
KOG0488|consensus309 99.59
KOG0844|consensus 408 99.58
KOG0842|consensus307 99.57
KOG0485|consensus268 99.5
KOG0484|consensus125 99.5
KOG0843|consensus197 99.47
KOG0492|consensus246 99.47
KOG0491|consensus194 99.45
KOG0483|consensus198 99.39
KOG2251|consensus 228 99.39
KOG0494|consensus 332 99.34
KOG0847|consensus288 99.27
KOG4577|consensus 383 99.17
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.16
KOG0493|consensus342 99.07
KOG0486|consensus 351 99.06
KOG3802|consensus398 99.0
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.99
COG5576156 Homeodomain-containing transcription factor [Trans 98.97
KOG0490|consensus235 98.94
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.89
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.82
KOG0849|consensus354 98.46
KOG0775|consensus304 98.23
KOG1168|consensus385 98.17
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.75
KOG0490|consensus235 97.41
KOG0774|consensus334 96.46
KOG1146|consensus 1406 95.86
PF1066860 Phage_terminase: Phage terminase small subunit; In 94.54
KOG3623|consensus 1007 94.14
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 93.87
KOG0773|consensus342 92.06
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 89.94
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 87.48
COG5484 279 Uncharacterized conserved protein [Function unknow 86.28
PF0605658 Terminase_5: Putative ATPase subunit of terminase 85.86
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 85.57
KOG2252|consensus558 83.1
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 82.04
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 81.88
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 80.88
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 80.41
>KOG0489|consensus Back     alignment and domain information
Probab=99.66  E-value=1.9e-17  Score=106.23  Aligned_cols=35  Identities=60%  Similarity=0.880  Sum_probs=31.7

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhhccC
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMN   38 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~~   38 (61)
                      .|||..|+|+|+|||||||||||||||..+.....
T Consensus       190 iEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~~~~  224 (261)
T KOG0489|consen  190 IEIAHALNLTERQIKIWFQNRRMKWKKENKAKSSQ  224 (261)
T ss_pred             HHHHhhcchhHHHHHHHHHHHHHHHHHhhcccccc
Confidence            48999999999999999999999999998866654



>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>COG5484 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-06
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 1e-05
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 1e-05
1hom_A68 Determination Of The Three-Dimensional Structure Of 1e-05
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 4e-05
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 1e-04
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 4e-04
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 7e-04
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 21/21 (100%), Positives = 21/21 (100%) Query: 13 TERQIKIWFQNRRMKWKKEHK 33 TERQIKIWFQNRRMKWKKEHK Sbjct: 68 TERQIKIWFQNRRMKWKKEHK 88
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-12
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-12
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-11
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-11
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-11
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-11
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 3e-11
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-11
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 6e-11
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 8e-11
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-10
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-10
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-10
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-10
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-10
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-10
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-09
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-08
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-07
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-07
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-07
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 9e-07
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 5e-06
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 9e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-05
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-05
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-05
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-05
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 4e-05
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-05
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-05
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-04
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-04
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-04
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 54.8 bits (132), Expect = 2e-12
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 13 TERQIKIWFQNRRMKWKKEHK 33
          ++ Q+K W+QNRRMKWKK   
Sbjct: 57 SQLQVKTWYQNRRMKWKKSGP 77


>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.64
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.58
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.55
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.55
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.54
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.54
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.53
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.53
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.53
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.52
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.52
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.52
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.52
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.52
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.51
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.51
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.51
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.5
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.5
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.5
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.5
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.5
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.5
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.49
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.49
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.48
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.48
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.48
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.48
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.48
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.48
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.48
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.48
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.48
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.47
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.47
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.47
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.47
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.46
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.46
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.45
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.45
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.45
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.44
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.44
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.44
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.44
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.44
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.43
2e19_A64 Transcription factor 8; homeobox domain, structura 99.43
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.42
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.42
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.41
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.39
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.39
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.39
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.39
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.39
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.36
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.36
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.35
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.34
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.34
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.32
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.3
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.3
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.3
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.28
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.27
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.27
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.17
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.15
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.15
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.11
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.07
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.05
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.76
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.29
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 88.12
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 88.03
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 85.37
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 82.04
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.64  E-value=5.7e-18  Score=93.51  Aligned_cols=36  Identities=19%  Similarity=0.370  Sum_probs=31.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhhcc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASM   37 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~   37 (61)
                      +..+||..|||+|++|+|||||||+|||+.+.....
T Consensus        40 ~r~~LA~~lgLte~qVkvWFqNRR~k~rk~~~~~~~   75 (89)
T 2ecb_A           40 ELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEI   75 (89)
T ss_dssp             HHHHHHHHTCCCHHHHHHHHHHHHHHHHSCCSCCCC
T ss_pred             HHHHHHHHhCcChHHCeecccccchHHHHHHHHhhc
Confidence            457899999999999999999999999997765444



>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 61
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 5e-09
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-08
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-08
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-08
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 9e-08
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-07
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-07
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-07
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 5e-07
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 9e-07
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 9e-07
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-06
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-06
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 4e-06
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-05
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-05
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-05
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-05
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-05
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 4e-05
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-05
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-05
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-04
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-04
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-04
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 3e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-04
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
 Score = 44.8 bits (106), Expect = 5e-09
 Identities = 19/20 (95%), Positives = 20/20 (100%)

Query: 13 TERQIKIWFQNRRMKWKKEH 32
          TERQIKIWFQNRRMKWKKE+
Sbjct: 37 TERQIKIWFQNRRMKWKKEN 56


>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.59
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.55
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.54
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.54
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.54
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.53
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.52
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.5
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.49
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.49
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.48
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.48
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.47
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.43
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.43
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.41
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.41
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.4
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.38
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.38
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.38
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.34
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.33
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.33
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.29
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.25
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.25
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.24
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.2
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.96
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.89
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 83.68
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 80.31
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
Probab=99.59  E-value=9.7e-18  Score=84.57  Aligned_cols=30  Identities=63%  Similarity=0.946  Sum_probs=27.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +..+||..|||++.+|+|||||||+|+||+
T Consensus        26 ~r~~LA~~l~l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_          26 RRIEIAHALSLTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             HHHHHHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhCCChhHeeeccccchhhhhhc
Confidence            467999999999999999999999999985



>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure